GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000052-TA|BGIBMGA000052-PA|IPR012338|Penicillin-binding
protein, transpeptidase fold, IPR012464|Protein of unknown function
DUF1676
         (222 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_22306| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.4  

>SB_22306| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 355

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 49  NPEEKLNRFLLYRLQDYLDGHSLKYKLLDPQ 79
           NP+ KL  F L++    L+ + L+YK+  P+
Sbjct: 224 NPKNKLKTFRLFKSNYKLEDYLLEYKITKPR 254


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.316    0.136    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,474,209
Number of Sequences: 59808
Number of extensions: 105651
Number of successful extensions: 138
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 137
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 16,821,457
effective HSP length: 79
effective length of query: 143
effective length of database: 12,096,625
effective search space: 1729817375
effective search space used: 1729817375
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 58 (27.5 bits)