SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG1466_internal:A_BomaASG_c10000_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		endoribonuclease_ZC3H12A_[Bombyx_mori]
Ontology
GO:0000932 C P-body
GO:0001525 P angiogenesis
GO:0002376 P immune system process
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0003730 F mRNA 3'-UTR binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004521 F endoribonuclease activity
GO:0004532 F exoribonuclease activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005791 C rough endoplasmic reticulum
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006915 P apoptotic process
GO:0006954 P inflammatory response
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0010508 P positive regulation of autophagy
GO:0010595 P positive regulation of endothelial cell migration
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010656 P negative regulation of muscle cell apoptotic process
GO:0010884 P positive regulation of lipid storage
GO:0010942 P positive regulation of cell death
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0030154 P cell differentiation
GO:0030867 C rough endoplasmic reticulum membrane
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032715 P negative regulation of interleukin-6 production
GO:0032720 P negative regulation of tumor necrosis factor production
GO:0035198 F miRNA binding
GO:0035613 F RNA stem-loop binding
GO:0035925 F mRNA 3'-UTR AU-rich region binding
GO:0036459 F thiol-dependent deubiquitinase
GO:0042347 P negative regulation of NIK/NF-kappaB signaling
GO:0042406 C extrinsic component of endoplasmic reticulum membrane
GO:0043124 P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045019 P negative regulation of nitric oxide biosynthetic process
GO:0045600 P positive regulation of fat cell differentiation
GO:0045766 P positive regulation of angiogenesis
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0050713 P negative regulation of interleukin-1 beta production
GO:0051259 P protein complex oligomerization
GO:0055118 P negative regulation of cardiac muscle contraction
GO:0061014 P positive regulation of mRNA catabolic process
GO:0061158 P 3'-UTR-mediated mRNA destabilization
GO:0071222 P cellular response to lipopolysaccharide
GO:0071356 P cellular response to tumor necrosis factor
GO:0090501 P RNA phosphodiester bond hydrolysis
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
GO:1900016 P negative regulation of cytokine production involved in inflammatory response
GO:1900165 P negative regulation of interleukin-6 production
GO:1902714 P negative regulation of interferon-gamma production
GO:1903799 P negative regulation of production of miRNAs involved in gene silencing by miRNA
GO:1904468 P negative regulation of tumor necrosis factor production
GO:1904628 P cellular response to phorbol 13-acetate 12-myristate
GO:1904637 P cellular response to ionomycin
GO:1990869 P cellular response to chemokine
GO:2000379 P positive regulation of reactive oxygen species metabolic process
GO:2000627 P positive regulation of miRNA catabolic process
RNA-seq EntryA_BomaASG_c10000_g1_i1
Sequence
(Amino Acid)
SQQPPRAPSPPPPAEVDPTPERSPLRQIVIDGSNVAMSHGNKEVFSCRGIEICVDWFRAR
GHKEIIVFVPKWRKEASRPDNPVADRDVLDRLERDRVLVYTPSRLLGGKRLVCYDDRYVL
RLAADTDGIVVSNDNYRDLAAESPDFRRVVEERLLMYSFVNDRFMPPEDPLGRTGPTLDA
FLRIPPSRVEPP
(63 a.a.)

- SilkBase 1999-2023 -