SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10009_5prime_partial:A_BomoASG_c26004_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
uncharacterized_protein_LOC101746411_[Bombyx_mori]
Ontology
GO:0008152 P metabolic process
GO:0016491 F oxidoreductase activity
GO:0047936 F glucose 1-dehydrogenase [NAD(P)] activity
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomoASG_c26004_g1_i1
Sequence
(Amino Acid)
LHGVDVMSFTNKVVLVTGGSSGIGASAAVHFAKEGADVAIVGRNVTKLDNVARECAQVGK
KPLIIKADISNDEEAKTIVQQTIDAFGKLDVLINNAGMNKSGSLLAGNLLESYDAVTATN
LRAVILITSLAAPHLIETKGNIINVSSIGGTMVPMPGFLAYCMGKASLNHFTRGIALELA
PRGVRANIISPGPVLTDIIENSDNQISWDIFRAATALKKLGEPSEIAELMLFLASDKARS
ITGSNYVSDNGMLLLR
*(84 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).