SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoEE10003_complete:A_BomoEE_comp63838_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC101742676_isoform_X1_[Bombyx_mori]
Ontology
RNA-seq EntryA_BomoEE_comp63838_c0_seq1
Sequence
(Amino Acid)
MADCGPRLKYAWGDALESSDCPGPDGSPYPRHLINRAIKSGPWSQSSRQGRAARTLDPAI
MRRALLDAHSSYSEGSTSAQTANNRTGRAVNLPTIPSSAQAGNTCGGGRLCKTRYNTTAP
MYGVSLTSGQPVTIVQKFPDLLQQVVFEVCESSECSVIRGTCTQTYVPYLFLVLPLGPVT
FTGQDYVLVESGCVCRPNPMP
*(66 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).