SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10026_3prime_partial:A_BomoASG_c26008_g1_i2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
uncharacterized_protein_LOC101739846_[Bombyx_mori]
Ontology
GO:0003676 F nucleic acid binding
GO:0008270 F zinc ion binding
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoASG_c26008_g1_i2
Sequence
(Amino Acid)
MKCHYEILNIVKEASASEIKKAYRRLALQWHPDKNLENLQEAKEQFQLVQNAYEVLSDPQ
ERAWYDNHREQLLRGAGSSYNDDSLDVYPYFSPSCYKGFGDDPQGFYGVYAEVFSKLTTE
EIDFLDDPEDVIKIPKFGNSTTEYEQVHEFYSFWTAFSTNKSYVWLDQYEIKQGDNRRVI
KLMEKENNKIRQKARRERNEEIRRLACFVRRKDKRVIEHTKLLQEKAEENKRKAEQMRRE
RIIQRQKEIEEAKKKEGESSFLQSDEYQKKLSEIESLLAEEFGLSSDDTISEGGMESSNE
ESSKTEEVSEASKATAKSPTKSKSSMKNLYCSACNKLFKNVKSFENHENSKKHKENVAKM
TLDDDIGISDVDDEENEDVEQTPATQEGPREPVKINGLTEDEKEPLGNSTSDIEDNDIRE
TLSDDSGKVKPLPKCLKKKKNKKKSFNPMPESEGNDSHDEMSFNEIEGPSRCRKAKKFNM
LKSQIQAKKEANLKKGNQSQTSTENLYEVSSTTPTDDALGESALPRDRPALPKTQRTVKT
KKPIDRKPARMKASETEDSSTTRLSCVVCDSDFPSKNKLFEHLKITGHSVPLPHTSFTQS
KKGKRA
(201 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).