SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10021_5prime_partial:A_BomoASG_c26007_g1_i6
Scaffold_idBomo_Chr14
NCBI non-redundant
(nr)
cleavage_and_polyadenylation_specificity_factor_subunit_CG7185_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005634 C nucleus
GO:0005849 C mRNA cleavage factor complex
GO:0006379 P mRNA cleavage
GO:0006397 P mRNA processing
RNA-seq EntryA_BomoASG_c26007_g1_i6
Sequence
(Amino Acid)
GSIFSQLRKMADGDVDIDLYADDIESDFNRQDEFAGENVDLYDDVISAPASKPEDGDGPP
IIAPNQHPPEETNGNASYHGPVHGHHGRRFQLYVGNLTWWATDQDIANAISDVGVSDFQD
VKFFENRANGQSKGFCVISLGSDQSVRMVMERLSKKEIHGQHPVVTLPTKQALNQFESQS
KTRSTPPGPNNPGMRGPHPGGPPGPHPGEFFGGGPNGPGGGGPRMMLPGPGPHQLRGPPP
HHMGPHQGGPHPMQHQPQPHQAPPHRPPMQFAGPPQMQRAPGPRPPPPDWAARAPHPMSQ
PAPHYGPPHHGMPHQMPPPHPGMPPPHQLPPHQPPRGPAPMPQHPVIPGAPAPHVNPAFF
NQQPPSQPPPMQAPQPGPPGPGAPYGHPAHGAPPPAQGPPPGSRQPYGRPPQSYPPQADP
ARPPHHPAPMVPQHAASLAPPMPVISEAEFEEVMSRNRTVSSSAIARAVSDAAAGEYASA
IETLVTAISLIKQSKVAQDDRCKILISSLQDTLHGVETKSYSSGERSRRSRSREREPRHH
RAPRRRDRSSSRYRDRSRDREDRDRYYRDYRERERERSRSRDRDRADHYNRGHSREERAR
KSPAEATAEGTTAEAGSKSRSTGAPYYDERYRERRDRDPPPADRDRDRDHRRDARH
*(218 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).