SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30041
         (747 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0YFQ3 Cluster: Twin-arginine translocation pathway sig...    35   2.4  
UniRef50_Q58593 Cluster: Polyferredoxin protein vhuB; n=12; Meth...    33   7.5  

>UniRef50_Q0YFQ3 Cluster: Twin-arginine translocation pathway signal
           precursor; n=4; Geobacter|Rep: Twin-arginine
           translocation pathway signal precursor - Geobacter sp.
           FRC-32
          Length = 310

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -3

Query: 682 YSVTPDGAIFVNPSILPSCMRCVNVCEFIYKNKTYSS 572
           Y+ T +GA+  NP I   C  C+  C F     +YSS
Sbjct: 124 YTKTKEGAVIYNPKICVGCRNCMIACPFNVPGYSYSS 160


>UniRef50_Q58593 Cluster: Polyferredoxin protein vhuB; n=12;
           Methanococcales|Rep: Polyferredoxin protein vhuB -
           Methanococcus jannaschii
          Length = 394

 Score = 33.1 bits (72), Expect = 7.5
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = -3

Query: 733 IYRIKFYEF*AVCSGLIYSVTPDGAIFVNPSILPSCMRCVNVC 605
           IY +K  E   VC G +  V  +  I + P   P+C  CVN+C
Sbjct: 211 IYCLKCVE---VCPGDMIKVDEENLIVIPPKSCPACKLCVNIC 250


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 742,197,035
Number of Sequences: 1657284
Number of extensions: 14578672
Number of successful extensions: 28004
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 27148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28003
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 61323318355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).