SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10010_3prime_partial:A_BomoASG_c26005_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
phosphatidylinositol_N-acetylglucosaminyltransferase_subunit_A_isoform_X1_[Bombyx_mori]
Ontology
GO:0000506 C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0005515 F protein binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006506 P GPI anchor biosynthetic process
GO:0008194 F UDP-glycosyltransferase activity
GO:0009893 P positive regulation of metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016254 P preassembly of GPI anchor in ER membrane
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0017176 F phosphatidylinositol N-acetylglucosaminyltransferase activity
RNA-seq EntryA_BomoASG_c26005_g1_i1
Sequence
(Amino Acid)
MDTRKKRQVVCMASDFFYPNTGGVEEHIFNLSQCLIKRGHKVIVLTHSYGDRVGIRYLTA
GLKVYYLPIRVFYAQCVLPTMICNIALIRNILIRECIEIVHGHSAFSVLCHEVCIIGKLM
GLKTVFTDHSLFGFADTSAVLTNKYLQICLSEIDHCICVSHTGKENTVLRAKVQAHKVSV
IPNAVDAFSFIPDPCQRDQKFITIVIVSRLVYRKGVNLMAAVIADMCPRYPNLRFIIGGD
GPKMWLLQEVREKIGCQESVRLLGSLKHSEVRNVLVKGDIFLNTSLTEAYCMAIVEAAAC
GLKVVSTKVGGIPEVLPESMIYLTEPNVGSLVRGIEKAITDIKEGNIMCPFKCNRLVREM
YSWMDITKRTEIVYDRILLNKNKPLGQQLRSYLNSGVWPFLLVISLMYILLQLTERIYKR
KYIDKAR
(141 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).