SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30048
         (717 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0FDQ8 Cluster: Putative uncharacterized protein; n=1; ...   110   4e-23
UniRef50_Q5MGF8 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_A3UB54 Cluster: Putative glycosyltransferase; n=1; Croc...    35   2.3  
UniRef50_Q248D6 Cluster: Putative uncharacterized protein; n=3; ...    34   4.0  
UniRef50_Q0RBP5 Cluster: Putative uncharacterized protein; n=1; ...    33   9.3  
UniRef50_Q176M4 Cluster: Putative uncharacterized protein; n=2; ...    33   9.3  

>UniRef50_A0FDQ8 Cluster: Putative uncharacterized protein; n=1;
           Bombyx mori|Rep: Putative uncharacterized protein -
           Bombyx mori (Silk moth)
          Length = 272

 Score =  110 bits (264), Expect = 4e-23
 Identities = 58/78 (74%), Positives = 58/78 (74%)
 Frame = +2

Query: 20  MKVLLLCIAFAAVSLAMPVAEEKDVVPAQPILEVAPKIDDSXXXXXXXXXXXXXXXXXXX 199
           MKVLLLCIAFAAVSLAMPVAEEKDVVPAQPILEVAPKIDDS                   
Sbjct: 1   MKVLLLCIAFAAVSLAMPVAEEKDVVPAQPILEVAPKIDDSVKPTEVAAATEEKKAEPAP 60

Query: 200 XSNDEVPAIPEAKKDDIA 253
            SNDEVPAIPEAKKDDIA
Sbjct: 61  VSNDEVPAIPEAKKDDIA 78



 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 45/65 (69%), Positives = 47/65 (72%)
 Frame = +1

Query: 250 SPEDSDIAXXXXXXXXXXXXXXXXAKSSEIPDAEAKSADIKVEEPAAQPEDSKTEVASLT 429
           +PEDSDIA                AKSSEIPDAEAKSADIKVEEPAAQPEDSKTEV + T
Sbjct: 78  APEDSDIAKPETVPEVKTEEKVPEAKSSEIPDAEAKSADIKVEEPAAQPEDSKTEVQA-T 136

Query: 430 VAEIS 444
           VAEIS
Sbjct: 137 VAEIS 141


>UniRef50_Q5MGF8 Cluster: Putative uncharacterized protein; n=1;
           Lonomia obliqua|Rep: Putative uncharacterized protein -
           Lonomia obliqua (Moth)
          Length = 206

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/32 (71%), Positives = 27/32 (84%)
 Frame = +2

Query: 17  KMKVLLLCIAFAAVSLAMPVAEEKDVVPAQPI 112
           +MKVLLLC+AFAAVS+AMPVAEEK  V   P+
Sbjct: 18  RMKVLLLCMAFAAVSMAMPVAEEKPEVAEVPV 49


>UniRef50_A3UB54 Cluster: Putative glycosyltransferase; n=1;
           Croceibacter atlanticus HTCC2559|Rep: Putative
           glycosyltransferase - Croceibacter atlanticus HTCC2559
          Length = 526

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = -3

Query: 367 YQQILLQHRESRMILLPGLFLRFSLQERFPVSRYRSLLGYIVLFGLWY 224
           Y  +L +    +  LL G+F+ FS   + PVS Y  LL +++ +G+ Y
Sbjct: 135 YSYLLSEKFNLKYALLAGIFIGFSALSKGPVSMYGLLLPFLISYGVVY 182


>UniRef50_Q248D6 Cluster: Putative uncharacterized protein; n=3;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 767

 Score = 33.9 bits (74), Expect = 4.0
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = -2

Query: 596 ES*FQEIASQHRFATGRSQRSNLAFTMVRRLASLSRTEPSAISSN 462
           E  FQ ++  +R++ G+S+R +LAF++        + EP AI  N
Sbjct: 438 EQPFQHVSQAYRYSIGKSERVSLAFSVNNNNPGPGQYEPKAIQKN 482


>UniRef50_Q0RBP5 Cluster: Putative uncharacterized protein; n=1;
           Frankia alni ACN14a|Rep: Putative uncharacterized
           protein - Frankia alni (strain ACN14a)
          Length = 727

 Score = 32.7 bits (71), Expect = 9.3
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = -3

Query: 361 QILLQHRESRMILLPGLFLRFSLQERFPVSR-YRSL--LGYIVLFGLWYSGY 215
           ++LL   + R+ LLP + LR  L   F   R Y +L  LG+++L+  WY+G+
Sbjct: 16  RLLLPEPQPRLTLLPTVALRLVLAAVFAAVRLYGALFGLGFVLLWHHWYAGH 67


>UniRef50_Q176M4 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 842

 Score = 32.7 bits (71), Expect = 9.3
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = -3

Query: 346 HRESRMILLPGLFLRFSLQERFPVSRYRSLLGYI---VLFGLWYSGYLVVTNW 197
           HR SRM LL    L F   ++  VS   +LL Y+     + +WY  Y+V+  W
Sbjct: 554 HRVSRMQLLDDA-LHFVKNDQLDVSILLNLLTYLRNETCYDVWYDAYIVLKTW 605


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 625,084,094
Number of Sequences: 1657284
Number of extensions: 10863018
Number of successful extensions: 26467
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 25382
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26441
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57851245060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).