BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30154 (459 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1HPQ5 Cluster: Serine proteinase-like protein; n=3; Ob... 53 3e-06 UniRef50_Q011V3 Cluster: Homology to unknown gene; n=2; Ostreoco... 33 2.2 UniRef50_Q4TVW4 Cluster: Internal virion protein C; n=1; Vibriop... 32 5.2 UniRef50_Q8LMB1 Cluster: Putative uncharacterized protein OSJNBa... 32 6.8 UniRef50_A1VH41 Cluster: Putative uncharacterized protein; n=2; ... 31 9.0 UniRef50_Q01GP0 Cluster: Chromosome 01 contig 1, DNA sequence; n... 31 9.0 UniRef50_A0DWH2 Cluster: Chromosome undetermined scaffold_67, wh... 31 9.0 >UniRef50_Q1HPQ5 Cluster: Serine proteinase-like protein; n=3; Obtectomera|Rep: Serine proteinase-like protein - Bombyx mori (Silk moth) Length = 399 Score = 52.8 bits (121), Expect = 3e-06 Identities = 34/80 (42%), Positives = 39/80 (48%) Frame = +3 Query: 186 MRSXXXXXXXXXXXXQDTTLDPACF*TXXXXXXXXXXXXXGNLEDIIVKPTESNKRVYG* 365 MRS QDTTLDPA GNLEDIIVKPTESN V+ Sbjct: 1 MRSLLLAVLVTVGLAQDTTLDPALLLNIFGTPPTPAKPGTGNLEDIIVKPTESNS-VFTD 59 Query: 366 ETGESLQNAVPYYFV*QRNQ 425 + GES + VPYY + N+ Sbjct: 60 KNGESCK-CVPYYLCNKNNE 78 >UniRef50_Q011V3 Cluster: Homology to unknown gene; n=2; Ostreococcus|Rep: Homology to unknown gene - Ostreococcus tauri Length = 381 Score = 33.5 bits (73), Expect = 2.2 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = -3 Query: 322 MSSRFPGAR-LRRRGGRSEDVQKQAGSKVVSWARQTVTSTASKSERIALL--LLKHSEKE 152 MS FP + L GR G K + WAR+T+ S A+ E++ +L LL H + Sbjct: 211 MSGTFPYFKDLEGLQGRWVPFNGGLGKKQLEWARETIRSAAASGEKVLILTHLLVHPDST 270 Query: 151 NQQNFTSLYYE 119 +++ +L ++ Sbjct: 271 AKRSGKTLMWD 281 >UniRef50_Q4TVW4 Cluster: Internal virion protein C; n=1; Vibriophage VP4|Rep: Internal virion protein C - Vibriophage VP4 Length = 725 Score = 32.3 bits (70), Expect = 5.2 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = -3 Query: 295 LRRRGGRSEDVQKQAGSKVVSWARQTVTSTASKSERIALLLLKHSEKENQQNF 137 L +R E +++ A SKV W +T + A +E + LL+L EK+ Q ++ Sbjct: 248 LAQRPDGVEALKEMANSKVTLWGEETTYAEAIGTEAMNLLILNAHEKQFQNDW 300 >UniRef50_Q8LMB1 Cluster: Putative uncharacterized protein OSJNBa0035F15.12; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein OSJNBa0035F15.12 - Oryza sativa subsp. japonica (Rice) Length = 428 Score = 31.9 bits (69), Expect = 6.8 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -2 Query: 338 RRLNDDVFQVPRCPASPAWGAFRRCSEAGRV*GR 237 RR +D QVPRC +PA A RRC+ AGR+ GR Sbjct: 320 RRDGED--QVPRC--APARRATRRCAPAGRLTGR 349 >UniRef50_A1VH41 Cluster: Putative uncharacterized protein; n=2; Desulfovibrio vulgaris subsp. vulgaris DP4|Rep: Putative uncharacterized protein - Desulfovibrio vulgaris subsp. vulgaris (strain DP4) Length = 312 Score = 31.5 bits (68), Expect = 9.0 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 344 ALRRLNDDVFQVPRCPASPAWG-AFRRCSEAGRV*GRVLG 228 AL L +D F+VP P PAWG A R GR LG Sbjct: 161 ALATLEEDKFKVPPAPGYPAWGKASPRRGATGRATDVALG 200 >UniRef50_Q01GP0 Cluster: Chromosome 01 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 01 contig 1, DNA sequence - Ostreococcus tauri Length = 405 Score = 31.5 bits (68), Expect = 9.0 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -3 Query: 331 LTMMSSRFPGARLRRRGGRSEDVQKQAGSKV--VSWARQTVTSTASKSERIALLLL 170 LT + ARLR+RG + G V VSWA V+S A KSE + L+ Sbjct: 202 LTALDGTVTAARLRKRGDFVRALASSTGLMVKDVSWAIGAVSSHAMKSEIVPYALV 257 >UniRef50_A0DWH2 Cluster: Chromosome undetermined scaffold_67, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_67, whole genome shotgun sequence - Paramecium tetraurelia Length = 738 Score = 31.5 bits (68), Expect = 9.0 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = -2 Query: 437 TPFQLVSLLHKIVGDRILQRFPRFLSVNTLVALRRLNDDVFQVPRC 300 T F L+S+LH + G +++ ++ N +ALR L++DV + C Sbjct: 234 TVFLLLSILHTVFGCLVIRNGQFWVPTNDQLALRALHNDVIEDMGC 279 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 433,214,945 Number of Sequences: 1657284 Number of extensions: 7649745 Number of successful extensions: 19606 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19586 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 24351434270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -