SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9VUR4 Cluster: Ubiquitin carrier protein; n=7; Eukaryo...   111   3e-23
UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=6...    79   1e-13
UniRef50_Q5DD88 Cluster: Ubiquitin carrier protein; n=2; Schisto...    67   4e-10
UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/...    57   6e-07
UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=6...    54   3e-06
UniRef50_UPI0000DBF7F5 Cluster: similar to ubiquitin-conjugating...    52   2e-05
UniRef50_Q5KEU0 Cluster: Ubiquitin conjugating enzyme, putative;...    50   7e-05
UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;...    49   2e-04
UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryo...    48   2e-04
UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1...    48   2e-04
UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=8...    48   3e-04
UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=...    47   6e-04
UniRef50_A7SJX4 Cluster: Predicted protein; n=1; Nematostella ve...    47   6e-04
UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichom...    46   8e-04
UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, wh...    46   0.001
UniRef50_Q9N490 Cluster: Ubiquitin conjugating enzyme protein 15...    45   0.002
UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizom...    44   0.005
UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia...    43   0.010
UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; ...    41   0.032
UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryo...    40   0.055
UniRef50_O42646 Cluster: Ubiquitin-conjugating enzyme E2 6; n=2;...    40   0.055
UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; ...    40   0.073
UniRef50_Q5GAR9 Cluster: Uce2; n=6; Poaceae|Rep: Uce2 - Zea mays...    40   0.097
UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryo...    39   0.13 
UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encepha...    39   0.13 
UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizom...    39   0.13 
UniRef50_Q4TYX9 Cluster: Ubiquitinating enzyme; n=4; core eudico...    39   0.17 
UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypano...    39   0.17 
UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=...    38   0.22 
UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzy...    38   0.22 
UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1; Symbiod...    38   0.22 
UniRef50_Q7RIL5 Cluster: Putative uncharacterized protein PY0360...    38   0.22 
UniRef50_A7TI46 Cluster: Putative uncharacterized protein; n=1; ...    38   0.22 
UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa;...    38   0.22 
UniRef50_Q7RIL6 Cluster: Ubiquitin carrier protein; n=1; Plasmod...    38   0.30 
UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypano...    38   0.30 
UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryo...    38   0.39 
UniRef50_Q54J28 Cluster: Putative uncharacterized protein; n=1; ...    38   0.39 
UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piropla...    38   0.39 
UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheri...    38   0.39 
UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin ...    37   0.52 
UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo...    37   0.52 
UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohy...    37   0.52 
UniRef50_Q1DVF2 Cluster: Putative uncharacterized protein; n=1; ...    37   0.68 
UniRef50_Q74Z34 Cluster: Ubiquitin-conjugating enzyme E2 6; n=1;...    37   0.68 
UniRef50_Q9FK29 Cluster: Ubiquitin conjugating enzyme-like prote...    36   0.90 
UniRef50_Q10MI2 Cluster: Ubiquitinating enzyme, putative, expres...    36   0.90 
UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza s...    36   0.90 
UniRef50_Q00WC4 Cluster: Transducin family protein / WD-40 repea...    36   0.90 
UniRef50_A2DS96 Cluster: Ubiquitin-conjugating enzyme family pro...    36   0.90 
UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryo...    36   0.90 
UniRef50_Q6C9E9 Cluster: Yarrowia lipolytica chromosome D of str...    36   0.90 
UniRef50_P33296 Cluster: Ubiquitin-conjugating enzyme E2 6; n=9;...    36   0.90 
UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme fam...    36   1.2  
UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55...    36   1.2  
UniRef50_UPI0000D55B57 Cluster: PREDICTED: similar to ubiquitin-...    36   1.6  
UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichom...    36   1.6  
UniRef50_Q9Y385 Cluster: Ubiquitin-conjugating enzyme E2 J1; n=3...    36   1.6  
UniRef50_Q017C9 Cluster: Non-Canonical UBiquitin Conjugating Enz...    35   2.1  
UniRef50_A7EGC6 Cluster: Ubiquitin-conjugating enzyme; n=6; Pezi...    35   2.1  
UniRef50_A7RTQ5 Cluster: Predicted protein; n=1; Nematostella ve...    35   2.8  
UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E...    35   2.8  
UniRef50_UPI0000E48D7E Cluster: PREDICTED: hypothetical protein;...    34   3.6  
UniRef50_UPI000050708E Cluster: PREDICTED: similar to ubiquitin-...    34   3.6  
UniRef50_Q57XR6 Cluster: Ubiquitin-conjugating enzyme, putative;...    34   3.6  
UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquiti...    34   3.6  
UniRef50_A2QBI2 Cluster: Catalytic activity: xynB of B. subtilis...    34   3.6  
UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;...    34   3.6  
UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichom...    34   4.8  
UniRef50_Q96JI7 Cluster: Spatacsin; n=24; Euteleostomi|Rep: Spat...    34   4.8  
UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraod...    33   6.4  
UniRef50_A2AKC6 Cluster: Ubiquitin-conjugating enzyme E2 J1; n=4...    33   6.4  
UniRef50_O97292 Cluster: Putative uncharacterized protein MAL3P7...    33   6.4  
UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep:...    33   8.4  
UniRef50_Q5BW62 Cluster: SJCHGC05477 protein; n=2; Bilateria|Rep...    33   8.4  
UniRef50_Q54U33 Cluster: Putative uncharacterized protein; n=1; ...    33   8.4  
UniRef50_Q4QJA9 Cluster: Ubiquitin-conjugating enzyme, putative;...    33   8.4  
UniRef50_Q4DQ89 Cluster: Ubiquitin-conjugating enzyme, putative;...    33   8.4  

>UniRef50_Q9VUR4 Cluster: Ubiquitin carrier protein; n=7;
           Eukaryota|Rep: Ubiquitin carrier protein - Drosophila
           melanogaster (Fruit fly)
          Length = 341

 Score =  111 bits (266), Expect = 3e-23
 Identities = 61/116 (52%), Positives = 69/116 (59%), Gaps = 1/116 (0%)
 Frame = +2

Query: 353 TVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT* 532
           T P+SSA+RALA+EYKSLQEEPVEGFRVKL+ +DNLFEWEVAIFGPPDTLYQ    +   
Sbjct: 57  TTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHM 116

Query: 533 NSPLTTRIHHHPLGFLTKVWASKCI*K-RRSLHIDSPPARGMILSLANCPCERWEP 697
             P         + FLTKVW           + I  PP           PCERW P
Sbjct: 117 KFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDP--QSGELPCERWNP 170


>UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=61;
           Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 R2 - Homo
           sapiens (Human)
          Length = 238

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
           +S+ +AL LE KSLQEEPVEGFR+ L+ E +L+ WEVAIFGPP+TLY+    +     P+
Sbjct: 7   TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPI 66

Query: 545 TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                     FLTK+W           + I  PP           P ERW P
Sbjct: 67  DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDP--QSGELPSERWNP 116


>UniRef50_Q5DD88 Cluster: Ubiquitin carrier protein; n=2;
           Schistosoma japonicum|Rep: Ubiquitin carrier protein -
           Schistosoma japonicum (Blood fluke)
          Length = 289

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 30/55 (54%), Positives = 41/55 (74%)
 Frame = +2

Query: 344 MSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           M++  P +SA++AL  E K L E PVEGF+V +  ++NLF W+VAIFGPP TLY+
Sbjct: 1   MASRKPNASAVKALQKELKDLNEFPVEGFKVMVSEDENLFVWDVAIFGPPMTLYE 55



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGELP 678
           GYFKA + FP DYPYSPP++   +      +Y   E+        P DDPQSGELP
Sbjct: 57  GYFKARLCFPDDYPYSPPTMHFMSRMYHPNIYENGEV-CISILHSPGDDPQSGELP 111



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 22/40 (55%), Positives = 27/40 (67%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVR 713
           HPN+YENG++CISILH P G        P+   NPTQ+VR
Sbjct: 84  HPNIYENGEVCISILHSP-GDDPQSGELPSERWNPTQNVR 122


>UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15;
           Fungi/Metazoa group|Rep: Ubiquitin carrier protein -
           Drosophila melanogaster (Fruit fly)
          Length = 180

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 5/86 (5%)
 Frame = +2

Query: 350 NTVPTS--SALRALAL---EYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVD 514
           N +P+S  S L+A  L   +   LQ  PVEGF   L+ + ++F+WEV I GPPDTLY+  
Sbjct: 6   NKIPSSDMSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGG 65

Query: 515 TSRHT*NSPLTTRIHHHPLGFLTKVW 592
             +     P    +    + F+T++W
Sbjct: 66  FFKAHLIFPKEYPLRPPKMKFITEIW 91



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+ + GD+CISILH P
Sbjct: 92  HPNIDKAGDVCISILHEP 109


>UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=66;
           Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G1 - Homo
           sapiens (Human)
          Length = 170

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   L + PVEGF   L+ +++L+ WEV I GPPDTLY+    +     P    +  
Sbjct: 10  LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRP 69

Query: 563 HPLGFLTKVW 592
             + F+T++W
Sbjct: 70  PKMKFITEIW 79



 Score = 36.7 bits (81), Expect = 0.68
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNV +NGD+CISILH P
Sbjct: 80  HPNVDKNGDVCISILHEP 97


>UniRef50_UPI0000DBF7F5 Cluster: similar to ubiquitin-conjugating
           enzyme E2R 2 (LOC691764), mRNA; n=5; Amniota|Rep:
           similar to ubiquitin-conjugating enzyme E2R 2
           (LOC691764), mRNA - Rattus norvegicus
          Length = 182

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +1

Query: 517 FKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGELP 678
           F+AH+KFP DYPYSPP+ R         +++            P DDPQSGELP
Sbjct: 1   FQAHVKFPIDYPYSPPTFRFLTKIWHSTLFINNGDVCISILHLPVDDPQSGELP 54


>UniRef50_Q5KEU0 Cluster: Ubiquitin conjugating enzyme, putative;
           n=1; Filobasidiella neoformans|Rep: Ubiquitin
           conjugating enzyme, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 209

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 23/54 (42%), Positives = 35/54 (64%)
 Frame = +2

Query: 347 SNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           S+T  +S  LR   +E   LQ+ PV+GF   L+ +DN+ EW++ I GP DTL++
Sbjct: 35  SSTANSSLILRKQLME---LQKHPVDGFSAGLVDDDNMLEWDIVIMGPVDTLWE 85


>UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;
           n=2; African swine fever virus|Rep:
           Ubiquitin-conjugating enzyme E2-21 kDa - African swine
           fever virus (strain BA71V) (ASFV)
          Length = 215

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 21/44 (47%), Positives = 30/44 (68%)
 Frame = +2

Query: 377 RALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           R L  EY+ L E P E F++ +  E+N+ EW+V + GPPDTLY+
Sbjct: 4   RFLIAEYRHLIENPSENFKISV-NENNITEWDVILRGPPDTLYE 46



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSI 570
           G FKA + FPP+YPY+PP +
Sbjct: 48  GLFKAKVAFPPEYPYAPPKL 67



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 12/16 (75%), Positives = 14/16 (87%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HPN+Y +G LCISILH
Sbjct: 75  HPNIYPDGRLCISILH 90


>UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2;
           Eukaryota|Rep: Ubiquitin carrier protein - Guillardia
           theta (Cryptomonas phi)
          Length = 201

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
 Frame = +2

Query: 338 LTMSNTVPTSSALRA---LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           L M+    + + LR+   L ++ + LQE P E F   L+ + N+ EW + I GPPD+LY+
Sbjct: 26  LAMAPAANSPTRLRSSQILRMQLRELQENPSELFSAGLVDDSNMLEWNICISGPPDSLYE 85

Query: 509 VDTSRHT*NSPLTTRIHHHPLGFLTKVW 592
                   + P         + FLT +W
Sbjct: 86  GGIFSARLSFPENYPDKPPSMKFLTPIW 113



 Score = 40.3 bits (90), Expect = 0.055
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY NGD+CISILH P
Sbjct: 114 HPNVYSNGDVCISILHAP 131


>UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1;
           Schizosaccharomyces pombe|Rep: Ubiquitin conjugating
           enzyme Ubc14 - Schizosaccharomyces pombe (Fission yeast)
          Length = 155

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/83 (32%), Positives = 41/83 (49%)
 Frame = +2

Query: 344 MSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSR 523
           M++  P+SS  R L  EY  L+E P+   RV L+ +DNLF W     GP D++Y      
Sbjct: 1   MASASPSSS--RRLTKEYSDLREHPIPDIRVNLV-DDNLFHWACTALGPSDSVYAGGKFH 57

Query: 524 HT*NSPLTTRIHHHPLGFLTKVW 592
            +   PL        + F T+++
Sbjct: 58  FSLKFPLDYPFQPPTIEFTTRIY 80


>UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=80;
           Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G2 - Homo
           sapiens (Human)
          Length = 165

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +AL+ L  EYK L   P EG     + E+N FEWE  I GP DT ++
Sbjct: 4   TALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFE 50



 Score = 36.7 bits (81), Expect = 0.68
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN+Y +G +CISILH P G   +   + A   +P QSV
Sbjct: 79  HPNIYPDGRVCISILHAP-GDDPMGYESSAERWSPVQSV 116


>UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep:
           ubiquitin-conjugating enzyme - Entamoeba histolytica
           HM-1:IMSS
          Length = 219

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           SA + +   YKS+ ++P+EG  V+   EDN+FEW + + GP  T Y+
Sbjct: 2   SAAKFIQSNYKSIIKDPLEGIYVEYASEDNIFEWNIWMEGPTQTPYE 48



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 20/39 (51%), Positives = 24/39 (61%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPNVY +G +CISILHPP G   +     +    PTQSV
Sbjct: 77  HPNVYPDGKVCISILHPP-GEDEMSGELASERWLPTQSV 114


>UniRef50_A7SJX4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 139

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 20/65 (30%), Positives = 36/65 (55%)
 Frame = +2

Query: 398 KSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHHHPLGF 577
           + LQ++PVEGF   L  +++L++WE+ + GPP T Y+    + +   P         L F
Sbjct: 19  QQLQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTF 78

Query: 578 LTKVW 592
           ++ +W
Sbjct: 79  ISDIW 83


>UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1;
           Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein
           - Trichomonas vaginalis G3
          Length = 150

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 24/72 (33%), Positives = 41/72 (56%)
 Frame = +2

Query: 377 RALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRI 556
           R +A +YK +  +P +G  V+L+ + +L EWEV I GP +T+++    R T N P     
Sbjct: 5   RRIASDYKLITTQPPDG--VRLISQKSLLEWEVEIDGPKETIWENGHFRLTVNFPSEYPF 62

Query: 557 HHHPLGFLTKVW 592
               + F+TK++
Sbjct: 63  KAPSVKFITKIY 74


>UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 150

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 16/47 (34%), Positives = 31/47 (65%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           S++  +  E ++LQ+EP+ GF + +L ++NLF W++   GP  + Y+
Sbjct: 2   SSISRIKKELQNLQDEPLNGFLISILDDNNLFHWKICFSGPQGSSYE 48


>UniRef50_Q9N490 Cluster: Ubiquitin conjugating enzyme protein 15;
           n=2; Caenorhabditis|Rep: Ubiquitin conjugating enzyme
           protein 15 - Caenorhabditis elegans
          Length = 218

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           +SSA+R L  +Y  L ++PV+G +  L  EDN+ EW   + G PDT
Sbjct: 17  SSSAVRRLQKDYAKLMQDPVDGIKA-LPNEDNILEWHYCLRGSPDT 61


>UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7;
           Pezizomycotina|Rep: Ubiquitin carrier protein -
           Aspergillus niger
          Length = 255

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/55 (43%), Positives = 27/55 (49%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           GYFKA MKFP +YPYSPP  R         +Y K           P +D  SGEL
Sbjct: 72  GYFKAIMKFPSNYPYSPPEFRFIRPLYHPNIY-KDGKLCISILHAPGEDEMSGEL 125


>UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia
           lamblia ATCC 50803|Rep: Ubiquitin carrier protein -
           Giardia lamblia ATCC 50803
          Length = 164

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           T+ A R LA E+++ + +P+ G  + L G D+LF W + + GPP TL++
Sbjct: 2   TTRAQRHLAREFQAYERDPIPGVSIGLKG-DSLFLWTLMLQGPPGTLFE 49



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+Y +G +CISILHPP
Sbjct: 78  HPNIYSDGSVCISILHPP 95


>UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 153

 Score = 41.1 bits (92), Expect = 0.032
 Identities = 16/45 (35%), Positives = 28/45 (62%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A R +A E+K + + P+ G    L+ E++L +W+V + GP +T Y
Sbjct: 2   AARRIAKEFKEVTDNPIPGISTSLVKEEDLHQWKVEMEGPAETPY 46


>UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6;
           Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium
           discoideum AX4
          Length = 517

 Score = 40.3 bits (90), Expect = 0.055
 Identities = 21/56 (37%), Positives = 28/56 (50%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGELP 678
           G F+  + FP DYP SPPS+R  +      +Y++           P DD  SGELP
Sbjct: 70  GVFQLLLTFPKDYPMSPPSLRFLSDFWHPNVYIREGRVCISILHPPGDDILSGELP 125


>UniRef50_O42646 Cluster: Ubiquitin-conjugating enzyme E2 6; n=2;
           Schizosaccharomyces pombe|Rep: Ubiquitin-conjugating
           enzyme E2 6 - Schizosaccharomyces pombe (Fission yeast)
          Length = 227

 Score = 40.3 bits (90), Expect = 0.055
 Identities = 21/49 (42%), Positives = 27/49 (55%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +  A + L  EY +LQ+ PVE    K   E N+ EW   I GPPDT Y+
Sbjct: 3   SKGAYKRLMKEYLALQKNPVELVDAKPATE-NILEWHYIITGPPDTPYE 50



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWD 654
           G +   + FPPDYP+ PP+IR+   S   Q   +  +    F  + W+
Sbjct: 52  GQYHGTLIFPPDYPFKPPAIRMITPSGRFQTNTRLCLSFSDFHPKSWN 99


>UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 323

 Score = 39.9 bits (89), Expect = 0.073
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           GYFKA M+FP D+P+SPP  R
Sbjct: 58  GYFKAQMRFPDDFPFSPPQFR 78



 Score = 33.9 bits (74), Expect = 4.8
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HPNVY +G LCISILH
Sbjct: 85  HPNVYRDGRLCISILH 100


>UniRef50_Q5GAR9 Cluster: Uce2; n=6; Poaceae|Rep: Uce2 - Zea mays
           (Maize)
          Length = 311

 Score = 39.5 bits (88), Expect = 0.097
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G     GY+   +KFPPDYP+ PPSI
Sbjct: 46  GTPFEGGYYYGKLKFPPDYPFKPPSI 71


>UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9;
           Eukaryota|Rep: Ubiquitin carrier protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 147

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 24/74 (32%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E + LQ +P        LGED LF W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIQKELQDLQRDPPSQCSAGPLGED-LFHWQATIMGPGDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKVAFTTKIY 74


>UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1;
           Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein
           - Encephalitozoon cuniculi
          Length = 172

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 19/42 (45%), Positives = 26/42 (61%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           L  +YK +QE P E + V L+  D ++ WEV IFGP  T Y+
Sbjct: 12  LLKDYKRMQENPNEYYSVGLVDGD-IYTWEVMIFGPRKTPYE 52



 Score = 36.3 bits (80), Expect = 0.90
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = +3

Query: 585 KSGHPNVYENGDLCISILHPP 647
           K  HPN+ ENG++CISILH P
Sbjct: 78  KMWHPNIDENGNVCISILHNP 98



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 13/22 (59%), Positives = 14/22 (63%)
 Frame = +1

Query: 508 SGYFKAHMKFPPDYPYSPPSIR 573
           +G FK  M FP DYP SPP  R
Sbjct: 53  NGIFKGRMLFPTDYPDSPPKFR 74


>UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7;
           Pezizomycotina|Rep: Ubiquitin carrier protein -
           Aspergillus oryzae
          Length = 226

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 21/55 (38%), Positives = 27/55 (49%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           GYFKA MKFP +YP+SPP            +Y   ++        P +D  SGEL
Sbjct: 47  GYFKASMKFPKNYPFSPPEFAFRRPLYHPNIYPDGKL-CISILHAPGEDEMSGEL 100


>UniRef50_Q4TYX9 Cluster: Ubiquitinating enzyme; n=4; core
           eudicotyledons|Rep: Ubiquitinating enzyme - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 273

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 18/46 (39%), Positives = 29/46 (63%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           A++ +  E K +Q  P + F + L  E+N+FEW+ AI GP DT ++
Sbjct: 12  AVKRILQEVKEMQANPSDDF-MSLPLEENIFEWQFAIRGPGDTEFE 56


>UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1;
           Trypanosoma brucei|Rep: Ubiquitin carrier protein -
           Trypanosoma brucei
          Length = 226

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G FK  ++FPP+YP+SPPS+R
Sbjct: 105 GTAWEGGVFKLLLQFPPEYPFSPPSVR 131


>UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=3;
           Entamoeba histolytica HM-1:IMSS|Rep:
           ubiquitin-conjugating enzyme - Entamoeba histolytica
           HM-1:IMSS
          Length = 161

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +2

Query: 338 LTMSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +T  N +  +   R +A E K++   P  G +V +  E+NL  W+  I GPPDT Y+
Sbjct: 3   ITKKNVIKQNET-RRIAQETKNILTNPPSGIKVTI-DENNLDYWKAIIDGPPDTPYE 57


>UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzyme
           7); ubiquitin-protein ligase; n=1; Arabidopsis
           thaliana|Rep: UBC7 (ubiquitin-conjugating enzyme 7);
           ubiquitin-protein ligase - Arabidopsis thaliana
          Length = 198

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 111 HPNVYSDGRVCISILHPP 128



 Score = 37.1 bits (82), Expect = 0.52
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 455 NLFEWEVAIFGPPDTLYQ 508
           N+FEW V I GPPDTLY+
Sbjct: 65  NIFEWSVTIIGPPDTLYE 82



 Score = 34.7 bits (76), Expect = 2.8
 Identities = 19/55 (34%), Positives = 26/55 (47%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           G+F A M FP +YP SPP++R  +      +Y    +        P DDP   EL
Sbjct: 84  GFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYSDGRV-CISILHPPGDDPSGYEL 137


>UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1;
           Symbiodinium sp. C3|Rep: Ubiquitin carrier protein -
           Symbiodinium sp. C3
          Length = 167

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 16/51 (31%), Positives = 28/51 (54%)
 Frame = +2

Query: 356 VPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +P  SA R L  ++K +  +  +G +   +G+D LF W   + GP DT ++
Sbjct: 1   MPCGSAQRRLLRDFKKMTADAPKGIQASPVGDD-LFNWSAIVLGPQDTAWE 50


>UniRef50_Q7RIL5 Cluster: Putative uncharacterized protein PY03604;
           n=1; Plasmodium yoelii yoelii|Rep: Putative
           uncharacterized protein PY03604 - Plasmodium yoelii
           yoelii
          Length = 62

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           T   ++ L   +  L  +   GF V L+ + N FEW V   GP +TLY+
Sbjct: 13  TQYYIKCLYFFFNELSRDHNVGFSVGLVDDSNFFEWNVCFEGPKNTLYE 61


>UniRef50_A7TI46 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 253

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           T  A + L  EYK + E P   + +    E N+ EW   I GPPD+ Y
Sbjct: 3   TKQAHKRLTKEYKMMMENPTP-YIIARPNESNILEWHYVITGPPDSPY 49


>UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa;
           n=14; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-34
           kDa - Saccharomyces cerevisiae (Baker's yeast)
          Length = 295

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G+FKA M+FP D+P+SPP  R
Sbjct: 58  GFFKAQMRFPEDFPFSPPQFR 78



 Score = 33.9 bits (74), Expect = 4.8
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HPNVY +G LCISILH
Sbjct: 85  HPNVYRDGRLCISILH 100


>UniRef50_Q7RIL6 Cluster: Ubiquitin carrier protein; n=1; Plasmodium
           yoelii yoelii|Rep: Ubiquitin carrier protein -
           Plasmodium yoelii yoelii
          Length = 77

 Score = 37.9 bits (84), Expect = 0.30
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 55  HPNVYPDGRVCISILHPP 72


>UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5;
           Trypanosomatidae|Rep: Ubiquitin carrier protein -
           Leishmania major
          Length = 271

 Score = 37.9 bits (84), Expect = 0.30
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 76  HPNVYADGRVCISILHPP 93



 Score = 35.1 bits (77), Expect = 2.1
 Identities = 18/46 (39%), Positives = 28/46 (60%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           SAL  +  E+++L ++P  GFRV+ L +++ F W V   GP  T Y
Sbjct: 2   SALPHIQKEFRNLTKDPPAGFRVE-LKDNSFFTWIVWFTGPEGTPY 46


>UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7;
           Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 157

 Score = 37.5 bits (83), Expect = 0.39
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +2

Query: 392 EYKSLQEEPVEGFRVKLLGED-NLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHHHP 568
           EYK +Q E V    ++L+ +D N+F+W   I GP +T Y+    +   + P    +    
Sbjct: 11  EYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQ 70

Query: 569 LGFLTKVW 592
           + FLTK++
Sbjct: 71  VRFLTKIF 78


>UniRef50_Q54J28 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 41

 Score = 37.5 bits (83), Expect = 0.39
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +2

Query: 377 RALALEYKSLQEEPVEGFRVKLLGEDNLFEWEV 475
           + LA +  S+  +PVEGF V+L+ + +L+EW+V
Sbjct: 4   KLLANQLNSIMNDPVEGFTVELVNDSSLYEWKV 36


>UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2;
           Piroplasmida|Rep: Ubiquitin carrier protein - Theileria
           annulata
          Length = 170

 Score = 37.5 bits (83), Expect = 0.39
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+Y +G +CISILHPP
Sbjct: 84  HPNIYPDGRVCISILHPP 101


>UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4;
           Eutheria|Rep: Ubiquitin carrier protein - Homo sapiens
           (Human)
          Length = 146

 Score = 37.5 bits (83), Expect = 0.39
 Identities = 21/67 (31%), Positives = 30/67 (44%)
 Frame = +2

Query: 392 EYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHHHPL 571
           E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P         +
Sbjct: 8   ELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKI 66

Query: 572 GFLTKVW 592
            F TK++
Sbjct: 67  AFTTKIY 73


>UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin
           conjugating enzyme, partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to ubiquitin
           conjugating enzyme, partial - Strongylocentrotus
           purpuratus
          Length = 162

 Score = 37.1 bits (82), Expect = 0.52
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           GYFKAH+ FP DYP  PP ++
Sbjct: 3   GYFKAHLIFPKDYPNKPPKMK 23



 Score = 33.9 bits (74), Expect = 4.8
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+ + GD+CISILH P
Sbjct: 30  HPNIDKEGDVCISILHEP 47


>UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5;
           Eukaryota|Rep: Ubiquitin carrier protein - Drosophila
           melanogaster (Fruit fly)
          Length = 354

 Score = 37.1 bits (82), Expect = 0.52
 Identities = 22/70 (31%), Positives = 32/70 (45%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  E      +  EG + +++G DNLF W   I GP +T+Y+    R     P     + 
Sbjct: 213 LRREISEFSTDQTEGCKAEMVG-DNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYP 271

Query: 563 HPLGFLTKVW 592
             L FLTK +
Sbjct: 272 PYLAFLTKTY 281


>UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4;
           Oligohymenophorea|Rep: Ubiquitin carrier protein -
           Paramecium tetraurelia
          Length = 233

 Score = 37.1 bits (82), Expect = 0.52
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           GYF+A MKFP DYP SPP+ +
Sbjct: 120 GYFQAIMKFPEDYPNSPPTFK 140


>UniRef50_Q1DVF2 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 804

 Score = 36.7 bits (81), Expect = 0.68
 Identities = 21/62 (33%), Positives = 28/62 (45%)
 Frame = +2

Query: 581 TKVWASKCI*KRRSLHIDSPPARGMILSLANCPCERWEPYTIGSQPVLPLW*SQSLKGAR 760
           ++VW S  I   R     +PP R  I+    CP  RW  Y +G+   LP W S +  G  
Sbjct: 211 SQVWTSARILSNRDSRKWTPPPRRQIILAELCPSSRWVDYVLGA---LPTWWSGTEGGPI 267

Query: 761 TP 766
            P
Sbjct: 268 KP 269


>UniRef50_Q74Z34 Cluster: Ubiquitin-conjugating enzyme E2 6; n=1;
           Eremothecium gossypii|Rep: Ubiquitin-conjugating enzyme
           E2 6 - Ashbya gossypii (Yeast) (Eremothecium gossypii)
          Length = 242

 Score = 36.7 bits (81), Expect = 0.68
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           A + L+ EYK + E P   + V    EDN+  W   I GPP+T Y+
Sbjct: 6   AYKRLSKEYKMMTENPPP-YIVAAPKEDNILVWHYVITGPPETPYE 50


>UniRef50_Q9FK29 Cluster: Ubiquitin conjugating enzyme-like protein;
           n=7; Spermatophyta|Rep: Ubiquitin conjugating
           enzyme-like protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 243

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G   + G++   +KFPP+YPY PP I
Sbjct: 46  GTPFAGGFYYGKIKFPPEYPYKPPGI 71


>UniRef50_Q10MI2 Cluster: Ubiquitinating enzyme, putative,
           expressed; n=5; Magnoliophyta|Rep: Ubiquitinating
           enzyme, putative, expressed - Oryza sativa subsp.
           japonica (Rice)
          Length = 313

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           A++ +  E K +Q  P   F    L ED +FEW+ AI GP D+ ++
Sbjct: 13  AVKRILQEVKEMQSNPSPDFMAMPLEED-IFEWQFAILGPRDSEFE 57


>UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza
           sativa (japonica cultivar-group)|Rep: Ubiquitin carrier
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 368

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A + +  E K LQ++P         GED +F W+  I GPPD+ Y
Sbjct: 103 ASKRILKELKDLQKDPPTSCSAGPAGED-MFHWQATIMGPPDSPY 146


>UniRef50_Q00WC4 Cluster: Transducin family protein / WD-40 repeat
           family protein; n=2; Ostreococcus|Rep: Transducin family
           protein / WD-40 repeat family protein - Ostreococcus
           tauri
          Length = 917

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +2

Query: 338 LTMSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           L +++TV T S +R  A   +  +   V      LL ++ + EWE+   G P+ ++ +D+
Sbjct: 338 LELASTVTTKSKMRGFAFSSEVSKRTDVMCKVAVLLDDNAVHEWEIVDEGEPERVHAIDS 397

Query: 518 SRH 526
           S H
Sbjct: 398 SGH 400


>UniRef50_A2DS96 Cluster: Ubiquitin-conjugating enzyme family
           protein; n=1; Trichomonas vaginalis G3|Rep:
           Ubiquitin-conjugating enzyme family protein -
           Trichomonas vaginalis G3
          Length = 344

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           ++ ++ L  E + LQ EP   F    + +D+LF W   I G PD+ +Q
Sbjct: 7   NTTIKRLLSEMRKLQSEPDPSFVAGPVSDDDLFVWHFTIKGTPDSPFQ 54


>UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6;
           Eukaryota|Rep: Ubiquitin carrier protein - Paramecium
           tetraurelia
          Length = 720

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           A + L +++K +Q+E  E F      E+++F WE  IFGP  T ++
Sbjct: 569 AQKRLLMDFKKIQQENQEDFMASPQ-ENDIFHWEAVIFGPEQTPWE 613


>UniRef50_Q6C9E9 Cluster: Yarrowia lipolytica chromosome D of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome D of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 252

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +  + L  EY+ +Q+EPV     +   + N+ EW   I GPPDT Y+
Sbjct: 5   AGFKRLTKEYQRIQDEPVPYILTRPT-DANILEWYYVIQGPPDTDYE 50


>UniRef50_P33296 Cluster: Ubiquitin-conjugating enzyme E2 6; n=9;
           Saccharomycetales|Rep: Ubiquitin-conjugating enzyme E2 6
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 250

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           T  A + L  EYK + E P   + +    EDN+ EW   I GP DT Y+
Sbjct: 3   TKQAHKRLTKEYKLMVENPPP-YILARPNEDNILEWHYIITGPADTPYK 50


>UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme family
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ubiquitin-conjugating enzyme family protein -
           Tetrahymena thermophila SB210
          Length = 579

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +2

Query: 359 PTSSALRALALEYKSLQEEPVEGFRVKLL-GEDNLFEWEVAIFGPPDTLY 505
           P+ + L+ +  E +++Q+E    F+ K+   E+++  W+V + GP  T Y
Sbjct: 388 PSQAVLKRIVKELETIQKETDPNFKAKVFPAENDIMNWKVLLIGPEGTTY 437


>UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55;
           Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 B - Homo
           sapiens (Human)
          Length = 152

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>UniRef50_UPI0000D55B57 Cluster: PREDICTED: similar to
           ubiquitin-conjugating enzyme E2, J1; n=3;
           Endopterygota|Rep: PREDICTED: similar to
           ubiquitin-conjugating enzyme E2, J1 - Tribolium
           castaneum
          Length = 268

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           S  ++ L  E + L E   E F   L  EDNLFEW   + GPP T ++
Sbjct: 11  SPGVKRLMREARELAEPTEEYFAHPL--EDNLFEWHFTVRGPPSTEFE 56


>UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1;
           Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein
           - Trichomonas vaginalis G3
          Length = 170

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+   G++CISILHPP
Sbjct: 81  HPNIKNTGEVCISILHPP 98



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +SA   LA ++K +       F   L+  D +F+W V +FGP  T Y+
Sbjct: 6   ASAQLILARQFKEISHNSTNMFSAGLIDND-VFKWRVTVFGPAGTPYE 52



 Score = 33.5 bits (73), Expect = 6.4
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +1

Query: 490 AGYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           AG     GY+ A + FP DYP +PP+++
Sbjct: 47  AGTPYEGGYYPAVLNFPDDYPNNPPTMK 74


>UniRef50_Q9Y385 Cluster: Ubiquitin-conjugating enzyme E2 J1; n=30;
           Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 J1 - Homo
           sapiens (Human)
          Length = 318

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E   L++ P + +  + L EDNLFEW   + GPPD+
Sbjct: 9   SPAVKRLMKEAAELKD-PTDHYHAQPL-EDNLFEWHFTVRGPPDS 51


>UniRef50_Q017C9 Cluster: Non-Canonical UBiquitin Conjugating Enzyme
           1; n=1; Ostreococcus tauri|Rep: Non-Canonical UBiquitin
           Conjugating Enzyme 1 - Ostreococcus tauri
          Length = 437

 Score = 35.1 bits (77), Expect = 2.1
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +2

Query: 359 PTSSALRALALEYKSLQEEPV--EGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           P SSA+R +A E +   +     + F    L ED++FEW+ A+ G PD+ ++
Sbjct: 101 PRSSAVRRIAREIRECVDAASADDAFVASPL-EDDIFEWQFAVLGAPDSAFE 151


>UniRef50_A7EGC6 Cluster: Ubiquitin-conjugating enzyme; n=6;
           Pezizomycotina|Rep: Ubiquitin-conjugating enzyme -
           Sclerotinia sclerotiorum 1980
          Length = 265

 Score = 35.1 bits (77), Expect = 2.1
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           +A + L  EYK++ E P          E N+ EW   + GPPDT Y
Sbjct: 5   AANKRLTREYKTITENPPPYIEAHP-SESNILEWHYILTGPPDTPY 49


>UniRef50_A7RTQ5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 181

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 14/29 (48%), Positives = 19/29 (65%)
 Frame = +2

Query: 422 EGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +G   K L +D+LF WE  I GP DTL++
Sbjct: 2   QGIDTKPLNDDDLFIWEATIKGPKDTLWE 30


>UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1;
           Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING
           ENZYME E2 - Encephalitozoon cuniculi
          Length = 216

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +3

Query: 585 KSGHPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVR 713
           K  HPN+YE+G +CISIL       S     P +   P Q++R
Sbjct: 107 KMFHPNIYEDGKMCISILEEDKQQDSSVFGDPKDKWTPVQNIR 149


>UniRef50_UPI0000E48D7E Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 234

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRV 576
           G+F   +KFPPDYP  PP I++
Sbjct: 93  GFFHFFVKFPPDYPIRPPRIKL 114


>UniRef50_UPI000050708E Cluster: PREDICTED: similar to
           ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C.
           elegans); n=1; Rattus norvegicus|Rep: PREDICTED: similar
           to ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C.
           elegans) - Rattus norvegicus
          Length = 114

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTL 502
           L  +   L +  VEG    L+ ++ L+ W+V I  PPDTL
Sbjct: 10  LRRQLAELNKNTVEGISAGLIDDNVLYRWQVLIICPPDTL 49


>UniRef50_Q57XR6 Cluster: Ubiquitin-conjugating enzyme, putative;
           n=1; Trypanosoma brucei|Rep: Ubiquitin-conjugating
           enzyme, putative - Trypanosoma brucei
          Length = 310

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A++ L  E + L +  V  F    L EDN+FEW   + GP D+ Y
Sbjct: 6   AIQRLGREKEQLDKSRVREFYAAPL-EDNIFEWHFTLLGPADSPY 49


>UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A
           (Ubiquitin-conjugating enzyme E2A (RAD6 homolog),
           isoform CRA_a); n=6; Euteleostomi|Rep: Uncharacterized
           protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6
           homolog), isoform CRA_a) - Homo sapiens (Human)
          Length = 122

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           ++ A R L  ++K LQE+P  G       E+N+  W   IFGP  T ++
Sbjct: 2   STPARRRLMRDFKRLQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFE 49


>UniRef50_A2QBI2 Cluster: Catalytic activity: xynB of B. subtilis
           hydrolysis 1; n=4; Trichocomaceae|Rep: Catalytic
           activity: xynB of B. subtilis hydrolysis 1 - Aspergillus
           niger
          Length = 527

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +1

Query: 628 YRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNTFQFRGNGRC 792
           YRF  +   + +S E P+R +G   NR  T  PP+ ++        + F    RC
Sbjct: 461 YRFGFQEIREDESNEEPIRWIGEAENRSMTAAPPVGVAFTGMMVGLYAFGERQRC 515


>UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;
           n=19; Spermatophyta|Rep: Ubiquitin-conjugating enzyme
           E2-18 kDa - Arabidopsis thaliana (Mouse-ear cress)
          Length = 161

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 5/62 (8%)
 Frame = +2

Query: 347 SNTVPTSSALRALALE--YKSLQE---EPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQV 511
           S++ P+  AL  +A     K L E    P  GFR K+   DNL +W + + G P TLY  
Sbjct: 3   SSSAPSRKALSKIACNRLQKELSEWQLNPPTGFRHKVT--DNLQKWTIDVTGAPGTLYAN 60

Query: 512 DT 517
           +T
Sbjct: 61  ET 62


>UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1;
           Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein
           - Trichomonas vaginalis G3
          Length = 149

 Score = 33.9 bits (74), Expect = 4.8
 Identities = 12/48 (25%), Positives = 28/48 (58%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           ++A R +  ++K +Q +  + + V      N++ W+  +FGP DT+++
Sbjct: 2   NAAQRRILRDFKKIQNDKTKNY-VVTPDPQNIYHWDAVLFGPEDTVWE 48


>UniRef50_Q96JI7 Cluster: Spatacsin; n=24; Euteleostomi|Rep:
           Spatacsin - Homo sapiens (Human)
          Length = 2443

 Score = 33.9 bits (74), Expect = 4.8
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           TS   R+  + + S QEEP+E   V + G   LF WEV   G   TL+ ++T
Sbjct: 406 TSDPGRSWKIMHISEQEEPIELKCVSVTGFTALFTWEVERMGYTITLWDLET 457


>UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraodon
           nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon
           nigroviridis (Green puffer)
          Length = 221

 Score = 33.5 bits (73), Expect = 6.4
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           ++ A R L  ++K LQE+P  G       E+N+  W   IFGP  T ++
Sbjct: 2   STPARRRLMRDFKRLQEDPPTGVS-GAPSENNIMLWNAVIFGPVGTPFE 49


>UniRef50_A2AKC6 Cluster: Ubiquitin-conjugating enzyme E2 J1; n=4;
           Eutheria|Rep: Ubiquitin-conjugating enzyme E2 J1 - Mus
           musculus (Mouse)
          Length = 261

 Score = 33.5 bits (73), Expect = 6.4
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +2

Query: 410 EEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           ++P + +  + L EDNLFEW   + GPPD+
Sbjct: 6   KDPTDHYHAQPL-EDNLFEWHFTVRGPPDS 34


>UniRef50_O97292 Cluster: Putative uncharacterized protein MAL3P7.22;
            n=1; Plasmodium falciparum 3D7|Rep: Putative
            uncharacterized protein MAL3P7.22 - Plasmodium falciparum
            (isolate 3D7)
          Length = 2706

 Score = 33.5 bits (73), Expect = 6.4
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -2

Query: 121  TLKSRRNNRPKAHDQLNNNEKAKHRSTKRNPKK 23
            T +  RNNR   ++  NNN K++ RST+ N KK
Sbjct: 2602 TSQRTRNNRRNNNNNNNNNRKSRKRSTRTNRKK 2634


>UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep:
           F15O4.3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 123

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G   +SG F+  ++FP DYP+ PP +
Sbjct: 7   GTPYASGIFRLDIEFPEDYPFKPPKV 32


>UniRef50_Q5BW62 Cluster: SJCHGC05477 protein; n=2; Bilateria|Rep:
           SJCHGC05477 protein - Schistosoma japonicum (Blood
           fluke)
          Length = 230

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 20/46 (43%), Positives = 26/46 (56%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           A++ L  E + L   P E +  K L EDNLFEW   I GP D+ +Q
Sbjct: 8   AVKRLMKEAQELSA-PTELYFAKPL-EDNLFEWHFTIRGPEDSDFQ 51


>UniRef50_Q54U33 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 401

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +2

Query: 344 MSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           M +  P + A++ +  E + L+ +    ++   L EDN+FEW   I GP D+
Sbjct: 1   MDSCNPNNPAVKRILREIQELRNDTNPDYKAFPL-EDNIFEWHFTIRGPQDS 51


>UniRef50_Q4QJA9 Cluster: Ubiquitin-conjugating enzyme, putative;
           n=3; Leishmania|Rep: Ubiquitin-conjugating enzyme,
           putative - Leishmania major
          Length = 464

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
 Frame = +2

Query: 365 SSALRALALEYKSLQ--EEPVEGFRVKLLGEDNLFEWEVAIFGP 490
           SSA++ L+ EY+ LQ  E  V  + V  L  DN+FEW   + GP
Sbjct: 5   SSAIKRLSNEYRRLQKPENRVREYYVAPLA-DNIFEWHFTLRGP 47


>UniRef50_Q4DQ89 Cluster: Ubiquitin-conjugating enzyme, putative;
           n=2; Trypanosoma cruzi|Rep: Ubiquitin-conjugating
           enzyme, putative - Trypanosoma cruzi
          Length = 437

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +A+R LA E + L E  V  F    L +  +FEW   + GPP++ Y+
Sbjct: 31  AAIRRLAKEKQKLDESRVRDFYACPLND--IFEWHFTLQGPPNSPYE 75


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 896,963,458
Number of Sequences: 1657284
Number of extensions: 20400199
Number of successful extensions: 51070
Number of sequences better than 10.0: 78
Number of HSP's better than 10.0 without gapping: 47807
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50972
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 69143070360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).