SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoEE1000_internal:A_BomoEE_comp22178_c1_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
PREDICTED:_C3_and_PZP-like_alpha-2-macroglobulin_domain-containing_protein_8_[Papilio_machaon]
Ontology
GO:0004866 F endopeptidase inhibitor activity
GO:0004867 F serine-type endopeptidase inhibitor activity
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0010466 P negative regulation of peptidase activity
GO:0010951 P negative regulation of endopeptidase activity
GO:0030414 F peptidase inhibitor activity
RNA-seq EntryA_BomoEE_comp22178_c1_seq1
Sequence
(Amino Acid)
LVADYVLPKFNMEMNIPKEVLFSDGRFNINVTAKHFNGLPVRGEVTFSAYAVFFSGLLQP
VVGSPARKVADINGQVEVTYDLKTDLDLAEDAARPLVVEAILEEKDT
(34 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).