SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10002_internal:A_BomoASG_c25994_g1_i1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
guanine_nucleotide_exchange_factor_subunit_Rich_[Helicoverpa_armigera]
Ontology
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017112 F guanyl-nucleotide exchange factor activity
GO:0017137 F small GTPase binding
GO:0032588 C trans-Golgi network membrane
GO:0034066 C Ric1-Rgp1 guanyl-nucleotide exchange factor complex
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043234 C protein-containing complex
GO:0043547 P positive regulation of GTPase activity
GO:1903363 P negative regulation of cellular protein catabolic process
RNA-seq EntryA_BomoASG_c25994_g1_i1
Sequence
(Amino Acid)
CGSLGARVWLPLLPRDATRHPDSGRHTFMAKRIMLPFHLNIYPLTILFDDAILLGAENDT
TLYASDSNSVFSLPFCVVNRTSQVYLHQILRQLLRRNLGYHAWEIARSCSQLAYFPHSLE
LLLHEVLEEEATSKEPIPDAQLPSIIEFVQEFPVYLETVVQ
(52 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).