SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoASG10000_complete:A_BomoASG_c25993_g1_i6
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
pyruvate_carboxylase,_mitochondrial_isoform_X7_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003677 F DNA binding
GO:0003824 F catalytic activity
GO:0004075 F biotin carboxylase activity
GO:0004736 F pyruvate carboxylase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0005829 C cytosol
GO:0006090 P pyruvate metabolic process
GO:0006094 P gluconeogenesis
GO:0006107 P oxaloacetate metabolic process
GO:0006629 P lipid metabolic process
GO:0006768 P biotin metabolic process
GO:0008152 P metabolic process
GO:0009374 F biotin binding
GO:0010629 P negative regulation of gene expression
GO:0016874 F ligase activity
GO:0019074 P viral RNA genome packaging
GO:0031406 F carboxylic acid binding
GO:0044791 P obsolete positive regulation by host of viral release from host cell
GO:0044794 P positive regulation by host of viral process
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoASG_c25993_g1_i6
Sequence
(Amino Acid)
MQILKARFALRATASQFQAWSSAKTRTAATDSKIVEYKPIRSVLVANRGEIAIRVFRACT
ELGIRSVAIYSEQDKLQMHRQKADESYIVGKGLPPVEAYLSIPEIIRVAKENDVDAVHPG
YGLLSERADFAQAIINAGLRFIGPSPKVVQQMGDKVAARKAAIEAKVPIVPGTDGPVTTK
EEAVEFCKSHGLPVILKAAYGGGGRGMRVVRKMEEVPSAFERASSEALGAFGNGSMFIER
FIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPKLDPKIRQKMVECATH
LARHVGYENAGTVEFLLDDKGNFYFIEVNARLQVEHTITEEVTGIDLVQSQIRIAEGMTL
PELGLTQDKIQAQGYAIQCRVTTEDPANNFQPSTGRIEVFRSGEGMGIRLDSASTYAGAV
ISPYYDSLLVKVISHAHDLPSSAAKMNRALREFRIRGVKTNIPFLLNVLENQKFLNGSVD
TYFIDENPQLFMFKASQNRAQKILNYLGYVLVNGPATPLATKIPPSDVKPYIPQVPLVRF
GSAVQPPKGYKQILDEGGPEAFAKAVRQHKGLLLMDTTFRDAHQSLLATRVRTHDLLAVS
PYVAHNFNNLYSLENWGGATFDVALRFLHECPWERLHDMRQLIPNIPFQMLLRGANAVGY
TNYPDNVVFKFCDMAVQAGMDIFRVFDSLNYLPNLVLGMEAAAKAGGVVEAAISYTGDVS
DPSKTKYDLKYYTKLADDLVKAGTHVLAIKDMAGLLKPQAAKLLIGAIRAAHPHVPLHVH
THDTSGAGVAAMLACAEAGADVVDVAVDSVSGLTSQPSMGALVASLQGTPLDTKIPLQKV
SEYSAYWEQARTLYGPFECTATMKSGNADVYLNEIPGGQYTNLQFQAFSLGLGSQFEEVK
KAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNKLTAADINARAEELSFPKSVVEYLQGA
IGIPYGGFPEPLRSKVLKDMPRIEGRPGKELPSLNFDKLKGELKESFPDINDEDVMSAAM
YPQVASDFFRFRDKYGPVKHLDTKTFLVGPAVGDTIEVKIERGKTLDIRTVAVSEDMTAA
GEREVFFELNGQLRSVFIRDENASKEMKIHPKAVKGDKNQVGAPMPGTVLTIKVKEGDKV
EKGQPIAVLSAMKMEMIVQAPKAGTVKTVSITNGQKLEGDDLICTIE
*(395 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).