SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8I099 Cluster: CG2663-PB, isoform B; n=11; Endopterygo...   133   6e-30
UniRef50_UPI0000D5641D Cluster: PREDICTED: similar to CG2663-PB,...    94   4e-18
UniRef50_Q0MSR0 Cluster: Nuclear transcription factor Tfp1; n=1;...    79   1e-13
UniRef50_Q5TMY7 Cluster: ENSANGP00000022827; n=4; Culicidae|Rep:...    75   3e-12
UniRef50_UPI0000DB787D Cluster: PREDICTED: similar to CG2663-PB,...    68   2e-10
UniRef50_UPI00015B5261 Cluster: PREDICTED: similar to ENSANGP000...    66   7e-10
UniRef50_UPI00015B61E7 Cluster: PREDICTED: similar to ENSANGP000...    66   1e-09
UniRef50_Q4V5F0 Cluster: RH74717p; n=3; Sophophora|Rep: RH74717p...    62   1e-08
UniRef50_UPI0000D565C1 Cluster: PREDICTED: similar to CG2663-PB,...    62   2e-08
UniRef50_Q7Q2Q5 Cluster: ENSANGP00000010672; n=2; Culicidae|Rep:...    62   2e-08
UniRef50_UPI0000D560D5 Cluster: PREDICTED: similar to CG12926-PA...    60   5e-08
UniRef50_UPI0000DB6B9E Cluster: PREDICTED: similar to CG11550-PA...    55   2e-06
UniRef50_Q7QB39 Cluster: ENSANGP00000012818; n=3; Culicidae|Rep:...    55   2e-06
UniRef50_Q9VD09 Cluster: CG13848-PA; n=2; Sophophora|Rep: CG1384...    54   5e-06
UniRef50_A1Z7X8 Cluster: CG12926-PA; n=3; Sophophora|Rep: CG1292...    52   2e-05
UniRef50_Q9VCJ2 Cluster: CG10300-PA; n=3; Sophophora|Rep: CG1030...    50   5e-05
UniRef50_UPI0000D55659 Cluster: PREDICTED: similar to CG3823-PA;...    50   7e-05
UniRef50_UPI0000D5713C Cluster: PREDICTED: similar to CG13848-PA...    50   9e-05
UniRef50_UPI0000D56579 Cluster: PREDICTED: similar to CG2663-PB,...    48   3e-04
UniRef50_Q8SXR4 Cluster: RE54230p; n=2; Sophophora|Rep: RE54230p...    48   4e-04
UniRef50_Q7PYQ6 Cluster: ENSANGP00000019247; n=2; Culicidae|Rep:...    47   5e-04
UniRef50_Q7PVA1 Cluster: ENSANGP00000013947; n=2; Culicidae|Rep:...    47   5e-04
UniRef50_Q6NLM7 Cluster: LP22879p; n=4; Sophophora|Rep: LP22879p...    47   5e-04
UniRef50_UPI0000D56533 Cluster: PREDICTED: similar to Inter-alph...    47   6e-04
UniRef50_Q2MGL9 Cluster: CG33965-PA; n=3; Sophophora|Rep: CG3396...    47   6e-04
UniRef50_UPI0000D56578 Cluster: PREDICTED: similar to CG30339-PA...    45   0.003
UniRef50_Q7QG15 Cluster: ENSANGP00000015314; n=2; Culicidae|Rep:...    45   0.003
UniRef50_UPI0000D5647E Cluster: PREDICTED: similar to CG11550-PA...    44   0.006
UniRef50_UPI00015B503D Cluster: PREDICTED: similar to phosphatid...    43   0.010
UniRef50_Q9VCJ3 Cluster: CG10301-PA; n=2; Sophophora|Rep: CG1030...    42   0.024
UniRef50_UPI0000D55F9C Cluster: PREDICTED: similar to CG2663-PB,...    41   0.031
UniRef50_Q1HRG7 Cluster: Phosphatidylinositol transfer protein; ...    41   0.031
UniRef50_Q0IET4 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_Q9W503 Cluster: CG3091-PA, isoform A; n=3; Drosophila m...    40   0.054
UniRef50_UPI0000D558FF Cluster: PREDICTED: similar to CG11550-PA...    39   0.13 
UniRef50_Q9VTY1 Cluster: CG10657-PA; n=22; Endopterygota|Rep: CG...    39   0.13 
UniRef50_UPI0000D56600 Cluster: PREDICTED: similar to CG12926-PA...    39   0.17 
UniRef50_Q9W408 Cluster: CG3823-PA; n=2; Sophophora|Rep: CG3823-...    39   0.17 
UniRef50_Q7Q2S2 Cluster: ENSANGP00000010674; n=1; Anopheles gamb...    39   0.17 
UniRef50_P49638 Cluster: Alpha-tocopherol transfer protein; n=27...    39   0.17 
UniRef50_UPI00015B5BBF Cluster: PREDICTED: similar to RH74717p; ...    38   0.22 
UniRef50_Q0UFR3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.38 
UniRef50_UPI0000D5609B Cluster: PREDICTED: similar to Protein C2...    37   0.67 
UniRef50_UPI0000D5665E Cluster: PREDICTED: hypothetical protein;...    36   0.89 
UniRef50_Q9VRP8 Cluster: CG10546-PA; n=5; Endopterygota|Rep: CG1...    36   0.89 
UniRef50_Q7QJ85 Cluster: ENSANGP00000017904; n=2; Culicidae|Rep:...    36   1.2  
UniRef50_Q7K1M4 Cluster: SD04017p; n=2; Sophophora|Rep: SD04017p...    36   1.2  
UniRef50_UPI0000D9DE36 Cluster: PREDICTED: similar to ring finge...    36   1.5  
UniRef50_UPI0000D56BC1 Cluster: PREDICTED: similar to CG2663-PB,...    36   1.5  
UniRef50_Q5QPC2 Cluster: Chromosome 20 open reading frame 121; n...    36   1.5  
UniRef50_Q9BTX7 Cluster: CRAL-TRIO domain-containing protein C20...    36   1.5  
UniRef50_UPI0000D56601 Cluster: PREDICTED: similar to CG2663-PB,...    35   2.7  
UniRef50_Q13QC4 Cluster: Haemagluttinin like protein; n=2; Burkh...    35   2.7  
UniRef50_Q7QCW6 Cluster: ENSANGP00000016869; n=2; Culicidae|Rep:...    35   2.7  
UniRef50_Q7Z9J1 Cluster: Intron-encoded I-PpoI type endonuclease...    35   2.7  
UniRef50_Q16Q19 Cluster: Putative uncharacterized protein; n=1; ...    34   3.6  
UniRef50_Q7QGG5 Cluster: ENSANGP00000018351; n=2; Culicidae|Rep:...    34   4.7  
UniRef50_UPI0000DB7FFC Cluster: PREDICTED: similar to dumpy CG33...    33   6.2  
UniRef50_UPI0000D5720B Cluster: PREDICTED: similar to CG12926-PA...    33   6.2  
UniRef50_Q5TRQ1 Cluster: ENSANGP00000028324; n=3; Culicidae|Rep:...    33   6.2  
UniRef50_Q7LZW9 Cluster: Hypothetical 11.7K protein; n=1; Beet c...    33   8.3  

>UniRef50_Q8I099 Cluster: CG2663-PB, isoform B; n=11;
           Endopterygota|Rep: CG2663-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 315

 Score =  133 bits (321), Expect = 6e-30
 Identities = 74/176 (42%), Positives = 105/176 (59%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLRGC FSLEK KKKLDMY+TMR A PEFF+NRD+ R EL  +L+    PTLPG+TP GR
Sbjct: 63  FLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGR 122

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           R+T  R +D +   + + D  K+A++       ++S   AGD+++LDAS+   +H  + F
Sbjct: 123 RITFIRGIDCDFQPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAK-F 181

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEKSVF 779
           + +  +      ++      KE+HV   ISP V  + FN  K   +KEKI  +  F
Sbjct: 182 SPTVVKKFLIAVQEAYPVKVKEVHVI-NISPLVD-TIFNFVKPF-VKEKIRSRITF 234



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +1

Query: 100 LIQPSGELWKKIREELNE--DVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVAS 273
           ++ P+ +    IREEL E  D     +D+  I+EWL  QPHLP + +D  L TF      
Sbjct: 10  MLHPTPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKF 69

Query: 274 PLRNVKRNL 300
            L  VK+ L
Sbjct: 70  SLEKVKKKL 78


>UniRef50_UPI0000D5641D Cluster: PREDICTED: similar to CG2663-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG2663-PB, isoform B - Tribolium castaneum
          Length = 291

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 4/112 (3%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLRGC FSL +CKKKL+MYFT+R+  PE F+NR++  P L ++L+ A G  LP LTP   
Sbjct: 53  FLRGCRFSLPQCKKKLEMYFTVRSTMPELFSNRNIANPGLQEVLDVADGAVLPHLTPDCG 112

Query: 432 RVTIARALDKNLDTNQLNDVFKLA-MISEM*DCVKKSRE*AG---DVYVLDA 575
           RV+I RA   + +T   ++ FKL  MI ++    +   E  G   DVY+LDA
Sbjct: 113 RVSIIRAARPHFETPTPSEFFKLVFMIGDL----RLELEEFGVPFDVYILDA 160



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/67 (40%), Positives = 38/67 (56%)
 Frame = +1

Query: 100 LIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPL 279
           L+ P+ E     ++  NE  N   +DL  IK+WLR+QPHLPD W+D+ L+TF       L
Sbjct: 3   LLPPTPEQRIHTKKIFNESENVE-RDLEEIKQWLREQPHLPDSWDDSRLLTFLRGCRFSL 61

Query: 280 RNVKRNL 300
              K+ L
Sbjct: 62  PQCKKKL 68


>UniRef50_Q0MSR0 Cluster: Nuclear transcription factor Tfp1; n=1;
           Locusta migratoria|Rep: Nuclear transcription factor
           Tfp1 - Locusta migratoria (Migratory locust)
          Length = 308

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 35/66 (53%), Positives = 46/66 (69%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLRGC FSLEK K+K+DMY+TM+ A PE FANRD   P++ ++LN      LP L   G+
Sbjct: 55  FLRGCKFSLEKTKQKMDMYYTMKTAAPELFANRDPLEPKIQEILNAGFITYLPQLDKHGQ 114

Query: 432 RVTIAR 449
           RV++ R
Sbjct: 115 RVSVLR 120



 Score = 39.9 bits (89), Expect = 0.072
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = +1

Query: 103 IQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLR 282
           ++P     ++  +EL ED     +D+  IK+WL++QPHL    +D  ++ F       L 
Sbjct: 5   LRPLSPQLQEAAKELGEDPRRLEKDIQHIKDWLKQQPHLRARTDDQWIVMFLRGCKFSLE 64

Query: 283 NVKRNL 300
             K+ +
Sbjct: 65  KTKQKM 70


>UniRef50_Q5TMY7 Cluster: ENSANGP00000022827; n=4; Culicidae|Rep:
           ENSANGP00000022827 - Anopheles gambiae str. PEST
          Length = 683

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 43/120 (35%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPG-LTPQG 428
           FLRGC  SLE+ K+KLDMY+T+R A PE   NRD   P+L++L+       LP  +TP G
Sbjct: 62  FLRGCKHSLERAKEKLDMYYTVRTALPELMRNRDPEEPKLLELIKMGVAVPLPNTVTPDG 121

Query: 429 RRVTIARALDKNLDTNQLNDVFKL-AMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQ 605
            R+ + R    +     + +VF+   M+S++      +   AG + +LD S    +H  Q
Sbjct: 122 PRIILVRPGVYDPSKYTIQEVFRYNTMMSDIMMKEDDNLVVAGQMGILDLSNCTMAHFLQ 181



 Score = 66.1 bits (154), Expect = 1e-09
 Identities = 57/199 (28%), Positives = 93/199 (46%), Gaps = 7/199 (3%)
 Frame = +3

Query: 30  NYETTCSKLDCDILQK*DGINGDPDSAFRGTVEENPRGIE*GCQHQGTGLSCNQGVAEKA 209
           N+ TT   LDC ++     I+       +  + E P  IE          +  Q +A   
Sbjct: 337 NHHTTIPSLDCHVMVNLRPISAALHEKAKRELNEKPERIEEDLA------ALRQWLAR-- 388

Query: 210 TPSTR*VGRRVPDDFL----RGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMD 377
           TP  R    R+ D FL    RGC +SLE+ K+K+DM++++R A PE   NRD  R  + +
Sbjct: 389 TPHIR---ARIDDQFLVTFLRGCKYSLERAKEKIDMFYSVRTAIPELMRNRDPDRGRIRE 445

Query: 378 LLNRAQGPTLPGLT--PQGRRVTIARALDKNLDTNQLNDVFKLA-MISEM*DCVKKSRE* 548
           ++    G  LP LT  P   R+ + R    +     + +V K++ MI+++      +   
Sbjct: 446 IVRLGVGLPLP-LTDGPDAPRIMLIRPGVYDPKQYTIEEVIKVSTMINDILMLEDDNMVI 504

Query: 549 AGDVYVLDASILMPSHLRQ 605
           AG V +LD + +  +H  Q
Sbjct: 505 AGQVGILDLANVTSAHFLQ 523



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 22/63 (34%), Positives = 29/63 (46%)
 Frame = +1

Query: 112 SGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVK 291
           S +L KK  +EL E      +DLAA++ WL K PH+    +D  L  F       L   K
Sbjct: 15  SAQLAKKAADELFEKPERIDEDLAALRAWLAKCPHIKSRTDDQFLTMFLRGCKHSLERAK 74

Query: 292 RNL 300
             L
Sbjct: 75  EKL 77


>UniRef50_UPI0000DB787D Cluster: PREDICTED: similar to CG2663-PB,
           isoform B; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG2663-PB, isoform B - Apis mellifera
          Length = 294

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 34/73 (46%), Positives = 43/73 (58%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL GC  S+E+CK  L+ YF++R A PEFFA RD    E+ +     Q   LP LT +G 
Sbjct: 54  FLFGCKNSIERCKLILERYFSVRTAIPEFFAVRDPLAREIQECCEAIQYFILPSLTDEGY 113

Query: 432 RVTIARALDKNLD 470
           RVTI R  D  +D
Sbjct: 114 RVTILRLKDSTID 126



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 25/53 (47%), Positives = 37/53 (69%)
 Frame = +1

Query: 97  TLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           TL+ P+ E  K+I EE++ D  TR +D+AAI++WL KQPHLP+  ++  L  F
Sbjct: 2   TLLPPTAEQQKRINEEVSTDPETRKRDVAAIRDWLSKQPHLPNHMDNTRLERF 54


>UniRef50_UPI00015B5261 Cluster: PREDICTED: similar to
           ENSANGP00000012173; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000012173 - Nasonia
           vitripennis
          Length = 310

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 34/82 (41%), Positives = 47/82 (57%)
 Frame = +3

Query: 246 DDFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQ 425
           + FL GC  S+E+CK  L+ YF+ R A PEFFANRD    ++ D  +  +   LP LT +
Sbjct: 52  EHFLFGCKNSIERCKLILETYFSARTALPEFFANRDPLARDIQDNCDVIEYFVLPKLTEE 111

Query: 426 GRRVTIARALDKNLDTNQLNDV 491
           G RVTI R  +  L+   L  +
Sbjct: 112 GHRVTILRLKETALERFSLTAI 133



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/53 (45%), Positives = 33/53 (62%)
 Frame = +1

Query: 97  TLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           TL+ P+ E  ++I + L  D   R +D+AAI+EWL KQPHLP   +D  L  F
Sbjct: 2   TLLPPTVEQQRRIDDVLPPDPEMRKRDIAAIREWLAKQPHLPKHMDDKRLEHF 54


>UniRef50_UPI00015B61E7 Cluster: PREDICTED: similar to
           ENSANGP00000019247; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000019247 - Nasonia
           vitripennis
          Length = 289

 Score = 66.1 bits (154), Expect = 1e-09
 Identities = 32/86 (37%), Positives = 49/86 (56%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLRGC F +E+ K+KL  Y+  R   PE+F +RD   PEL +LLN      L  +  +GR
Sbjct: 62  FLRGCKFDVERAKQKLRNYYEQRFLSPEWFTHRDPFLPELQELLNLGVFLPLRNVDEEGR 121

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMI 509
            + + R    +   ++ +DVFK+ M+
Sbjct: 122 MIIVVRTCAHDPRKHKQSDVFKVGMM 147


>UniRef50_Q4V5F0 Cluster: RH74717p; n=3; Sophophora|Rep: RH74717p -
           Drosophila melanogaster (Fruit fly)
          Length = 326

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 32/83 (38%), Positives = 40/83 (48%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           F   C +S+E  K+ LD   T R    EFF N D  RPE+   +       LPG TP+G 
Sbjct: 74  FFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGY 133

Query: 432 RVTIARALDKNLDTNQLNDVFKL 500
           RV +A+  D N       DV KL
Sbjct: 134 RVILAKLDDLNTSNYNFADVMKL 156


>UniRef50_UPI0000D565C1 Cluster: PREDICTED: similar to CG2663-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG2663-PB, isoform B - Tribolium castaneum
          Length = 309

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 1/133 (0%)
 Frame = +3

Query: 249 DFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQG 428
           +F+RG  F+LE  ++KL+ YF  + A P F+ NR+    +L+   +      +P LT  G
Sbjct: 60  NFIRGAKFNLEITRRKLEGYFLAKKAFPMFYHNRNPNCKDLLRAFDTVNIARMPKLTQDG 119

Query: 429 RRVTIARALDKNLDTNQLNDVFKLA-MISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQ 605
            RV I    D N D   + DV KL  M+ ++   +        ++++ D +   P HL +
Sbjct: 120 ERVCILSLADSNPDNFIMLDVLKLFWMLYDL--TLTCDLPITSEIFIFDCASAKPEHLVK 177

Query: 606 DFTSSAEEILSFV 644
             +SS +  +S +
Sbjct: 178 FLSSSFKNSVSIL 190


>UniRef50_Q7Q2Q5 Cluster: ENSANGP00000010672; n=2; Culicidae|Rep:
           ENSANGP00000010672 - Anopheles gambiae str. PEST
          Length = 683

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +3

Query: 249 DFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQ 425
           +FLRGC +SLEK K+KLD Y+T++ A PEFF NRD     L   ++      LP  L   
Sbjct: 58  NFLRGCKYSLEKTKEKLDNYYTVKTAIPEFFDNRDPDNASLQSYMSFGVNLPLPHTLEAD 117

Query: 426 GRRVTIARALDKNLDTNQLNDVFKLA-MISEM 518
           G R  + R    +     + DV K+  MI+++
Sbjct: 118 GPRFMLVRMGAYDASKYSIVDVMKVCYMITDL 149



 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP 410
           FLRGC FSLEK KKK+ +++  R+  P+   NRD    +++ ++    G  LP
Sbjct: 403 FLRGCKFSLEKVKKKILLFYQTRSELPQIIQNRDPLDSDVLRIIRMGVGVPLP 455



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 26/61 (42%), Positives = 30/61 (49%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRN 297
           EL +K R ELNE       DLAA+K WL KQPHL    +D  L+ F       L   K  
Sbjct: 14  ELAEKARNELNEVPTRITDDLAALKAWLLKQPHLNPRMDDQFLVNFLRGCKYSLEKTKEK 73

Query: 298 L 300
           L
Sbjct: 74  L 74


>UniRef50_UPI0000D560D5 Cluster: PREDICTED: similar to CG12926-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG12926-PA - Tribolium castaneum
          Length = 293

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 24/45 (53%), Positives = 34/45 (75%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLN 386
           FLRGC FSLE+ K+KLDM++T++   PE + NRD  RPE+  +L+
Sbjct: 55  FLRGCKFSLERTKEKLDMHYTLKTITPEIYENRDPMRPEIQKVLS 99



 Score = 43.2 bits (97), Expect = 0.008
 Identities = 21/54 (38%), Positives = 25/54 (46%)
 Frame = +1

Query: 139 EELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNL 300
           +ELNED      DL  IK WL KQPH+    +D  L+ F       L   K  L
Sbjct: 17  DELNEDPKRIPDDLKHIKNWLSKQPHITARTDDQLLLAFLRGCKFSLERTKEKL 70


>UniRef50_UPI0000DB6B9E Cluster: PREDICTED: similar to CG11550-PA;
           n=3; Apocrita|Rep: PREDICTED: similar to CG11550-PA -
           Apis mellifera
          Length = 307

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRD-VTRPELMDLLNRAQGPTLPGLTPQG 428
           FL    +S+E  K  ++ +FT+R+  PEFF+NRD +   EL  + N      LPGL+ QG
Sbjct: 54  FLHSNYYSIEAAKNTIENFFTIRSHVPEFFSNRDPLGSKELRQIFNVVFATELPGLSKQG 113

Query: 429 RRVTIARALD 458
            ++  A+ +D
Sbjct: 114 HKILFAKLID 123


>UniRef50_Q7QB39 Cluster: ENSANGP00000012818; n=3; Culicidae|Rep:
           ENSANGP00000012818 - Anopheles gambiae str. PEST
          Length = 247

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 35/153 (22%), Positives = 74/153 (48%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL    + LE  ++ ++ Y+T R +C   F NR++ +  ++  ++      LP LTP+G 
Sbjct: 55  FLHSNYYDLEAAQRTIECYYTFRTSCKNLFGNRNLDKDAILMAMDVLDLAILPELTPEGY 114

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           RV +A+ +D +     L+ +  LA++       ++     G + ++D   +   HL +  
Sbjct: 115 RVMLAKIVDPDASKFSLSSLLTLALMCVDIQLWEEGCN-NGSILIIDMDGIHLGHLPKLG 173

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFV 710
             + +++L F+   L     K +H+   + PF+
Sbjct: 174 IFTLKDLLYFIQEGL-PIRLKGLHL-ANVVPFI 204


>UniRef50_Q9VD09 Cluster: CG13848-PA; n=2; Sophophora|Rep:
           CG13848-PA - Drosophila melanogaster (Fruit fly)
          Length = 273

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR   F +E+ KKKL  ++ MRA   E+F NRD   PE+ DLL    G  LP G   + 
Sbjct: 51  FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLK--LGVFLPIGPDAEQ 108

Query: 429 RRVTIARALDKNLDTNQLNDVFK 497
           R V + R    +   +  N+VFK
Sbjct: 109 RMVVVIRTAAHDPKLHSQNNVFK 131


>UniRef50_A1Z7X8 Cluster: CG12926-PA; n=3; Sophophora|Rep:
           CG12926-PA - Drosophila melanogaster (Fruit fly)
          Length = 313

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLRGC +SLEK K KLD ++ MR A PE + NR V   +L  +L+      LP  L   G
Sbjct: 60  FLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEKQL-SILDTGCLLRLPQPLQADG 118

Query: 429 RRVTIAR 449
            R+ I+R
Sbjct: 119 PRIHISR 125



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 20/63 (31%), Positives = 29/63 (46%)
 Frame = +1

Query: 112 SGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVK 291
           S EL KK  +EL E  +   +D+  ++ W+ KQPHL    +   L+ F       L   K
Sbjct: 13  SPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTK 72

Query: 292 RNL 300
             L
Sbjct: 73  LKL 75


>UniRef50_Q9VCJ2 Cluster: CG10300-PA; n=3; Sophophora|Rep:
           CG10300-PA - Drosophila melanogaster (Fruit fly)
          Length = 311

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 4/123 (3%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR C FS E+ K++ D Y+++R+  PE   +R V    L  L        +  ++P+G 
Sbjct: 56  FLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGP 115

Query: 432 RVTIARALDKNLDTNQLN--DVFKLAMIS-EM*DCVKKSRE*AGDVYVLDA-SILMPSHL 599
           RV I++   +N+D  + N  + FKL  I  E+      +   +G ++V+DA  + M   +
Sbjct: 116 RVIISQF--RNIDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMM 173

Query: 600 RQD 608
           + D
Sbjct: 174 QYD 176



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 82  MASTATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           MA+T   + P  +L    + E NE+   RA+ +A IK W+ K PHL    ++  ++ F
Sbjct: 1   MANTLRTLDP--KLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAF 56


>UniRef50_UPI0000D55659 Cluster: PREDICTED: similar to CG3823-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG3823-PA - Tribolium castaneum
          Length = 292

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 35/153 (22%), Positives = 69/153 (45%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL  C++SLE+ K+ +D+++T+R+  PE F NRD +     ++        LP  T    
Sbjct: 39  FLHTCNYSLEQTKQLIDLFYTIRSQAPEIFGNRDPSDAASQEIFKIIDLVPLPKPTKDNH 98

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           ++ I R  D + D     D  +   +      V ++   +G++ + D       HL +  
Sbjct: 99  KLFIYRLADPDPDKYNFVDSLRTFFMIADTRMVLETEFHSGEIPIFDMEGFSLRHLTKIT 158

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFV 710
               ++ + +  ++      K+IH+   I PF+
Sbjct: 159 LPVLKKYMLYT-QEAHPIRLKQIHIL-NIPPFL 189



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +1

Query: 151 EDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKR 294
           E    + +D+  I+EWL KQPHLP   +D  ++ F       L   K+
Sbjct: 5   EIATNQKEDIGKIREWLTKQPHLPQNIDDVLILRFLHTCNYSLEQTKQ 52


>UniRef50_UPI0000D5713C Cluster: PREDICTED: similar to CG13848-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG13848-PA - Tribolium castaneum
          Length = 277

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 21/43 (48%), Positives = 28/43 (65%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDL 380
           FLR C F LE+ K KL  Y+TMR   PE+++NRD   P++  L
Sbjct: 52  FLRACKFDLERTKGKLSDYYTMRRDIPEWYSNRDPLHPQIRAL 94



 Score = 33.1 bits (72), Expect = 8.3
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +1

Query: 136 REELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNL 300
           R+ LNE   T A  LAA++ W+   P L    ++  L+ F  A    L   K  L
Sbjct: 13  RQTLNETPETLAAGLAALRLWISSNPQLHVNPDERSLLAFLRACKFDLERTKGKL 67


>UniRef50_UPI0000D56579 Cluster: PREDICTED: similar to CG2663-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG2663-PB, isoform B - Tribolium castaneum
          Length = 264

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 35/155 (22%), Positives = 74/155 (47%)
 Frame = +3

Query: 246 DDFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQ 425
           ++FL    FS+E+ K+ +DMY+T+R   PE + + +  +P + +    A    LP +T +
Sbjct: 50  ENFLILNKFSIERTKQSIDMYYTVRTLIPELYEHVNPQKPNMAEARQIAYWLALPKMTDE 109

Query: 426 GRRVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQ 605
             RV + +  +K +  +++     + ++  + +         GDV + D   +   + ++
Sbjct: 110 MHRVMVFKMRNKQM-IDKMEPRNVIGLVINLEELRLNEDIMFGDVTIFDNEGINFGYFKK 168

Query: 606 DFTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFV 710
              S   ++L+ VY K+     K I++     PFV
Sbjct: 169 LTPSIIAKVLT-VYEKVFSIPMKAIYIVNS-PPFV 201


>UniRef50_Q8SXR4 Cluster: RE54230p; n=2; Sophophora|Rep: RE54230p -
           Drosophila melanogaster (Fruit fly)
          Length = 308

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 21/41 (51%), Positives = 26/41 (63%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELM 374
           FLRGC FSLEK K KLD ++T++   PE F  R V    L+
Sbjct: 55  FLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKRLVDERNLI 95



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 25/69 (36%), Positives = 31/69 (44%)
 Frame = +1

Query: 94  ATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVAS 273
           A L   S EL +    ELNE       DL A+++WL KQPHL    +D  L+ F      
Sbjct: 2   ANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKF 61

Query: 274 PLRNVKRNL 300
            L   K  L
Sbjct: 62  SLEKTKSKL 70


>UniRef50_Q7PYQ6 Cluster: ENSANGP00000019247; n=2; Culicidae|Rep:
           ENSANGP00000019247 - Anopheles gambiae str. PEST
          Length = 266

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 28/90 (31%), Positives = 46/90 (51%)
 Frame = +3

Query: 231 GRRVPDDFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP 410
           G R+   FLR   + L+K K+KL  +   R    E+F +RD  RPE+ +LL+      L 
Sbjct: 36  GSRLILYFLRTTKYDLDKAKRKLMTFLNNREKLTEWFKDRDPFRPEIQELLDIGVFLPLH 95

Query: 411 GLTPQGRRVTIARALDKNLDTNQLNDVFKL 500
                 R+V + R    + + ++ +DVFK+
Sbjct: 96  QKDALNRQVVVIRTAAHDPEKHKQDDVFKV 125


>UniRef50_Q7PVA1 Cluster: ENSANGP00000013947; n=2; Culicidae|Rep:
           ENSANGP00000013947 - Anopheles gambiae str. PEST
          Length = 317

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 2/91 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR C  S+EK K KLD Y+T+R+  PE    RD   P +  ++       LP  + P  
Sbjct: 59  FLRSCKHSMEKVKIKLDTYYTIRSVLPEVMRKRDPLDPFVRSVIKMGVTVPLPKTVHPDD 118

Query: 429 RRVTIARALDKNLDTNQLNDVFKL-AMISEM 518
            ++ + R    + D     D+ K+  MI ++
Sbjct: 119 PKIILIRGDAFDGDVCDFPDILKVFTMIGDL 149



 Score = 40.7 bits (91), Expect = 0.041
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = +1

Query: 121 LWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNL 300
           L +K  EELNE   T  ++L  IK W+++  H+    ED  L+ F  +    +  VK  L
Sbjct: 15  LKRKAAEELNEKEGTLTEELTMIKTWMKQSGHIRGRMEDQFLLGFLRSCKHSMEKVKIKL 74


>UniRef50_Q6NLM7 Cluster: LP22879p; n=4; Sophophora|Rep: LP22879p -
           Drosophila melanogaster (Fruit fly)
          Length = 311

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 2/132 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLRGC +SLE+ K KLD Y+T++   P++F   + T  +  ++        LP  L   G
Sbjct: 56  FLRGCKYSLERAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENG 115

Query: 429 RRVTIARALDKNLDTNQLNDVFKLAM-ISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQ 605
            R+ I R     ++   + +  ++A  + E+           G V+++D      +HL Q
Sbjct: 116 PRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQ 175

Query: 606 DFTSSAEEILSF 641
              S A++   F
Sbjct: 176 MTPSMAKKFTVF 187



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 22/61 (36%), Positives = 28/61 (45%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRN 297
           EL K  +E+L ED      DL A K W+ +QPHL    +D  L+ F       L   K  
Sbjct: 11  ELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSK 70

Query: 298 L 300
           L
Sbjct: 71  L 71


>UniRef50_UPI0000D56533 Cluster: PREDICTED: similar to
           Inter-alpha-trypsin inhibitor heavy chain H4 precursor
           (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain
           4) (Inter-alpha-trypsin inhibitor family heavy
           chain-related protein) (IHRP) (Plasma kallikrein
           sensitive glycoprotein 120) (P...; n=5; Tribolium
           castaneum|Rep: PREDICTED: similar to Inter-alpha-trypsin
           inhibitor heavy chain H4 precursor (ITI heavy chain H4)
           (Inter-alpha-inhibitor heavy chain 4)
           (Inter-alpha-trypsin inhibitor family heavy
           chain-related protein) (IHRP) (Plasma kallikrein
           sensitive glycoprotein 120) (P... - Tribolium castaneum
          Length = 698

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLN 386
           FL+ C ++ E  K  +D YFT+R  CPEFF  R+V++  L+   N
Sbjct: 652 FLQCCDYNEEMAKNLIDSYFTVRTLCPEFFTGRNVSKSPLLKSWN 696


>UniRef50_Q2MGL9 Cluster: CG33965-PA; n=3; Sophophora|Rep:
           CG33965-PA - Drosophila melanogaster (Fruit fly)
          Length = 317

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 31/112 (27%), Positives = 60/112 (53%), Gaps = 3/112 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFAN-RDVTRPELMDLLNRAQGPTLP-GLTPQ 425
           FLRG  FSLEK K+K+D +++++A  PE F + R V   ++++++       +P      
Sbjct: 60  FLRGSKFSLEKAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDT 119

Query: 426 GRRVTIARALDKNLDTNQLNDVFKL-AMISEM*DCVKKSRE*AGDVYVLDAS 578
           G  VTI RA   +++  +  D+ ++ +M  E+      +   +G + ++D S
Sbjct: 120 GPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMS 171



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 27/64 (42%), Positives = 35/64 (54%)
 Frame = +1

Query: 109 PSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNV 288
           P G L K   EELNE  +    D+AA+KEWL+KQPHL    ED  L++F       L   
Sbjct: 13  PPG-LQKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKA 71

Query: 289 KRNL 300
           K+ +
Sbjct: 72  KQKI 75


>UniRef50_UPI0000D56578 Cluster: PREDICTED: similar to CG30339-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG30339-PA - Tribolium castaneum
          Length = 306

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 35/151 (23%), Positives = 71/151 (47%)
 Frame = +3

Query: 234 RRVPDDFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPG 413
           +RV  +FL     S+EK K+K+DMYFT+R+   + F   +   P L ++         P 
Sbjct: 50  KRVIQNFLLLSKCSVEKTKQKIDMYFTLRSKLEDVFGESNPKLPHLKEIREVMNFVVYP- 108

Query: 414 LTPQGRRVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPS 593
            T +  R+ I +   +NL   +L  +  L  +  + +   K     G+ +++D S +  S
Sbjct: 109 KTFKNNRLFIFKMRQENLG-EKLEPMNVLRHLLSIHEIRMKEDVTFGEYFIVDCSHVPVS 167

Query: 594 HLRQDFTSSAEEILSFVYRKLIQ*NWKEIHV 686
           ++ +   +   + ++ +Y KL     K +++
Sbjct: 168 YILKLTPTFVFKAVAIIYEKLYSARLKGLYL 198



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 11/53 (20%), Positives = 29/53 (54%)
 Frame = +1

Query: 97  TLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           T ++   E+   + ++ + +  +  +D+  + +WL++QPHLP+  +   +  F
Sbjct: 4   TFLEAGDEILYDVIKDFDRNEKSFNEDVTVVTKWLQEQPHLPEVLDKRVIQNF 56


>UniRef50_Q7QG15 Cluster: ENSANGP00000015314; n=2; Culicidae|Rep:
           ENSANGP00000015314 - Anopheles gambiae str. PEST
          Length = 247

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/77 (32%), Positives = 37/77 (48%)
 Frame = +3

Query: 255 LRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRR 434
           L  C ++++  KK L  Y  + A  PE F NRD+    +   LN      LP  TP+G R
Sbjct: 1   LHACLWNVDDAKKALQKYSQIHANSPEIFDNRDIMGAGVQMTLNATHMVALPRTTPEGYR 60

Query: 435 VTIARALDKNLDTNQLN 485
           +   R  D   D +++N
Sbjct: 61  LLYYRLSD--TDPSKMN 75


>UniRef50_UPI0000D5647E Cluster: PREDICTED: similar to CG11550-PA;
           n=3; Tribolium castaneum|Rep: PREDICTED: similar to
           CG11550-PA - Tribolium castaneum
          Length = 298

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 21/73 (28%), Positives = 35/73 (47%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL+ C    E  K  +D +FT++  C + F  R+       D +N +    LP  TP+G 
Sbjct: 47  FLQSCYNRNEAAKAAIDTFFTVKTLCSDLFGGRNPLTSPNKDTMNVSLMTPLPRETPEGH 106

Query: 432 RVTIARALDKNLD 470
            + + + +D N D
Sbjct: 107 CIFLFKLIDTNPD 119


>UniRef50_UPI00015B503D Cluster: PREDICTED: similar to
           phosphatidylinositol transfer protein; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to
           phosphatidylinositol transfer protein - Nasonia
           vitripennis
          Length = 304

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 34/145 (23%), Positives = 58/145 (40%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           F   C +      K +D Y+ MR   P+FF  RDV        L       LP  +P+G 
Sbjct: 45  FAHSCYYDKSATLKCMDTYYRMRRDVPDFFKKRDVLLDHHQQNLKVVYYIELPKPSPEGY 104

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           R+      + N  +  LND    A++  +   +       G V++ D   + P HL +  
Sbjct: 105 RIIYHGLRNYNSSSYMLNDAV-AALLMTVDSNLYTEGCVPGHVFLFDMRGVRPGHLLRVS 163

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHV 686
            ++      ++ ++ +    K IHV
Sbjct: 164 ITNLRRFFEYL-QEAMPIRLKAIHV 187


>UniRef50_Q9VCJ3 Cluster: CG10301-PA; n=2; Sophophora|Rep:
           CG10301-PA - Drosophila melanogaster (Fruit fly)
          Length = 353

 Score = 41.5 bits (93), Expect = 0.024
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDL 380
           FLR C +SLE+ K+++D YFT     PE   NR VT+  L+D+
Sbjct: 100 FLRRCRYSLEETKRRIDRYFTHYNLFPEIMNNRCVTQ-RLLDI 141



 Score = 36.7 bits (81), Expect = 0.67
 Identities = 22/76 (28%), Positives = 34/76 (44%)
 Frame = +1

Query: 73  KSEMASTATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMT 252
           K  +A T      S  L K   +E+NE  +   QD+  ++ W+R+QPHL    +   L+ 
Sbjct: 40  KHRIAVTKMRRPLSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIA 99

Query: 253 FSEAVASPLRNVKRNL 300
           F       L   KR +
Sbjct: 100 FLRRCRYSLEETKRRI 115


>UniRef50_UPI0000D55F9C Cluster: PREDICTED: similar to CG2663-PB,
           isoform B isoform 2; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to CG2663-PB, isoform B isoform 2 -
           Tribolium castaneum
          Length = 304

 Score = 41.1 bits (92), Expect = 0.031
 Identities = 20/72 (27%), Positives = 37/72 (51%)
 Frame = +3

Query: 249 DFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQG 428
           +FL    F++EK K+K+D Y+T+R+  P+FF   +   P + ++++       P      
Sbjct: 55  NFLFMNKFNVEKTKRKIDTYYTVRSLIPDFFEQTNPKSPLMREVVDALYFGVCPKALNDK 114

Query: 429 RRVTIARALDKN 464
            RV I +  + N
Sbjct: 115 HRVFIIKVRESN 126



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +1

Query: 127 KKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           K   EE N+   T  +D   I+ W++ Q HLP+  ++A ++ F
Sbjct: 14  KNALEEHNKTEETAREDAKTIQIWMKTQHHLPEVMDEAKIINF 56


>UniRef50_Q1HRG7 Cluster: Phosphatidylinositol transfer protein;
           n=3; Culicidae|Rep: Phosphatidylinositol transfer
           protein - Aedes aegypti (Yellowfever mosquito)
          Length = 291

 Score = 41.1 bits (92), Expect = 0.031
 Identities = 35/153 (22%), Positives = 61/153 (39%), Gaps = 1/153 (0%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL  C  ++++ +K + +Y+  R   PE F NRD   P++           LP  TP G 
Sbjct: 46  FLNACKKNVQETRKVIKIYYQDRREAPELFDNRDPLNPKIQQCFQNQDYFFLPP-TPSGH 104

Query: 432 RVTIARALDKNLDTNQLNDVFK-LAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQD 608
            +   R  +        ++  K   M+ E   C+       G + + D + +  SHL + 
Sbjct: 105 SIIFHRLSNPKASNYHFDEAVKTYFMLIE--TCMYHQGPCPGLICLFDMNNVGLSHLLRV 162

Query: 609 FTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPF 707
              +  +   ++   L     K IHV   +S F
Sbjct: 163 KIGTIRKFFHYLQEGLPA-KLKAIHVLNAVSFF 194


>UniRef50_Q0IET4 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 328

 Score = 40.7 bits (91), Expect = 0.041
 Identities = 23/78 (29%), Positives = 43/78 (55%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   FS+ +  + L+ Y ++R   P++F N DV  PE+  L++      +P     G+
Sbjct: 73  FLRTKKFSITQSCEMLEKYLSIRQTYPKWFRNCDVEDPEMEALIDGGYIVPMPQRDDNGQ 132

Query: 432 RVTIARALDKNLDTNQLN 485
           ++ ++ A   NLD +++N
Sbjct: 133 QLILSVA--SNLDLSRVN 148



 Score = 36.3 bits (80), Expect = 0.89
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +1

Query: 46  VPNWIVTYCKSEMASTATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHL 219
           V + + + CK+           S +L K  + EL ED   R Q LA ++EW+ K PH+
Sbjct: 3   VDSIVYSNCKNPSKYEPYRCTLSDKLRKIAKAELREDDKIREQALAQMREWIAKNPHI 60


>UniRef50_Q9W503 Cluster: CG3091-PA, isoform A; n=3; Drosophila
           melanogaster|Rep: CG3091-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 303

 Score = 40.3 bits (90), Expect = 0.054
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL+  +F +E+ K   ++ + MR   P  F +R++      + L  +    LPG+TPQG 
Sbjct: 51  FLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGN 110

Query: 432 RVTIARALDKNLDTNQLNDV 491
           ++   R  D  LD    N V
Sbjct: 111 KLIFFRMAD--LDPRTRNSV 128


>UniRef50_UPI0000D558FF Cluster: PREDICTED: similar to CG11550-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG11550-PA - Tribolium castaneum
          Length = 295

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +3

Query: 255 LRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRR 434
           L  C + +E  K  +D YFT+R  CPE F + D  R  +  + +      L   TP+G  
Sbjct: 48  LHSCYYRIEAAKITIDNYFTIRDVCPELFESLD--RDGIKRVSSALFANVLTKKTPEGYG 105

Query: 435 VTIARALD 458
           + + R  D
Sbjct: 106 ILMLRLFD 113



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 151 EDVNTRAQDLAAIKEWLRKQPHLP 222
           +D N + +D+  I+EWL+KQPHLP
Sbjct: 14  KDANVKREDVRIIQEWLKKQPHLP 37


>UniRef50_Q9VTY1 Cluster: CG10657-PA; n=22; Endopterygota|Rep:
           CG10657-PA - Drosophila melanogaster (Fruit fly)
          Length = 334

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +1

Query: 136 REELNEDVNTRAQDLAAIKEWLRKQPHL 219
           +EEL+ED N R Q LA  +EW+ K PH+
Sbjct: 40  KEELHEDENIRRQALAQFREWIEKHPHI 67



 Score = 37.1 bits (82), Expect = 0.51
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 3/112 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   FS+    + L+ Y T+R   P++F   D+  P + ++        LP     GR
Sbjct: 80  FLRTKKFSVPSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGR 139

Query: 432 RV--TIARALDKNLDTN-QLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDAS 578
           +V  ++A   D    T+ Q+  V  L   + + D   +  + AG VY+ D S
Sbjct: 140 QVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDD---EDSQVAGYVYINDES 188


>UniRef50_UPI0000D56600 Cluster: PREDICTED: similar to CG12926-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG12926-PA - Tribolium castaneum
          Length = 306

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 5/151 (3%)
 Frame = +3

Query: 246 DDFLRGCSFSLEKCKKKLDMYFTMRAACPEFF-ANRDVTRPELMDLLNRAQGPTLPGLTP 422
           + FLR   ++ +K K K+D ++T+R   P     + +    +L    + +    LP LT 
Sbjct: 54  ESFLRLSKYNFDKAKSKIDNFYTLRMKMPHLLQIDINPNSTQLRKNADYSYVIKLPQLTD 113

Query: 423 QGRRVTIARALDKNLDT-NQLNDV---FKLAMISEM*DCVKKSRE*AGDVYVLDASILMP 590
              RVT+ + + K+L   N L      F LA++  + DC +      G V + D      
Sbjct: 114 DLYRVTLHKLMTKDLACFNPLLTFLWHFNLAIVGMIEDCNR------GYVLIYDFQNYGL 167

Query: 591 SHLRQDFTSSAEEILSFVYRKLIQ*NWKEIH 683
           SH+ +  T +  +  S +Y+K +  + K IH
Sbjct: 168 SHVTK-ITPTMVKRASEIYKKTLTASVKSIH 197



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 175 DLAAIKEWLRKQPHLPDEWEDACLMTF 255
           D+ A+KEW  KQPHLPD   D+ L +F
Sbjct: 30  DVIALKEWCSKQPHLPDVPCDSMLESF 56


>UniRef50_Q9W408 Cluster: CG3823-PA; n=2; Sophophora|Rep: CG3823-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 295

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 36/149 (24%), Positives = 61/149 (40%), Gaps = 4/149 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL      L   ++ L++ + +R      F +RD        LL  A    LPGLTP+  
Sbjct: 42  FLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENN 101

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DC----VKKSRE*AGDVYVLDASILMPSHL 599
           ++   R +D   D ++ N    + +   + DC      + R   G++ V D +     HL
Sbjct: 102 KLLFYRLID--FDADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHL 159

Query: 600 RQDFTSSAEEILSFVYRKLIQ*NWKEIHV 686
            +    +    + FV ++      KEIHV
Sbjct: 160 TKTALGALRVYMKFV-QEAHPVRLKEIHV 187


>UniRef50_Q7Q2S2 Cluster: ENSANGP00000010674; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000010674 - Anopheles gambiae
           str. PEST
          Length = 241

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 31/147 (21%), Positives = 65/147 (44%), Gaps = 1/147 (0%)
 Frame = +3

Query: 279 EKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVTIARALD 458
           E  ++ ++ Y+T+R    + F +RDV    +   L       LPG T +G ++   R L 
Sbjct: 50  EATQRTIENYYTLRTNYRDCFTDRDVFNDAMQTALRIMMFTILPGETKEGYKMVYTRLLT 109

Query: 459 KNLDTNQLNDVFKLAMISEM*DC-VKKSRE*AGDVYVLDASILMPSHLRQDFTSSAEEIL 635
              D +  N    L  ++   D  VK      G + ++D   +   H+ +   ++ ++ +
Sbjct: 110 S--DASHFNHPQILKFMTMCLDLWVKLEGNAKGHIMLMDMHGMHVGHMTKMNMAAVKKHM 167

Query: 636 SFVYRKLIQ*NWKEIHVYQRISPFVGW 716
            +V +  +    K++H +  + PF+ W
Sbjct: 168 FYV-QDALPIRLKQLH-FINVVPFMNW 192


>UniRef50_P49638 Cluster: Alpha-tocopherol transfer protein; n=27;
           Euteleostomi|Rep: Alpha-tocopherol transfer protein -
           Homo sapiens (Human)
          Length = 278

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 44/173 (25%), Positives = 71/173 (41%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   F L+   + L  Y+  RA CPE  A  D+    ++ LL       L    P G 
Sbjct: 55  FLRARDFDLDLAWRLLKNYYKWRAECPEISA--DLHPRSIIGLLKAGYHGVLRSRDPTGS 112

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           +V I R    +       DVF++++I+      +   +  G   + D      SH  Q  
Sbjct: 113 KVLIYRIAHWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQ-I 171

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           T S  + ++ V         + IH+     P +  + F++ K   L EKI+E+
Sbjct: 172 TPSVAKKIAAVLTDSFPLKVRGIHLIN--EPVIFHAVFSMIKPF-LTEKIKER 221


>UniRef50_UPI00015B5BBF Cluster: PREDICTED: similar to RH74717p;
           n=5; Nasonia vitripennis|Rep: PREDICTED: similar to
           RH74717p - Nasonia vitripennis
          Length = 310

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRD-VTRPELMDLLNRAQGPTLPGLTPQG 428
           FL  C + LE  K  ++ Y+  R   PE F NRD +   ++   +       L   TP+G
Sbjct: 57  FLHSCYYRLEPTKTCMENYYASRTHVPEIFHNRDPIGCRDIKYTMETLHVVPLDQPTPEG 116

Query: 429 RRVTIARALDKNLDTNQLNDVFKL 500
            RV  AR ++  ++     D  KL
Sbjct: 117 YRVFYARLVNFEVERFIYYDGLKL 140



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 13/41 (31%), Positives = 25/41 (60%)
 Frame = +1

Query: 133 IREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           + EE  ++   + +DL  +++W++KQPH P    D+ L+ F
Sbjct: 17  VEEEFKKNPELKEEDLQHLRDWIKKQPHYPKNISDSDLIIF 57


>UniRef50_Q0UFR3 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 2167

 Score = 37.5 bits (83), Expect = 0.38
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = -2

Query: 259  RRKSSGTRLPTHLVDGVAFSATP*LQLSPVPWC*HPHSIPRGFSSTVPRKAESGSPLMP- 83
            R +S+ T LP  +        +P +    +P    PHS+P    ST+ +    G PL+  
Sbjct: 1439 RYESTQTALPRQIAPTPELHKSPPVNPLAIPKTTPPHSVPSSRFSTIAQAPVQGKPLVSV 1498

Query: 82   SHFCNMSQSSLEQVVS 35
            S F NM ++SL  V S
Sbjct: 1499 SSFPNMPETSLASVPS 1514


>UniRef50_UPI0000D5609B Cluster: PREDICTED: similar to Protein
           C20orf121 homolog; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to Protein C20orf121 homolog -
           Tribolium castaneum
          Length = 306

 Score = 36.7 bits (81), Expect = 0.67
 Identities = 49/185 (26%), Positives = 83/185 (44%), Gaps = 8/185 (4%)
 Frame = +3

Query: 240 VPDD------FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGP 401
           +PDD      FLR   F  +K    L  Y+ M+  CPE F+    +  E +  L +AQ  
Sbjct: 66  IPDDGAFLLRFLRARKFDSKKAFHMLQRYYLMKLKCPELFSCPVPSECEKVFNL-QAQNM 124

Query: 402 TLPGLTPQGRRVTIARA--LDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDA 575
            L      GRRV + R    D N+ T  ++D+F+  +++      +   + AG V VLD 
Sbjct: 125 LLE-RDQLGRRVYVIRMDYFDSNVVT--IDDIFRTNILALEQIVREPETQVAGIVLVLDM 181

Query: 576 SILMPSHLRQDFTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKE 755
           + L   H +      A++++  V ++     +K  H+     PF   +   + K   +KE
Sbjct: 182 AGLSLQHAKFFTPYYAKKMVELV-QETFPLRFKGFHIVN--EPFYFDAVMAVLKPF-VKE 237

Query: 756 KIEEK 770
           KI ++
Sbjct: 238 KIRKR 242


>UniRef50_UPI0000D5665E Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 94

 Score = 36.3 bits (80), Expect = 0.89
 Identities = 14/45 (31%), Positives = 27/45 (60%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLN 386
           FL    ++++K K  ++ YFT+RA+ P  F +RD   P +  +++
Sbjct: 48  FLHAAYYNIDKTKTCIENYFTIRASAPAIFNDRDPYSPRMQVMIS 92


>UniRef50_Q9VRP8 Cluster: CG10546-PA; n=5; Endopterygota|Rep:
           CG10546-PA - Drosophila melanogaster (Fruit fly)
          Length = 324

 Score = 36.3 bits (80), Expect = 0.89
 Identities = 21/71 (29%), Positives = 30/71 (42%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   FS+   ++ L  Y  +R   P      D   P L DL+++     +P     GR
Sbjct: 60  FLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGR 119

Query: 432 RVTIARALDKN 464
           RV +  A   N
Sbjct: 120 RVVVINAKGLN 130


>UniRef50_Q7QJ85 Cluster: ENSANGP00000017904; n=2; Culicidae|Rep:
           ENSANGP00000017904 - Anopheles gambiae str. PEST
          Length = 312

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 36/146 (24%), Positives = 63/146 (43%), Gaps = 1/146 (0%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   FS+ K  + L+ Y  +R   P +F   D    + M  L   +   + G   +G+
Sbjct: 57  FLRQRKFSIPKACEMLERYLALRQTFPHWFQGLDPFE-KTMVALGEEEVFHVLGFDAKGQ 115

Query: 432 RVTIARALDKNLDTNQLNDVFK-LAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQD 608
            V + ++ +  +D   L D+ + L M  E+  C  +  + AG V ++D      +H    
Sbjct: 116 IVILIKSRNFRVDKYDLEDLIRFLHMNMEILSC-DEMVQVAGVVLIVDCYEASMAHFTLF 174

Query: 609 FTSSAEEILSFVYRKLIQ*NWKEIHV 686
             S    I  ++   L+    +EIHV
Sbjct: 175 RLSEMRNIGPYI-NHLLPIRCREIHV 199


>UniRef50_Q7K1M4 Cluster: SD04017p; n=2; Sophophora|Rep: SD04017p -
           Drosophila melanogaster (Fruit fly)
          Length = 312

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR C + +E+ KK++  Y+T ++   E    R V   +L++L       TLP  + P G
Sbjct: 55  FLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVD-DKLIELARSGIFATLPKPIGPGG 113

Query: 429 RRVTIARALDKNLDTNQLNDVFK 497
            R+   R        + ++D+F+
Sbjct: 114 PRIHYTRMGHIEPSKHSVSDIFR 136


>UniRef50_UPI0000D9DE36 Cluster: PREDICTED: similar to ring finger
           and WD repeat domain 2 isoform a; n=1; Macaca
           mulatta|Rep: PREDICTED: similar to ring finger and WD
           repeat domain 2 isoform a - Macaca mulatta
          Length = 443

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 26/78 (33%), Positives = 40/78 (51%)
 Frame = -1

Query: 407 ECRSLGSIQQVH*LWSGYVSVREELWASSPHREVHIKFLFTFLKGEATASEKVIRHASSH 228
           + +  GS+ QV   WS ++ V+ +   SSP  E+    L++  K    +  K+ ++   H
Sbjct: 114 KAKQQGSLLQVR-TWSSHLLVKRDGQESSP-TELRT-MLYSLRKVGIESLYKLKKNGPIH 170

Query: 227 SSGRWGCFLSHSLIAAKS 174
           S  RW  FLS SL  AKS
Sbjct: 171 SCNRWENFLSGSLETAKS 188


>UniRef50_UPI0000D56BC1 Cluster: PREDICTED: similar to CG2663-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG2663-PB, isoform B - Tribolium castaneum
          Length = 294

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 3/105 (2%)
 Frame = +3

Query: 273 SLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVTIARA 452
           S+E  K+K+DMY+T+R+  PE F                    TLP LT +  RV+ ++ 
Sbjct: 87  SIELTKEKIDMYYTVRSLLPEVF------------------DETLPKLTKEMYRVSFSKI 128

Query: 453 LDKNLDTNQLNDVFKLAMISEM*DC--VKKSRE*A-GDVYVLDAS 578
             +N D  +  D  K  +I+ + +C  ++ S + A GD+++LDA+
Sbjct: 129 --RNTDLLEKTDFNK--VIAHLVNCQEIRLSEDVAFGDIFILDAA 169


>UniRef50_Q5QPC2 Cluster: Chromosome 20 open reading frame 121; n=3;
           Catarrhini|Rep: Chromosome 20 open reading frame 121 -
           Homo sapiens (Human)
          Length = 279

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>UniRef50_Q9BTX7 Cluster: CRAL-TRIO domain-containing protein
           C20orf121; n=26; Euteleostomi|Rep: CRAL-TRIO
           domain-containing protein C20orf121 - Homo sapiens
           (Human)
          Length = 342

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>UniRef50_UPI0000D56601 Cluster: PREDICTED: similar to CG2663-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG2663-PB, isoform B - Tribolium castaneum
          Length = 310

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = +1

Query: 103 IQPSGELWK-KIREELNEDVNTRAQDLAAIKEWLRKQPHL 219
           +QP  E  K +I +       T   D+ AI+EWL+KQPHL
Sbjct: 5   LQPISEAQKIEILKTFGRTPETVKSDIEAIEEWLKKQPHL 44


>UniRef50_Q13QC4 Cluster: Haemagluttinin like protein; n=2;
            Burkholderia|Rep: Haemagluttinin like protein -
            Burkholderia xenovorans (strain LB400)
          Length = 1246

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = -2

Query: 589  GIRIEASST*TSPAYSLDFFTQSYISDIIASLKTSLSWFVSRFLSSALAMVTRRP 425
            G +I A  + T P+Y +   TQ+ + D + SL   LS       +  + MVT+ P
Sbjct: 840  GAQINADGSLTGPSYHMQGGTQTTVGDALGSLDNGLSTLQQNMENGGIGMVTQDP 894


>UniRef50_Q7QCW6 Cluster: ENSANGP00000016869; n=2; Culicidae|Rep:
           ENSANGP00000016869 - Anopheles gambiae str. PEST
          Length = 285

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 23/78 (29%), Positives = 33/78 (42%)
 Frame = +3

Query: 276 LEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVTIARAL 455
           LE  KK   + +T+R   P  F NRD     +M++L       LP +     +    R +
Sbjct: 46  LEYAKKIFILGYTLRQNNPTIFDNRDPLNSNVMNILKAIDMVPLPSVEGCEDKFIYYRLV 105

Query: 456 DKNLDTNQLNDVFKLAMI 509
           D + D    NDV K   I
Sbjct: 106 DCDPDKFDFNDVIKTFFI 123


>UniRef50_Q7Z9J1 Cluster: Intron-encoded I-PpoI type endonuclease;
           n=1; Neoscytalidium dimidiatum|Rep: Intron-encoded
           I-PpoI type endonuclease - Neoscytalidium dimidiatum
          Length = 290

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +1

Query: 34  TKQLVPNWIVTYCKSEMASTATLIQPS-GELWKKIREELNEDVNTRAQDLAAIKEWLRKQ 210
           T Q V +  +   + E AS +T+ +P+  E    +RE   + +  RA+DL  +   L K 
Sbjct: 56  TAQKVVSETLAKSQLEEASQSTVSRPTTSESLLNVREVFQQALADRAEDLDEVSASLEKL 115

Query: 211 PHLPDEWEDACLMTF 255
             LP  W  A L+TF
Sbjct: 116 SRLPAGWCRAKLITF 130


>UniRef50_Q16Q19 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 316

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 20/86 (23%), Positives = 37/86 (43%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   F++ +  + ++ Y   R   P +F   D   PE+ ++L+     T  G    GR
Sbjct: 60  FLRFRKFAVHQAGEAIERYLVARKRFPHWFQKLDPRDPEMQEILSDTP-LTAIGRDEDGR 118

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMI 509
            + + R    N + N    + +  M+
Sbjct: 119 TIILIRINRYNPEVNTSTTILRFVMM 144



 Score = 33.1 bits (72), Expect = 8.3
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 136 REELNEDVNTRAQDLAAIKEWLRKQPHL 219
           ++EL ED N R Q +  +K+W+ K P++
Sbjct: 20  KDELREDDNVRLQAMEQLKDWIEKNPYI 47


>UniRef50_Q7QGG5 Cluster: ENSANGP00000018351; n=2; Culicidae|Rep:
           ENSANGP00000018351 - Anopheles gambiae str. PEST
          Length = 232

 Score = 33.9 bits (74), Expect = 4.7
 Identities = 45/175 (25%), Positives = 77/175 (44%), Gaps = 2/175 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPT-LPGLTPQG 428
           FLR   F +EK  K +  Y+ M+   PE F    V+ P  M  +   Q  T LP     G
Sbjct: 13  FLRAKKFDVEKAFKMMQKYYKMKEEYPEIF---KVSPPSEMKFMLEMQIQTMLPKKDEHG 69

Query: 429 RRVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKK-SRE*AGDVYVLDASILMPSHLRQ 605
           R++ + R    +     ++ VF+  +++ + D V+    +  G V +LD + L  +H R 
Sbjct: 70  RQIYLFRVEKCDPYKIPVDYVFRSNVLA-LEDAVRSPETQIGGLVVLLDMAGLGFAHARY 128

Query: 606 DFTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
                A++ +  V ++     +K  HV     PF   +   + K   LK+KI  +
Sbjct: 129 LSPHLAKKTVE-VVQEAFPLRFKAFHVLH--EPFYFDAILAVLKPF-LKDKIRRR 179


>UniRef50_UPI0000DB7FFC Cluster: PREDICTED: similar to dumpy
            CG33196-PB; n=4; Apis mellifera|Rep: PREDICTED: similar
            to dumpy CG33196-PB - Apis mellifera
          Length = 4920

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +1

Query: 202  RKQPHLPDEWEDACLMTFSEAVASPLRNVKRNLICTSR*GLLAQSSS 342
            R+QPH+P+  +D CL        S  RN++ + +C+   G L    S
Sbjct: 3841 REQPHVPESSKDPCLPVSPCGPNSQCRNIENHAVCSCLQGYLGSPPS 3887


>UniRef50_UPI0000D5720B Cluster: PREDICTED: similar to CG12926-PA
           isoform 1; n=2; Tribolium castaneum|Rep: PREDICTED:
           similar to CG12926-PA isoform 1 - Tribolium castaneum
          Length = 299

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 1/84 (1%)
 Frame = +3

Query: 270 FSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVTIAR 449
           FS+E+CK+K++ Y+T+R A  +  A+ +   P  + L        LP +T    R+ I +
Sbjct: 60  FSVERCKEKIENYYTLRGANLDLVADWEKIVPSKLALTCL----PLPHVTKDCERIVIMQ 115

Query: 450 ALDKNLDTNQLNDVFKLAM-ISEM 518
            ++ +          KL + ISE+
Sbjct: 116 LINPDPKAYDAVKTLKLTLAISEL 139


>UniRef50_Q5TRQ1 Cluster: ENSANGP00000028324; n=3; Culicidae|Rep:
           ENSANGP00000028324 - Anopheles gambiae str. PEST
          Length = 330

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +1

Query: 118 ELWKKI-REELNEDVNTRAQDLAAIKEWLRKQPHL 219
           +L++K+ ++EL ED   R Q L  ++EW+ K P++
Sbjct: 28  DLYRKMAKDELREDDEIREQSLTQMREWIAKHPYI 62


>UniRef50_Q7LZW9 Cluster: Hypothetical 11.7K protein; n=1; Beet
           cryptic virus 3|Rep: Hypothetical 11.7K protein - Beet
           cryptic virus 3
          Length = 107

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +1

Query: 1   LRSPVRHLNRITKQLVPNWIVTYCKSEMASTATLIQPSGELWKKIREELN 150
           L + +R  N++  QL+ N +    K + +S    ++PS  +W  IR  LN
Sbjct: 29  LGNSIRSFNKLKAQLISNLVTLESKLDQSSAYNHLEPSRFIWCSIRGTLN 78


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 847,977,124
Number of Sequences: 1657284
Number of extensions: 18239377
Number of successful extensions: 52872
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 50732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52848
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 67908372675
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).