SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10005_complete:A_BomoASG_c26000_g1_i2
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
probable_ATP-dependent_RNA_helicase_DDX52_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0006364 P rRNA processing
GO:0010501 P RNA secondary structure unwinding
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0044822 F RNA binding
RNA-seq EntryA_BomoASG_c26000_g1_i2
Sequence
(Amino Acid)
MDAYDIFKKLTKGLSFKKPVLGVKNNQQKTKQETLKQEIEIKKEELSDFEDVAEIENDLE
NSQPSSGSEEEELELVDGVKVGKKKRGKKKKEITEDLKKKLLQEEENRFRNEHGIKAVGR
HIPPALKDFSDLTVRYNVPQALVDTVTQCGYSEPTPVQRQAMACMLEDRQIVACAPTGSG
KTAAFIVPLLHTLGTHQGGPRALILCPTRELAHQIYREALRLSASTQLRVTVVKNLKESK
VKEREATFRKSDIVISTPNRLCYLLNQDQVNISLEKVRWLIIDEADKLFEGSSEQESDFR
QQLEQIMCRCGPKRLIAMFSATHTPPVARWSRRHLRGLVNVTVGHRNAATSLVEQQLLYC
GNEDGKLVAFRQLVQQGLKPPVLVFVQSKDRAKQLFKELIYDGINVDVIHADRTQAQRDN
VVRSFRVGRIWVLISTELMGRGIDFRGVNLVINYDFPPSAISYVHRIGRAGRAGHRGRAV
TFFTQDDVVNLRSIASVMKQSGCEVPEYMLRLKQDSNKRKRLLKKAPHRDKISTILEKPV
KRKLEEGKDSNVNSKDTEKIKNGKHKKQRKIDGTKENGARRSTSEKENKRKKFKKNKKIK
LTKKPKSGS
*(202 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).