SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10008_internal:A_BomoASG_c26002_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
crossover_junction_endonuclease_MUS81_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005634 C nucleus
GO:0006259 P DNA metabolic process
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0016787 F hydrolase activity
GO:0046872 F metal ion binding
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
RNA-seq EntryA_BomoASG_c26002_g1_i1
Sequence
(Amino Acid)
ISSFIDSASVDKQNKSSSSQLFSNDCLKDTSKGSPVVESSNQDQDTPGSSSACSLEDTLS
NIAIEFPKGSFDVILLIDKNETSGLSKKNDPTMVQFKKFPDLKHEYRSLKVGDFLWIARH
RVNNEELVLPYIIERKRMDDLGASIKDGRFHEQKFRLKKCGLKHVIYLIENYGKNKHVGL
PLQALRQALANTKVQDGFKIHMT
(66 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).