BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30161 (676 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3DP00 Cluster: ABC transporter, ATP-binding protein; n... 38 0.22 UniRef50_A6VL98 Cluster: Tripartite ATP-independent periplasmic ... 37 0.51 UniRef50_UPI0000F219D1 Cluster: PREDICTED: hypothetical protein;... 34 2.7 UniRef50_Q7KPI8 Cluster: Aminopeptidase-1; n=3; Caenorhabditis e... 33 4.8 UniRef50_Q747Y4 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_Q245H6 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_A2E5Q6 Cluster: Beige/BEACH domain containing protein; ... 33 8.4 >UniRef50_Q3DP00 Cluster: ABC transporter, ATP-binding protein; n=7; Streptococcus agalactiae|Rep: ABC transporter, ATP-binding protein - Streptococcus agalactiae 515 Length = 282 Score = 37.9 bits (84), Expect = 0.22 Identities = 21/72 (29%), Positives = 35/72 (48%) Frame = +2 Query: 461 STNGILICKSHIMRDVNVIPRRLKVVRRGPEIKIGNFPNAGSSISLGKHWPLTENMPVFV 640 STN I+I +HI+ DV + + + V++ G I+ GN +I GK W +T + Sbjct: 176 STNKIIILSTHIVSDVEAVAKEIIVLKNGKFIEHGNTAQLLKTIE-GKVWEITTEPGLSQ 234 Query: 641 TPDFVSTDSDFF 676 P+ + F Sbjct: 235 IPNIAIVNEKVF 246 >UniRef50_A6VL98 Cluster: Tripartite ATP-independent periplasmic transporter DctQ component precursor; n=1; Actinobacillus succinogenes 130Z|Rep: Tripartite ATP-independent periplasmic transporter DctQ component precursor - Actinobacillus succinogenes 130Z Length = 169 Score = 36.7 bits (81), Expect = 0.51 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = +2 Query: 137 IFLNIPGGLIFFNLRRKIIFVSGLIWSDRNDVSSQVFKYLVHISNV 274 + L + L+FFN+ + F SGL+WS+ +VS VF Y++++ + Sbjct: 18 VMLAVMIALVFFNVILRFFFNSGLVWSE--EVSRYVFVYVIYLGAI 61 >UniRef50_UPI0000F219D1 Cluster: PREDICTED: hypothetical protein; n=3; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 682 Score = 34.3 bits (75), Expect = 2.7 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = -2 Query: 258 TRYLNTWLETSLRSLQISPDTK---IILRRRLKNISPPGMFKNIKDVNSTNTSDNQLIKL 88 T +NT L++S ++++S D K I RR+ I PG +K + +N S QLI+ Sbjct: 100 TSVINTVLQSSETAVKVSTDVKTEGFIDGRRICLIESPGWWKTFNLTDLSNISKQQLIRR 159 Query: 87 VSRLA 73 +S ++ Sbjct: 160 ISLIS 164 >UniRef50_Q7KPI8 Cluster: Aminopeptidase-1; n=3; Caenorhabditis elegans|Rep: Aminopeptidase-1 - Caenorhabditis elegans Length = 609 Score = 33.5 bits (73), Expect = 4.8 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -2 Query: 138 IKDVNSTNTSDNQLIKLVSRLAEADRETATSSIPYHTMTGAL*TI 4 ++ VN D++ KLV L AD + A SS+PY + L TI Sbjct: 353 VRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTI 397 >UniRef50_Q747Y4 Cluster: Putative uncharacterized protein; n=1; Geobacter sulfurreducens|Rep: Putative uncharacterized protein - Geobacter sulfurreducens Length = 1175 Score = 33.1 bits (72), Expect = 6.3 Identities = 21/80 (26%), Positives = 45/80 (56%), Gaps = 6/80 (7%) Frame = -2 Query: 318 QNIHSNILNGVRVHVTLDMCTRYLNTWLETSLRSLQISPDTKI---ILRR---RLKNISP 157 + +H IL+GVR+ + D + L T ++ + +PDT+I ++RR ++ Sbjct: 111 RTLHRIILDGVRLTLVRDRSGTWNLARLATGMKGKKPAPDTRIGEVVVRRGSLAVEGHRM 170 Query: 156 PGMFKNIKDVNSTNTSDNQL 97 G+ N++D+++ T+D++L Sbjct: 171 EGIDLNLRDLSTQGTTDSRL 190 >UniRef50_Q245H6 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1610 Score = 33.1 bits (72), Expect = 6.3 Identities = 23/72 (31%), Positives = 34/72 (47%) Frame = -2 Query: 255 RYLNTWLETSLRSLQISPDTKIILRRRLKNISPPGMFKNIKDVNSTNTSDNQLIKLVSRL 76 + +N L T+L Q S + + R+K I +F+ + V S SDNQ +L Sbjct: 56 KIINDELITTLSESQTSSE---FIEERIKEIIENQLFQEKEQVISKLASDNQAFQLKIEQ 112 Query: 75 AEADRETATSSI 40 E D +T SSI Sbjct: 113 LEIDNQTLASSI 124 >UniRef50_A2E5Q6 Cluster: Beige/BEACH domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Beige/BEACH domain containing protein - Trichomonas vaginalis G3 Length = 2367 Score = 32.7 bits (71), Expect = 8.4 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 7/64 (10%) Frame = -2 Query: 324 WYQNIHSNILNGVRVHVTLDMCTRYLNTWLETSLRSLQISPDT----KIILRRR---LKN 166 W QN + +V + ++ ++ +N W++T+ SLQ SP T KII + + KN Sbjct: 2002 WAQNSFDFVYKHRKV-LECELVSKQINKWIDTTFGSLQKSPPTNYPPKIIFKSKHPQRKN 2060 Query: 165 ISPP 154 I PP Sbjct: 2061 IPPP 2064 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,083,058 Number of Sequences: 1657284 Number of extensions: 14798088 Number of successful extensions: 33173 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33169 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52066120554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -