SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6PTI2 Cluster: Fructose-bisphosphate aldolase; n=1; Mo...   135   1e-30
UniRef50_UPI0000DB6B71 Cluster: PREDICTED: similar to Aldolase C...   126   5e-28
UniRef50_P09972 Cluster: Fructose-bisphosphate aldolase C; n=453...   123   5e-27
UniRef50_P49577 Cluster: Fructose-bisphosphate aldolase 2; n=37;...   103   4e-21
UniRef50_Q9XFU6 Cluster: Fructose-bisphosphate aldolase; n=2; Ch...    97   4e-19
UniRef50_P16096 Cluster: Fructose-bisphosphate aldolase, chlorop...    96   8e-19
UniRef50_Q42728 Cluster: Fructose-1,6-bisphosphate aldolase prec...    93   8e-18
UniRef50_Q39A32 Cluster: Fructose-bisphosphate aldolase; n=15; B...    92   2e-17
UniRef50_Q4RRM4 Cluster: Fructose-bisphosphate aldolase; n=2; Te...    90   5e-17
UniRef50_Q84RH9 Cluster: Fructose-bisphosphate aldolase; n=3; Eu...    90   7e-17
UniRef50_Q8P5Z7 Cluster: Probable fructose-bisphosphate aldolase...    88   3e-16
UniRef50_Q4UG57 Cluster: Fructose-bisphosphate aldolase 2, putat...    82   2e-14
UniRef50_P07752 Cluster: Fructose-bisphosphate aldolase, glycoso...    76   1e-12
UniRef50_Q6PCU3 Cluster: Fructose-bisphosphate aldolase; n=4; Eu...    74   5e-12
UniRef50_Q4FN34 Cluster: Fructose-bisphosphate aldolase; n=2; Ca...    70   6e-11
UniRef50_Q2QX47 Cluster: Fructose-bisphosphate aldolase; n=1; Or...    70   6e-11
UniRef50_Q01AD9 Cluster: Fructose-bisphosphate aldolase; n=2; Os...    69   1e-10
UniRef50_Q8SSM8 Cluster: Fructose-bisphosphate aldolase; n=1; En...    64   4e-09
UniRef50_Q7LZE9 Cluster: Fructose-bisphosphate aldolase (EC 4.1....    51   3e-05
UniRef50_Q73QV3 Cluster: Fructose-bisphosphate aldolase class 1;...    41   0.043
UniRef50_Q5KE61 Cluster: Transcriptional activator, putative; n=...    39   0.13 
UniRef50_UPI00005A417C Cluster: PREDICTED: similar to Fructose-b...    39   0.17 
UniRef50_Q7RXD7 Cluster: Predicted protein; n=1; Neurospora cras...    38   0.23 
UniRef50_Q3JXN1 Cluster: Putative uncharacterized protein; n=8; ...    38   0.30 
UniRef50_UPI000155C584 Cluster: PREDICTED: similar to helicase B...    38   0.40 
UniRef50_A5P062 Cluster: Putative uncharacterized protein; n=2; ...    37   0.53 
UniRef50_A0V602 Cluster: Phospholipase D/Transphosphatidylase; n...    37   0.53 
UniRef50_Q2HCA5 Cluster: Putative uncharacterized protein; n=1; ...    37   0.53 
UniRef50_Q4ITQ5 Cluster: Putative uncharacterized protein precur...    37   0.70 
UniRef50_A5NZZ8 Cluster: LigA; n=1; Methylobacterium sp. 4-46|Re...    36   0.93 
UniRef50_A7HHV0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.6  
UniRef50_Q5JJS2 Cluster: Putative uncharacterized protein OSJNBa...    36   1.6  
UniRef50_A1CQ85 Cluster: Formin binding protein (FNB3), putative...    36   1.6  
UniRef50_A3H5L8 Cluster: Pyridoxal phosphate-dependent enzyme, p...    36   1.6  
UniRef50_Q0IBD8 Cluster: Orn/Lys/Arg decarboxylases family 1; n=...    35   2.2  
UniRef50_A5NX38 Cluster: Diguanylate cyclase/phosphodiesterase w...    35   2.2  
UniRef50_UPI0000E24FCD Cluster: PREDICTED: hypothetical protein;...    35   2.8  
UniRef50_Q2LVJ6 Cluster: General secretion pathway protein F; n=...    35   2.8  
UniRef50_Q15QK5 Cluster: Fructose-bisphosphate aldolase; n=4; Pr...    35   2.8  
UniRef50_A4L310 Cluster: M.TspMI; n=2; Thermus|Rep: M.TspMI - Th...    35   2.8  
UniRef50_A1K3P0 Cluster: Pseudouridylate synthase; n=3; Betaprot...    35   2.8  
UniRef50_Q24450 Cluster: Phosphoglyceromutase; n=1; Drosophila m...    35   2.8  
UniRef50_A6S4E6 Cluster: Predicted protein; n=1; Botryotinia fuc...    34   3.8  
UniRef50_Q6G670 Cluster: Fructose-bisphosphate aldolase class 1;...    34   3.8  
UniRef50_UPI0000DD7A6D Cluster: PREDICTED: hypothetical protein;...    34   5.0  
UniRef50_Q58793 Cluster: Uncharacterized HTH-type transcriptiona...    34   5.0  
UniRef50_Q9RL04 Cluster: Putative secreted protein; n=2; Actinom...    33   6.6  
UniRef50_Q4IVL7 Cluster: Putative uncharacterized protein precur...    33   6.6  
UniRef50_A1SP38 Cluster: Putative uncharacterized protein; n=2; ...    33   6.6  
UniRef50_A0K0C6 Cluster: Putative uncharacterized protein precur...    33   6.6  
UniRef50_Q7QU83 Cluster: GLP_226_16405_17856; n=1; Giardia lambl...    33   6.6  
UniRef50_Q2HCJ1 Cluster: Predicted protein; n=1; Chaetomium glob...    33   6.6  
UniRef50_UPI0000E80A56 Cluster: PREDICTED: hypothetical protein;...    33   8.7  
UniRef50_UPI0000DA2A7B Cluster: PREDICTED: hypothetical protein;...    33   8.7  
UniRef50_UPI0000D9BF32 Cluster: PREDICTED: hypothetical protein;...    33   8.7  
UniRef50_Q0FWF3 Cluster: Putative uncharacterized protein; n=1; ...    33   8.7  
UniRef50_Q02BJ1 Cluster: L-fucokinase; n=3; Solibacter usitatus ...    33   8.7  
UniRef50_A5NNR1 Cluster: LigA; n=2; cellular organisms|Rep: LigA...    33   8.7  
UniRef50_Q7F719 Cluster: OSJNBa0004B13.16 protein; n=1; Oryza sa...    33   8.7  
UniRef50_A7SYN2 Cluster: Predicted protein; n=1; Nematostella ve...    33   8.7  
UniRef50_A1CW97 Cluster: PHD finger domain protein, putative; n=...    33   8.7  

>UniRef50_Q6PTI2 Cluster: Fructose-bisphosphate aldolase; n=1;
           Modiolus americanus|Rep: Fructose-bisphosphate aldolase
           - Modiolus americanus (American horsemussel)
          Length = 228

 Score =  135 bits (327), Expect = 1e-30
 Identities = 65/107 (60%), Positives = 76/107 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D V++ENISGVILFHETLY    DG P V +L++KG IPGIKVDKGVVPL G++ E TTQ
Sbjct: 33  DKVVAENISGVILFHETLYLSTRDGVPFVKVLKEKGYIPGIKVDKGVVPLGGTDGESTTQ 92

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           GLD LA+RCAQYKKDG  FAKWRC  +     P  +   +    LAR
Sbjct: 93  GLDGLAERCAQYKKDGVQFAKWRCLLKIGPETPTFQAMFENANVLAR 139



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/32 (68%), Positives = 26/32 (81%)
 Frame = +3

Query: 159 DESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           DESTGT+GK   +  VEN EENRRRYR+LLF+
Sbjct: 1   DESTGTIGKDCFN-QVENNEENRRRYRELLFT 31


>UniRef50_UPI0000DB6B71 Cluster: PREDICTED: similar to Aldolase
           CG6058-PA, isoform A; n=1; Apis mellifera|Rep:
           PREDICTED: similar to Aldolase CG6058-PA, isoform A -
           Apis mellifera
          Length = 369

 Score =  126 bits (305), Expect = 5e-28
 Identities = 57/124 (45%), Positives = 85/124 (68%)
 Frame = +2

Query: 269 SENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDD 448
           S+ ISGVIL HET+Y+K  DG  ++ LL ++ ++PGIKVDKG+VPLFG+++E TT+GLD+
Sbjct: 88  SKCISGVILHHETVYEKTTDGIDMIELLRQRNVVPGIKVDKGLVPLFGAKNENTTEGLDN 147

Query: 449 LAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLKP 628
           L +RC QYK+DGCHFAKWRC      T P ++L+  T   +      + +      +++P
Sbjct: 148 LQERCIQYKRDGCHFAKWRCTFSITETTP-SQLAMVTNADVLARYATICQSARIVPIIEP 206

Query: 629 EVFT 640
           E+ +
Sbjct: 207 EILS 210



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 37/69 (53%), Positives = 48/69 (69%)
 Frame = +3

Query: 48  K*STMSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENR 227
           K S+  T +    P L +ELKKI +A+V P KG+LA DES  ++ KR  ++GVENTE NR
Sbjct: 13  KVSSPITKYTELEPALCQELKKIVEAVVVPGKGLLACDESPASLQKRFDELGVENTETNR 72

Query: 228 RRYRQLLFS 254
           R YRQ+LFS
Sbjct: 73  RNYRQMLFS 81


>UniRef50_P09972 Cluster: Fructose-bisphosphate aldolase C; n=453;
           cellular organisms|Rep: Fructose-bisphosphate aldolase C
           - Homo sapiens (Human)
          Length = 364

 Score =  123 bits (297), Expect = 5e-27
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 3e-14
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>UniRef50_P49577 Cluster: Fructose-bisphosphate aldolase 2; n=37;
           cellular organisms|Rep: Fructose-bisphosphate aldolase 2
           - Plasmodium berghei (strain Anka)
          Length = 358

 Score =  103 bits (248), Expect = 4e-21
 Identities = 49/80 (61%), Positives = 61/80 (76%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + ISG ILF ETL+QK + G PLV+LL  +GIIPGIKVDKG+V +  ++DE +TQGLD
Sbjct: 64  LGKFISGAILFEETLFQKNEAGVPLVNLLHDEGIIPGIKVDKGLVSIPCTDDEKSTQGLD 123

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            LA+RC +Y K G  FAKWR
Sbjct: 124 GLAERCKEYYKAGARFAKWR 143



 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 29/51 (56%), Positives = 37/51 (72%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           +EL + A+ +VA  KGILAADEST T+ KR  +I +ENT +NR  YR LLF
Sbjct: 9   QELAETAKKLVAAGKGILAADESTQTIKKRFDNIKIENTVQNRASYRDLLF 59


>UniRef50_Q9XFU6 Cluster: Fructose-bisphosphate aldolase; n=2;
           Chlamydomonas sp. HS-5|Rep: Fructose-bisphosphate
           aldolase - Chlamydomonas sp. HS-5
          Length = 194

 Score = 97.5 bits (232), Expect = 4e-19
 Identities = 45/80 (56%), Positives = 53/80 (66%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + ISG ILF ETLYQ   DG   V ++  +GI+PGIKVDKG+VPL  S  E    GLD
Sbjct: 37  LGQYISGAILFEETLYQSTKDGKTFVQVMNDQGIVPGIKVDKGLVPLVNSNGESWCMGLD 96

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            L +RCA+Y K G  FAKWR
Sbjct: 97  GLDKRCAEYYKAGARFAKWR 116



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/32 (75%), Positives = 24/32 (75%)
 Frame = +3

Query: 159 DESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           DES  T GKRL  IGVENTEENRR YR LL S
Sbjct: 2   DESNATCGKRLDSIGVENTEENRRAYRDLLLS 33


>UniRef50_P16096 Cluster: Fructose-bisphosphate aldolase,
           chloroplast precursor; n=94; cellular organisms|Rep:
           Fructose-bisphosphate aldolase, chloroplast precursor -
           Spinacia oleracea (Spinach)
          Length = 394

 Score = 96.3 bits (229), Expect = 8e-19
 Identities = 46/80 (57%), Positives = 55/80 (68%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + +SG ILF ETLYQ   DG  +V +L ++GI+PGIKVDKG +PL GS DE   QGLD
Sbjct: 106 LGQYVSGAILFEETLYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLD 165

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            LA R A Y + G  FAKWR
Sbjct: 166 GLACRSAAYYQQGARFAKWR 185



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/52 (57%), Positives = 37/52 (71%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +EL K A+ + +P +GILA DES  T GKRL  IG+ENTE NR+ YR LL S
Sbjct: 51  DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLIS 102


>UniRef50_Q42728 Cluster: Fructose-1,6-bisphosphate aldolase
           precursor; n=1; Euglena gracilis|Rep:
           Fructose-1,6-bisphosphate aldolase precursor - Euglena
           gracilis
          Length = 494

 Score = 93.1 bits (221), Expect = 8e-18
 Identities = 39/77 (50%), Positives = 53/77 (68%)
 Frame = +2

Query: 275 NISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLA 454
           NI GVI++ ETLYQK  +G P V ++ + G + G+KVD G+ PL G++DE  T GLD L 
Sbjct: 210 NILGVIMYEETLYQKDKNGKPFVQIINEAGAVAGVKVDTGIAPLPGADDEGYTMGLDGLR 269

Query: 455 QRCAQYKKDGCHFAKWR 505
           +RC +Y + G  FAKWR
Sbjct: 270 ERCQEYYRQGARFAKWR 286



 Score = 42.7 bits (96), Expect = 0.011
 Identities = 24/42 (57%), Positives = 28/42 (66%), Gaps = 2/42 (4%)
 Frame = +3

Query: 105 LKKIAQAIVAPAKGILAADES--TGTMGKRLQDIGVENTEEN 224
           L  + Q  + P +GILAADES    T G RL+ IGVENTEEN
Sbjct: 152 LMSVRQDHLHPWQGILAADESRPNKTCGARLKSIGVENTEEN 193


>UniRef50_Q39A32 Cluster: Fructose-bisphosphate aldolase; n=15;
           Bacteria|Rep: Fructose-bisphosphate aldolase -
           Burkholderia sp. (strain 383) (Burkholderia cepacia
           (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 340

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 47/90 (52%), Positives = 58/90 (64%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L E +SGVIL+ ETL Q ADDGTPL  L  ++ I+PGIKVD G +PL  +  +  TQGLD
Sbjct: 60  LGEFVSGVILYEETLGQCADDGTPLPELAARQQIVPGIKVDAGKIPLALAPGDEITQGLD 119

Query: 446 DLAQRCAQYKKDGCHFAKWRCC*RSAATPP 535
            LA R   Y++ G  FAKWR     +AT P
Sbjct: 120 GLAARLDGYQRQGARFAKWRAVYNVSATLP 149



 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 28/53 (52%), Positives = 36/53 (67%)
 Frame = +3

Query: 96  QEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +  L+   QA+V   KG+LAADES  T+ KR + I VE+TEENRR +R LL S
Sbjct: 4   ESALQATIQALVQDGKGLLAADESGPTIAKRFKTIAVESTEENRRAWRTLLLS 56


>UniRef50_Q4RRM4 Cluster: Fructose-bisphosphate aldolase; n=2;
           Tetraodontidae|Rep: Fructose-bisphosphate aldolase -
           Tetraodon nigroviridis (Green puffer)
          Length = 364

 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 50/110 (45%), Positives = 63/110 (57%), Gaps = 24/110 (21%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ------- 436
           + GVI FHETLYQ +D+G   V ++  + ++ GIKVDKGVVPL G+  E TTQ       
Sbjct: 74  LGGVIFFHETLYQYSDNGVSFVRMIRDRDVLVGIKVDKGVVPLAGTAGETTTQGEIPQLW 133

Query: 437 -----------------GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPP 535
                            GLD L++RCAQYKKDG  FAKWRC  + + T P
Sbjct: 134 SALLLRLCSHVLQMFSTGLDGLSERCAQYKKDGASFAKWRCVLKISDTNP 183



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 40/61 (65%), Positives = 48/61 (78%), Gaps = 2/61 (3%)
 Frame = +3

Query: 75  QYPT-PELQE-ELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLL 248
           Q PT  E Q+ EL + A  IV+P KGILAADES G+MGKRL  +GVENTEENRR++RQ+L
Sbjct: 4   QVPTLSEAQKRELHETALRIVSPGKGILAADESVGSMGKRLAQVGVENTEENRRQFRQIL 63

Query: 249 F 251
           F
Sbjct: 64  F 64


>UniRef50_Q84RH9 Cluster: Fructose-bisphosphate aldolase; n=3;
           Eukaryota|Rep: Fructose-bisphosphate aldolase -
           Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 461

 Score = 89.8 bits (213), Expect = 7e-17
 Identities = 41/80 (51%), Positives = 55/80 (68%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           ++E IS  IL+ ETL+Q A+DGTP V +++   +IPGIKVD GV   F  + E  T+G+D
Sbjct: 170 MNEAISSAILYEETLFQNAEDGTPFVDIMKANNVIPGIKVDTGVRATF-MDGETITEGID 228

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            LA+R A+Y K G  FAKWR
Sbjct: 229 GLAERAAKYYKQGARFAKWR 248



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 35/63 (55%), Positives = 43/63 (68%), Gaps = 6/63 (9%)
 Frame = +3

Query: 81  PTPELQE------ELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQ 242
           P P LQ+      EL++ A AIVA  KGILA DEST T+GKRL+ IGV N E  RR++R+
Sbjct: 103 PLPALQDKSPYSAELQQTAAAIVADGKGILACDESTKTIGKRLEQIGVPNEETYRRQWRE 162

Query: 243 LLF 251
           L F
Sbjct: 163 LFF 165


>UniRef50_Q8P5Z7 Cluster: Probable fructose-bisphosphate aldolase
           class 1; n=30; Bacteria|Rep: Probable
           fructose-bisphosphate aldolase class 1 - Xanthomonas
           campestris pv. campestris
          Length = 334

 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 43/80 (53%), Positives = 48/80 (60%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           LS+ ISG ILF ET+ QK  DG P    +   GIIPGIKVDKG  PL G   E  T+GLD
Sbjct: 59  LSDYISGAILFDETIRQKTKDGVPFAKYMADHGIIPGIKVDKGAQPLAGMPGELVTEGLD 118

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            L  R  +Y   G  FAKWR
Sbjct: 119 GLRARLEEYYTLGARFAKWR 138



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 32/52 (61%), Positives = 41/52 (78%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           E+L + AQA+VAP KGI+A DEST T+ KR   +G+ENTEENRR YR+LL +
Sbjct: 4   EQLAETAQAMVAPGKGIIAIDESTSTIAKRFSGVGIENTEENRRAYRELLLT 55


>UniRef50_Q4UG57 Cluster: Fructose-bisphosphate aldolase 2,
           putative; n=2; Theileria|Rep: Fructose-bisphosphate
           aldolase 2, putative - Theileria annulata
          Length = 377

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 50/102 (49%), Positives = 66/102 (64%), Gaps = 3/102 (2%)
 Frame = +2

Query: 209 EHRGEPSSLSPTPIQPDAVLSENISGVILFHETLYQK-ADDGTPLVSLLEKKGIIPGIKV 385
           EHR +  SL  +   PD  L++ ISGVILF ET+YQK  + G  ++ LL + G++ GIKV
Sbjct: 45  EHRAKYRSLLFST--PD--LNKYISGVILFEETMYQKDPNSGKSMLELLNENGLLVGIKV 100

Query: 386 DKGV--VPLFGSEDECTTQGLDDLAQRCAQYKKDGCHFAKWR 505
           DKG+  +PL G   E TT+G DDL  R A++ K G  FAKWR
Sbjct: 101 DKGLFTLPLLG---ETTTKGFDDLYDRSAKFYKMGARFAKWR 139



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 32/55 (58%), Positives = 39/55 (70%)
 Frame = +3

Query: 90  ELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           E  +EL + A  +VA  KGILAADES  T+ KR   IG+ENTEE+R +YR LLFS
Sbjct: 2   EYAKELVETANKLVANGKGILAADESDNTIKKRFDAIGLENTEEHRAKYRSLLFS 56


>UniRef50_P07752 Cluster: Fructose-bisphosphate aldolase,
           glycosomal; n=11; Trypanosomatidae|Rep:
           Fructose-bisphosphate aldolase, glycosomal - Trypanosoma
           brucei brucei
          Length = 372

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLF-GSEDECTTQGLDDLA 454
           ISGVIL  ET+YQKA  G      L ++G++PGIK D G+ PL  G++ E  T GLD   
Sbjct: 83  ISGVILHDETVYQKAKTGETFPQYLRRRGVVPGIKTDCGLEPLVEGAKGEQMTAGLDGYI 142

Query: 455 QRCAQYKKDGCHFAKWR 505
           +R  +Y   GC F KWR
Sbjct: 143 KRAKKYYAMGCRFCKWR 159



 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 30/63 (47%), Positives = 42/63 (66%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           +  Y +  TP  + EL + A+ + AP KG+LAADESTG+  KR   IG+ NT E+RR+YR
Sbjct: 12  LPAYNRLKTP-YEAELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYR 70

Query: 240 QLL 248
            L+
Sbjct: 71  ALM 73


>UniRef50_Q6PCU3 Cluster: Fructose-bisphosphate aldolase; n=4;
           Eumetazoa|Rep: Fructose-bisphosphate aldolase - Rattus
           norvegicus (Rat)
          Length = 153

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 33/51 (64%), Positives = 40/51 (78%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECT 430
           I GVI FHETLYQK D+G P V  +++KGI+ GIKVDKGVVPL G++ E T
Sbjct: 35  IGGVIFFHETLYQKDDNGVPFVRTIQEKGILVGIKVDKGVVPLAGTDGETT 85



 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 21/26 (80%), Positives = 22/26 (84%)
 Frame = +3

Query: 177 MGKRLQDIGVENTEENRRRYRQLLFS 254
           M KRL  IGVENTEENRR YRQ+LFS
Sbjct: 1   MAKRLSQIGVENTEENRRLYRQVLFS 26


>UniRef50_Q4FN34 Cluster: Fructose-bisphosphate aldolase; n=2;
           Candidatus Pelagibacter ubique|Rep:
           Fructose-bisphosphate aldolase - Pelagibacter ubique
          Length = 336

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 34/80 (42%), Positives = 47/80 (58%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           + + I GVIL+ ET+ Q ++    +  L+ + G +PGIKVD G   L GS +E  T+GLD
Sbjct: 57  MKDFIGGVILYDETINQTSNLKQTIPELISESGAVPGIKVDTGAKILAGSHEEKITEGLD 116

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            L +R   Y K G  F KWR
Sbjct: 117 GLRERLKDYYKLGARFTKWR 136



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 29/51 (56%), Positives = 37/51 (72%)
 Frame = +3

Query: 102 ELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           EL KIA  I++  KGILAADES GTM KRL+ + V ++ ENR  +R+ LFS
Sbjct: 3   ELNKIALKILSNGKGILAADESNGTMTKRLESVNVPSSPENRLLFRETLFS 53


>UniRef50_Q2QX47 Cluster: Fructose-bisphosphate aldolase; n=1; Oryza
           sativa (japonica cultivar-group)|Rep:
           Fructose-bisphosphate aldolase - Oryza sativa subsp.
           japonica (Rice)
          Length = 283

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 33/59 (55%), Positives = 41/59 (69%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGL 442
           L + ISG ILF ETLYQ   DG  +V +L ++GI+PGI VDKG+VPL GS+ E    GL
Sbjct: 51  LGQYISGAILFEETLYQSTVDGRRIVDVLAEQGIVPGINVDKGLVPLAGSDPESLEDGL 109


>UniRef50_Q01AD9 Cluster: Fructose-bisphosphate aldolase; n=2;
           Ostreococcus|Rep: Fructose-bisphosphate aldolase -
           Ostreococcus tauri
          Length = 402

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query: 269 SENISGVILFHETLYQKAD-DGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           +E +S  IL  ETLYQK+  +G     +L   GI+PG+K    V  L G       QGLD
Sbjct: 113 NEYLSAAILDPETLYQKSTTNGKLFPEVLSDLGIVPGVKPHLKVYALPGQSGATVMQGLD 172

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            LA R  +YKK GC FAKWR
Sbjct: 173 SLAMRLEEYKKAGCKFAKWR 192



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 31/56 (55%), Positives = 38/56 (67%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           T E + EL+ I  AI    KGI A DE  GT+G R +++GV NTEENRR YRQ+LF
Sbjct: 52  TSERKAELEAICAAIGRAGKGITACDEGPGTIGTRFENVGVTNTEENRRAYRQMLF 107


>UniRef50_Q8SSM8 Cluster: Fructose-bisphosphate aldolase; n=1;
           Encephalitozoon cuniculi|Rep: Fructose-bisphosphate
           aldolase - Encephalitozoon cuniculi
          Length = 338

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 36/76 (47%), Positives = 43/76 (56%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVIL  ET  Q +  G PL  LL+KKGI  GIK+DKG++     E E  + GL+DL  
Sbjct: 67  IGGVILNQETFEQTSGSGVPLTELLKKKGIEIGIKLDKGLIDY--KEKEKISVGLEDLDL 124

Query: 458 RCAQYKKDGCHFAKWR 505
           RC         FAKWR
Sbjct: 125 RCKSSAFKDATFAKWR 140



 Score = 59.7 bits (138), Expect = 9e-08
 Identities = 25/46 (54%), Positives = 37/46 (80%)
 Frame = +3

Query: 117 AQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           A+ I+   KGILAADE+  T+G+R + +G+ NTEENRR++R++LFS
Sbjct: 14  AKKILENGKGILAADETPKTLGRRFEKLGITNTEENRRKFREILFS 59


>UniRef50_Q7LZE9 Cluster: Fructose-bisphosphate aldolase (EC
           4.1.2.13) A; n=2; Xenopus|Rep: Fructose-bisphosphate
           aldolase (EC 4.1.2.13) A - Xenopus laevis (African
           clawed frog)
          Length = 83

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/39 (66%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query: 75  QYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGK 185
           QYP  TPE ++EL  IA+ IVAP KGILAADESTG++ K
Sbjct: 3   QYPALTPEQKKELHDIAKRIVAPGKGILAADESTGSIAK 41


>UniRef50_Q73QV3 Cluster: Fructose-bisphosphate aldolase class 1;
           n=14; Bacteria|Rep: Fructose-bisphosphate aldolase class
           1 - Treponema denticola
          Length = 295

 Score = 40.7 bits (91), Expect = 0.043
 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = +2

Query: 269 SENISGVILFHETLYQKADDGTPLVSLL-EKKGIIPGIKVDKGVVPL 406
           S NI G ILF +T+ ++  +G P    L EKK I+P +KVDKG+  L
Sbjct: 65  SNNILGAILFEQTM-EREIEGMPTADFLWEKKKILPFLKVDKGLADL 110


>UniRef50_Q5KE61 Cluster: Transcriptional activator, putative; n=2;
            Filobasidiella neoformans|Rep: Transcriptional activator,
            putative - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 1242

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 3/54 (5%)
 Frame = +1

Query: 292  PVPRDPLPEG*RWNASGLPAGEEGHHP--RHQGRQGCRPAVRIGRRMHHP-GSG 444
            P+PR PLP G +    G P  EE HHP    Q  QG R   R G+R  +  G+G
Sbjct: 1178 PLPRPPLPPGAQAAQGGRPPQEERHHPNQNRQQEQGHRQGQRQGQRWRNERGNG 1231


>UniRef50_UPI00005A417C Cluster: PREDICTED: similar to
           Fructose-bisphosphate aldolase A (Muscle-type aldolase);
           n=1; Canis lupus familiaris|Rep: PREDICTED: similar to
           Fructose-bisphosphate aldolase A (Muscle-type aldolase)
           - Canis familiaris
          Length = 178

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 26/52 (50%), Positives = 30/52 (57%)
 Frame = +1

Query: 469 VQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVRANAFVPIVE 624
           VQEG+  L QVA + KIG +TPS  AI ENANV         + N  VPI E
Sbjct: 45  VQEGQGWLCQVAPVPKIGEHTPSALAIMENANVLAHYA-SICQQNGIVPISE 95


>UniRef50_Q7RXD7 Cluster: Predicted protein; n=1; Neurospora
            crassa|Rep: Predicted protein - Neurospora crassa
          Length = 2992

 Score = 38.3 bits (85), Expect = 0.23
 Identities = 20/53 (37%), Positives = 25/53 (47%)
 Frame = +1

Query: 346  PAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVA 504
            P G+    P  QG +G RP  R+G   H P S   R +     +GR P RQ A
Sbjct: 1916 PGGDPPSQPSSQGSEGRRPGRRVGSSPHRPISISSRESTSSDDDGRSPPRQPA 1968


>UniRef50_Q3JXN1 Cluster: Putative uncharacterized protein; n=8;
           Burkholderia|Rep: Putative uncharacterized protein -
           Burkholderia pseudomallei (strain 1710b)
          Length = 542

 Score = 37.9 bits (84), Expect = 0.30
 Identities = 26/78 (33%), Positives = 33/78 (42%)
 Frame = +1

Query: 352 GEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVALLLKIGRNT 531
           G  GH  RH+G    R  +   RR H    G P P LRP   GR   R V    +  R  
Sbjct: 164 GRGGHRRRHEGDLPARKRIHGSRRQH----GGPGPDLRPRCVGRRRKRHVR---QAHRGL 216

Query: 532 PSYQAIQENANVSRPLTL 585
           P +   +   ++ RPL L
Sbjct: 217 PEHDRARRGGDLRRPLRL 234


>UniRef50_UPI000155C584 Cluster: PREDICTED: similar to helicase B;
            n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to
            helicase B - Ornithorhynchus anatinus
          Length = 1045

 Score = 37.5 bits (83), Expect = 0.40
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +2

Query: 104  AQEDRSSNCSSRKGYPRR*RIHRYNGKAFAGHRRGEH-RGEPSSLSP 241
            A E +      RK YPR+ R+ ++  +AFAG R G+   G PS+L P
Sbjct: 903  ADEAQLCQAVHRKSYPRKTRLKQFLQEAFAGRREGQQVPGSPSTLHP 949


>UniRef50_A5P062 Cluster: Putative uncharacterized protein; n=2;
           Proteobacteria|Rep: Putative uncharacterized protein -
           Methylobacterium sp. 4-46
          Length = 829

 Score = 37.1 bits (82), Expect = 0.53
 Identities = 27/70 (38%), Positives = 31/70 (44%), Gaps = 5/70 (7%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPG-----SGRPRPALR 465
           R   P G R    G PAG    HPR + R    P  R+  R HHPG      G PRP  R
Sbjct: 158 RQAAPPGRR---GGAPAGR---HPRPRRRAHLEPQGRLAARHHHPGRRHDREGPPRPGSR 211

Query: 466 PVQEGRLPLR 495
             ++ RL  R
Sbjct: 212 ARRQHRLDRR 221


>UniRef50_A0V602 Cluster: Phospholipase D/Transphosphatidylase; n=2;
           Comamonadaceae|Rep: Phospholipase D/Transphosphatidylase
           - Delftia acidovorans SPH-1
          Length = 939

 Score = 37.1 bits (82), Expect = 0.53
 Identities = 19/35 (54%), Positives = 20/35 (57%)
 Frame = +1

Query: 346 PAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRP 450
           PAG  G  P H  R   RPAVR  RR+ HP  GRP
Sbjct: 86  PAGPGGREPGHDAR--ARPAVRADRRLRHP-DGRP 117


>UniRef50_Q2HCA5 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 543

 Score = 37.1 bits (82), Expect = 0.53
 Identities = 29/74 (39%), Positives = 35/74 (47%)
 Frame = +1

Query: 535 SYQAIQENANVSRPLTLPSVRANAFVPIVEARSLYLMGEARTLEPRPRKVNLKVVLGRPV 714
           S  A   +++VSRP  + S RA   VP   A S Y   E+  L P P   NL   LGR V
Sbjct: 229 SLAASSRSSSVSRPAHV-SERAQGSVPATPALSFYESSESVVL-PSPLD-NLPATLGRRV 285

Query: 715 LKRPLKRTTKFLPP 756
            +     TT  LPP
Sbjct: 286 ERDRANATTPLLPP 299


>UniRef50_Q4ITQ5 Cluster: Putative uncharacterized protein
           precursor; n=1; Azotobacter vinelandii AvOP|Rep:
           Putative uncharacterized protein precursor - Azotobacter
           vinelandii AvOP
          Length = 792

 Score = 36.7 bits (81), Expect = 0.70
 Identities = 21/37 (56%), Positives = 21/37 (56%)
 Frame = +1

Query: 394 CRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVA 504
           CRP    GRR   PG GRP P LRP   GR P R VA
Sbjct: 423 CRP----GRRRPRPGDGRPAPVLRPRPAGRHP-RPVA 454


>UniRef50_A5NZZ8 Cluster: LigA; n=1; Methylobacterium sp. 4-46|Rep:
           LigA - Methylobacterium sp. 4-46
          Length = 962

 Score = 36.3 bits (80), Expect = 0.93
 Identities = 27/68 (39%), Positives = 33/68 (48%), Gaps = 2/68 (2%)
 Frame = +1

Query: 292 PVPRDPLPEG*RWNASGLPAGEEGHHPRH--QGRQGCRPAVRIGRRMHHPGSGRPRPALR 465
           P+ R P PE    +   LPAG     PRH   G +G  PA R  +R+H P   R RP   
Sbjct: 109 PLGRLPAPELLPADGEALPAG-----PRHGGPGPRGAGPARRAAQRLH-PALARRRPDHH 162

Query: 466 PVQEGRLP 489
            +  GRLP
Sbjct: 163 HLAGGRLP 170


>UniRef50_A7HHV0 Cluster: Putative uncharacterized protein; n=1;
           Anaeromyxobacter sp. Fw109-5|Rep: Putative
           uncharacterized protein - Anaeromyxobacter sp. Fw109-5
          Length = 249

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 20/44 (45%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 367 HPRHQGRQGC-RPAVRIGRRMHHPGSGRPRPALRPVQEGRLPLR 495
           HPR +G  G  R   R GR     G GRPR A RP +  R P R
Sbjct: 123 HPRVRGAGGAARGEERAGRARPRAGRGRPRSARRPARSPRRPPR 166


>UniRef50_Q5JJS2 Cluster: Putative uncharacterized protein
           OSJNBa0042P21.11; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBa0042P21.11 - Oryza sativa subsp. japonica (Rice)
          Length = 270

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = -3

Query: 582 RKRARNIGVFLDSLVRGG---VAADLQQQRHLAKWQPSFLYWAQRWARSSRPW 433
           R RAR+ G  L  + RGG    +A+ Q  RH AK       W +RW RS  PW
Sbjct: 127 RPRARDSGARLGGIARGGGGRDSAEEQPDRHAAKADRPDGCWRRRW-RSCPPW 178


>UniRef50_A1CQ85 Cluster: Formin binding protein (FNB3), putative;
           n=8; Pezizomycotina|Rep: Formin binding protein (FNB3),
           putative - Aspergillus clavatus
          Length = 805

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 173 YNGKAFAGHRRGEHRGEPSSLSPTPIQPDA 262
           ++ +A   HRRGE RG PS LS TP +PDA
Sbjct: 602 HHDRADRDHRRGERRGPPSRLSRTP-EPDA 630


>UniRef50_A3H5L8 Cluster: Pyridoxal phosphate-dependent enzyme,
           putative; n=1; Caldivirga maquilingensis IC-167|Rep:
           Pyridoxal phosphate-dependent enzyme, putative -
           Caldivirga maquilingensis IC-167
          Length = 388

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +1

Query: 400 PAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVALLLKIGR 525
           P +RI +R++HPG  R RP   P  E +LP R   L +K+ R
Sbjct: 301 PGIRIEKRLNHPGE-RIRPVTVPKVEIKLPRRYTELYIKLLR 341


>UniRef50_Q0IBD8 Cluster: Orn/Lys/Arg decarboxylases family 1; n=3;
           cellular organisms|Rep: Orn/Lys/Arg decarboxylases
           family 1 - Synechococcus sp. (strain CC9311)
          Length = 474

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)
 Frame = +2

Query: 215 RGEPSSLSPTPIQPDAV----LSENISGVILFHETLYQKADDGTPLVSLLEKKGI 367
           RG P ++S   ++        + E+I G +L H T +  A D TPL++ L ++G+
Sbjct: 133 RGHPGAMSAQGLESALTALPSIPESIVGAVLVHPTYHGYASDPTPLIAALHRRGL 187


>UniRef50_A5NX38 Cluster: Diguanylate cyclase/phosphodiesterase with
           PAS/PAC sensor; n=9; Alphaproteobacteria|Rep:
           Diguanylate cyclase/phosphodiesterase with PAS/PAC
           sensor - Methylobacterium sp. 4-46
          Length = 1423

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 23/69 (33%), Positives = 29/69 (42%), Gaps = 3/69 (4%)
 Frame = +1

Query: 346 PAGEEGHHPRHQGRQGCRPAVRIGRR---MHHPGSGRPRPALRPVQEGRLPLRQVALLLK 516
           P G    HPR    +   P  R+ RR      P + R RP  RP     LP R   L+ +
Sbjct: 526 PQGPRHAHPRRSADRLAEPRARLRRRGLPGRDPAAPRRRPDARPRAARTLPDRSGPLIER 585

Query: 517 IGRNTPSYQ 543
             +NTP  Q
Sbjct: 586 GAQNTPDAQ 594


>UniRef50_UPI0000E24FCD Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 208

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = +1

Query: 364 HHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEG---RLPLRQVALLLKIGRNTP 534
           HH  H G  G RP+ R GR    P    P  +L P  +     LPLR  +LL     +TP
Sbjct: 58  HHTPHGGGDGTRPSPR-GRAPESPAPESPTHSLEPPAKAPAQALPLRAPSLLTCSPEHTP 116

Query: 535 S 537
           S
Sbjct: 117 S 117


>UniRef50_Q2LVJ6 Cluster: General secretion pathway protein F; n=1;
           Syntrophus aciditrophicus SB|Rep: General secretion
           pathway protein F - Syntrophus aciditrophicus (strain
           SB)
          Length = 409

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 2/83 (2%)
 Frame = +1

Query: 394 CRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPL--RQVALLLKIGRNTPSYQAIQENANV 567
           CR A RIG +   P S +P P ++PV  G L +  R +A LL  G   P  QA+      
Sbjct: 42  CREA-RIGAQAQEPLSRKPLPFVKPVNPGELSVTTRHLATLLSAG--MPLVQALNILVTQ 98

Query: 568 SRPLTLPSVRANAFVPIVEARSL 636
           +    L S+ +     +VE  SL
Sbjct: 99  TDNQALQSILSQIRKDVVEGISL 121


>UniRef50_Q15QK5 Cluster: Fructose-bisphosphate aldolase; n=4;
           Proteobacteria|Rep: Fructose-bisphosphate aldolase -
           Pseudoalteromonas atlantica (strain T6c / BAA-1087)
          Length = 299

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = +2

Query: 272 ENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVV 400
           + + G ILF  TL ++ D  +    L ++K ++P +KVDKG++
Sbjct: 70  KRVLGAILFENTLDREIDGKSSAHFLWQEKNVVPFLKVDKGLL 112


>UniRef50_A4L310 Cluster: M.TspMI; n=2; Thermus|Rep: M.TspMI -
           Thermus sp. manalii
          Length = 437

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 LPAGEEGHHPRHQGRQGCR-PAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVALL 510
           L  G++G  P   GR     PA  I R   HPG+GR    L P Q+  L +R++A+L
Sbjct: 304 LREGKKGSFPDVYGRMSWNSPAPTITRECGHPGNGR---YLHPEQDRMLSIREMAIL 357


>UniRef50_A1K3P0 Cluster: Pseudouridylate synthase; n=3;
           Betaproteobacteria|Rep: Pseudouridylate synthase -
           Azoarcus sp. (strain BH72)
          Length = 500

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 22/49 (44%), Positives = 23/49 (46%)
 Frame = +1

Query: 349 AGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPLR 495
           AGEEG  PR   R G   A R G R       R +P  RP QEG  P R
Sbjct: 56  AGEEGRAPRSGARGG--QASR-GERPRQDAEPRRQPRARPAQEGEAPRR 101


>UniRef50_Q24450 Cluster: Phosphoglyceromutase; n=1; Drosophila
           melanogaster|Rep: Phosphoglyceromutase - Drosophila
           melanogaster (Fruit fly)
          Length = 192

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 19/34 (55%), Positives = 21/34 (61%)
 Frame = +1

Query: 355 EEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRP 456
           E+G   R QGRQGCRP VR G    H G+  PRP
Sbjct: 25  EKGGSSRAQGRQGCRPGVRCG---PHLGA-NPRP 54


>UniRef50_A6S4E6 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 94

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = -1

Query: 485 SRPSCTGRSAGRGRPDPGWCIRLPIRTA 402
           S P+CTG   GR   +PG+CI +P+  A
Sbjct: 42  SAPTCTGEKRGRTCTEPGYCIYVPVVAA 69


>UniRef50_Q6G670 Cluster: Fructose-bisphosphate aldolase class 1;
           n=31; Bacteria|Rep: Fructose-bisphosphate aldolase class
           1 - Staphylococcus aureus (strain MSSA476)
          Length = 296

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +2

Query: 272 ENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGV 397
           + I G ILF +T+ ++ + G      L  KG++P +KVDKG+
Sbjct: 66  DKILGAILFEQTMDREVE-GKYTADYLADKGVVPFLKVDKGL 106


>UniRef50_UPI0000DD7A6D Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 174

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 4/60 (6%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLP----AGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRP 468
           R P P    W +SG P    AG+ G     + R+G +  ++ G R    G+ RP PA  P
Sbjct: 14  RTPPPSSPAWPSSGFPVRQPAGKAGRRSGVRHRRGTKQELQPGARALACGAARPHPAAGP 73


>UniRef50_Q58793 Cluster: Uncharacterized HTH-type transcriptional
           regulator MJ1398; n=2; Methanococcales|Rep:
           Uncharacterized HTH-type transcriptional regulator
           MJ1398 - Methanococcus jannaschii
          Length = 391

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +2

Query: 272 ENISGVILFHETLYQKADDGTPLVSLLEKKGII---PGIKVDKGVVPL 406
           EN+S   L++ T+Y   ++GTP   + EKK  +   P IKVD+ + PL
Sbjct: 34  ENVSQY-LYNTTVYLSYENGTPCFYIGEKKEFVIIPPYIKVDRDIAPL 80


>UniRef50_Q9RL04 Cluster: Putative secreted protein; n=2;
           Actinomycetales|Rep: Putative secreted protein -
           Streptomyces coelicolor
          Length = 648

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = -3

Query: 576 RARNIGVFLDSLVRGGVAADLQQQRHLAKWQPSFLYWAQRWARSSRPWVVHSSSDPNSGT 397
           RA  +G  +D L       D    R    W     YW  R A     W   +S DP++G 
Sbjct: 540 RALTVGQLIDGLAVRVNGPDAWSLRLALDWHIGDTYWHLRLANGVLTWTSDASPDPDAGL 599

Query: 396 TPLSTLMPGMMPFFSSRETRGV 331
           T ++     ++   + + T GV
Sbjct: 600 T-MTMTRAQLLAVLAGKGTDGV 620


>UniRef50_Q4IVL7 Cluster: Putative uncharacterized protein precursor;
            n=1; Azotobacter vinelandii AvOP|Rep: Putative
            uncharacterized protein precursor - Azotobacter
            vinelandii AvOP
          Length = 1343

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 4/77 (5%)
 Frame = +1

Query: 340  GLPAGEEGHHPRHQGRQGCRPAVRIGRR----MHHPGSGRPRPALRPVQEGRLPLRQVAL 507
            G   G  G   R +G +  R A R  R+    +H P   RP PA  P + GR P   + L
Sbjct: 1118 GQEPGRAGDRQRGRGGRAERGAGRTARQHPAQLHRPARARPLPAEIPGRHGRGPEPGLQL 1177

Query: 508  LLKIGRNTPSYQAIQEN 558
             L  GR+      ++E+
Sbjct: 1178 RLAQGRHRHDAAGLRED 1194


>UniRef50_A1SP38 Cluster: Putative uncharacterized protein; n=2;
           Bacteria|Rep: Putative uncharacterized protein -
           Nocardioides sp. (strain BAA-499 / JS614)
          Length = 719

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 26/66 (39%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
 Frame = +1

Query: 271 REHLWCDPVPRDPLPEG*RWNASG-LPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGR 447
           R+H    P PRD  P G   + +   P G  G  PR   R+G  P  R GR   H   GR
Sbjct: 204 RDHPHGGPHPRDG-PAGDATDGTAPRPLGLAGRGPR--SRRGRGPRRRAGRAGPHGPPGR 260

Query: 448 PRPALR 465
           PR A+R
Sbjct: 261 PRRAVR 266


>UniRef50_A0K0C6 Cluster: Putative uncharacterized protein
           precursor; n=1; Arthrobacter sp. FB24|Rep: Putative
           uncharacterized protein precursor - Arthrobacter sp.
           (strain FB24)
          Length = 276

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 8/65 (12%)
 Frame = +1

Query: 367 HPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRP----VQEGRLPL----RQVALLLKIG 522
           HP  QGR+G R A  +  R   PG  + R A+R      Q   +P+    +Q+A LLK G
Sbjct: 34  HPDSQGRRGSRSACGVKGRGASPGGSQARTAIRAGKPRHQSHGVPMTVVVQQLAALLKGG 93

Query: 523 RNTPS 537
           R TPS
Sbjct: 94  R-TPS 97


>UniRef50_Q7QU83 Cluster: GLP_226_16405_17856; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_16405_17856 - Giardia lamblia
           ATCC 50803
          Length = 483

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +3

Query: 183 KRLQDIGVENTEENRRRYRQLLFSLTLCSPRTSL 284
           KR  +  +EN   N R+YR LLF LT C   ++L
Sbjct: 286 KRANNFAMENKTANARQYRLLLFGLTTCGTISTL 319


>UniRef50_Q2HCJ1 Cluster: Predicted protein; n=1; Chaetomium
           globosum|Rep: Predicted protein - Chaetomium globosum
           (Soil fungus)
          Length = 260

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = -1

Query: 593 TDGSVSGRETLAFSWIAWYEGVLRPIFSSNATWRSGSRPSCTGRSAGRGRPDPG--WCI 423
           +D S SG+ETLA  + A ++  LR   + N  ++  +   CT   AG G+  PG  WC+
Sbjct: 184 SDFSGSGKETLASFFAATWDDCLRLCNTMN-YFQERTDVGCTWNVAGTGQQTPGTCWCL 241


>UniRef50_UPI0000E80A56 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 455

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 51/169 (30%), Positives = 65/169 (38%), Gaps = 14/169 (8%)
 Frame = +1

Query: 292 PVPRDPLPEG*RWNASGL----PAGE-EGH--HPRHQGRQGCRP--AVR----IGRRMHH 432
           P  ++  P G R  +S L    PAG  EG    P  +GR G RP  A R    +  R   
Sbjct: 30  PQRKEKSPNGNRHASSPLRVIAPAGRREGSAGKPPSRGRAGARPDPACRGSPSLPPRRGQ 89

Query: 433 PGSGRPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLP-SVRANAF 609
            G   P PALR   E R P   +  LL     +P      + +    P TLP S+ A++ 
Sbjct: 90  RGLRGPIPALRRGAEHRTP---IVTLLGPAARSPFQPHPPDESPFRNPRTLPESLPASSG 146

Query: 610 VPIVEARSLYLMGEARTLEPRPRKVNLKVVLGRPVLKRPLKRTTKFLPP 756
                  S    G A  L P  R  +      RP   RPL    +  PP
Sbjct: 147 AKRSAGSSRTAAGPAHRLAPMQRSPH--SAAARPRRHRPLTPARRRWPP 193


>UniRef50_UPI0000DA2A7B Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 583

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 22/66 (33%), Positives = 28/66 (42%)
 Frame = +1

Query: 268 LREHLWCDPVPRDPLPEG*RWNASGLPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGR 447
           L + L CD  P D L     W   GLP     HHP  +      P+  + +  HHP S  
Sbjct: 56  LEKFLECDSRPSDSLAP--LWGGQGLPCPTGHHHPHSRS-----PSPTL-QGHHHPHSRS 107

Query: 448 PRPALR 465
           P P L+
Sbjct: 108 PSPTLQ 113


>UniRef50_UPI0000D9BF32 Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 501

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 21/56 (37%), Positives = 24/56 (42%)
 Frame = +1

Query: 325 RWNASGLPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPL 492
           +W    LPAGE    P      GC  A  +  R+ H G   P   LRP   G LPL
Sbjct: 206 KWRPHRLPAGER---PAADTHDGCH-AGPLQPRIQHHGRALPGQVLRPGAPGLLPL 257


>UniRef50_Q0FWF3 Cluster: Putative uncharacterized protein; n=1;
           Roseovarius sp. HTCC2601|Rep: Putative uncharacterized
           protein - Roseovarius sp. HTCC2601
          Length = 327

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 4/40 (10%)
 Frame = +1

Query: 346 PAGEEGHHPRHQGR-QGCRPAVRIGRR---MHHPGSGRPR 453
           PAG E  HPRHQ R Q   PA     R    H  G GRPR
Sbjct: 96  PAGAEIDHPRHQPRQQQLAPACARDHRDRDCHREGQGRPR 135


>UniRef50_Q02BJ1 Cluster: L-fucokinase; n=3; Solibacter usitatus
            Ellin6076|Rep: L-fucokinase - Solibacter usitatus (strain
            Ellin6076)
          Length = 1035

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 13/51 (25%), Positives = 23/51 (45%)
 Frame = -3

Query: 468  WAQRWARSSRPWVVHSSSDPNSGTTPLSTLMPGMMPFFSSRETRGVPSSAF 316
            W    A  +R W ++ + DPN+   P+++L+    PF    +  G     F
Sbjct: 941  WEHLGALLNRHWELNKTLDPNTANAPINSLLETARPFIHGAKLAGAGGGGF 991


>UniRef50_A5NNR1 Cluster: LigA; n=2; cellular organisms|Rep: LigA -
           Methylobacterium sp. 4-46
          Length = 1001

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 4/42 (9%)
 Frame = +1

Query: 364 HHPRHQGRQGC-RPAVRIGR---RMHHPGSGRPRPALRPVQE 477
           H P+ + R+G  RP  R GR   R  +PG GRPRPA R V+E
Sbjct: 597 HRPQVRHRRGASRPHQRGGRAGGRRRYPGPGRPRPA-RGVRE 637


>UniRef50_Q7F719 Cluster: OSJNBa0004B13.16 protein; n=1; Oryza
           sativa (japonica cultivar-group)|Rep: OSJNBa0004B13.16
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 197

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 29/78 (37%), Positives = 34/78 (43%), Gaps = 1/78 (1%)
 Frame = +1

Query: 286 CDPVPRDPLPEG*RWNASGLPAGEEGHHP-RHQGRQGCRPAVRIGRRMHHPGSGRPRPAL 462
           C P  R   P G   +ASG P G  GHHP        C P V  G+     G  R  PA+
Sbjct: 101 CQPTCRTHGP-GTAQHASGRPEGTMGHHPILCVLGLDCWPIVP-GQPSVSVGRPRHGPAV 158

Query: 463 RPVQEGRLPLRQVALLLK 516
            P Q G  P R V  L++
Sbjct: 159 GPGQHGPDPSRPVPCLVR 176


>UniRef50_A7SYN2 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1300

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 23/69 (33%), Positives = 27/69 (39%), Gaps = 3/69 (4%)
 Frame = +1

Query: 301  RDPLPEG*RWNASGLPAGEEGHHPRHQGR---QGCRPAVRIGRRMHHPGSGRPRPALRPV 471
            R P   G   +  G P  E G  P   GR   +  RP   +GR  H PG     P   P 
Sbjct: 1053 RPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLPH 1112

Query: 472  QEGRLPLRQ 498
            + GR P  Q
Sbjct: 1113 EPGRPPYEQ 1121


>UniRef50_A1CW97 Cluster: PHD finger domain protein, putative; n=6;
           Trichocomaceae|Rep: PHD finger domain protein, putative
           - Neosartorya fischeri (strain ATCC 1020 / DSM 3700 /
           NRRL 181)(Aspergillus fischerianus (strain ATCC 1020 /
           DSM 3700 / NRRL 181))
          Length = 837

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 18/36 (50%), Positives = 23/36 (63%)
 Frame = -3

Query: 432 VVHSSSDPNSGTTPLSTLMPGMMPFFSSRETRGVPS 325
           V H  S P SG+ PLS+LM GM  F  S  ++G+PS
Sbjct: 568 VTHGQSAPVSGSRPLSSLMKGMNGFGPS--SQGLPS 601


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 922,043,073
Number of Sequences: 1657284
Number of extensions: 22000981
Number of successful extensions: 67973
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 63416
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67887
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 71324098314
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).