SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG1001_5prime_partial:A_BomoASG_c6360_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
vinculin-like_[Helicoverpa_armigera]
Ontology
GO:0003779 F actin binding
GO:0005198 F structural molecule activity
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005925 C focal adhesion
GO:0006909 P phagocytosis
GO:0007016 P obsolete cytoskeletal anchoring at plasma membrane
GO:0007155 P cell adhesion
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0030054 C cell junction
GO:0048812 P neuron projection morphogenesis
GO:0051015 F actin filament binding
RNA-seq EntryA_BomoASG_c6360_g1_i1
Sequence
(Amino Acid)
SAAAPPRPPPPADTDDEGEDIFRRQPHPSQPILVAAHNLHKAVREWSSKDNEIIAAAKRM
AILMARLSELVRSDSKGSKRELIATAKAIAEASEEVTRLAKKLALECTDKRIRTNLLQVC
ERIPTIGTQLKILSTVKATMLGAQGSEEDQEATEMLVGNAQNLMQSVKETVKASEGASIK
IRTEQGGYRLRWVRRSPWYQI
*(66 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).