SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   182   7e-45
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   182   9e-45
UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   177   2e-43
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   177   2e-43
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   164   1e-39
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...   155   1e-36
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...   149   8e-35
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...   141   2e-32
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...   138   1e-31
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...   135   8e-31
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...   134   1e-30
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...   133   4e-30
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...   128   9e-29
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...   126   5e-28
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...   126   6e-28
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...   125   8e-28
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...   124   2e-27
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...   123   3e-27
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...   120   2e-26
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...   120   3e-26
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...   119   7e-26
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...   116   7e-25
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...   114   2e-24
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...   113   3e-24
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...   113   4e-24
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...   111   2e-23
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...   111   2e-23
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...   109   6e-23
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...   109   6e-23
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...   109   8e-23
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...   108   1e-22
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...   108   1e-22
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   108   1e-22
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...   108   1e-22
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...   105   9e-22
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...   105   1e-21
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...   102   7e-21
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...   102   9e-21
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...   102   9e-21
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...   101   1e-20
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...   101   2e-20
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...   101   2e-20
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...   100   4e-20
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...   100   4e-20
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...    99   5e-20
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...    99   5e-20
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    99   5e-20
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...   100   6e-20
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    99   8e-20
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    99   8e-20
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    99   8e-20
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...    99   1e-19
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    99   1e-19
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    98   1e-19
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    98   1e-19
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    98   2e-19
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...    98   2e-19
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    96   6e-19
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    95   1e-18
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    94   2e-18
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    94   2e-18
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    92   1e-17
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    92   1e-17
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    92   1e-17
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...    90   4e-17
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    89   7e-17
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    89   9e-17
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...    89   9e-17
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    88   2e-16
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    87   3e-16
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    86   6e-16
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    86   6e-16
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    86   8e-16
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...    85   1e-15
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    85   1e-15
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    85   2e-15
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...    85   2e-15
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...    84   3e-15
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    83   4e-15
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...    80   5e-14
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    80   5e-14
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    79   9e-14
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    77   3e-13
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    77   5e-13
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    76   9e-13
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    76   9e-13
UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC 50318...    75   1e-12
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...    75   2e-12
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    74   3e-12
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...    73   5e-12
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    72   1e-11
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    72   1e-11
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    70   4e-11
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    69   1e-10
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    69   1e-10
UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261, w...    69   1e-10
UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;...    67   3e-10
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    66   7e-10
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    66   9e-10
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...    65   2e-09
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    65   2e-09
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    65   2e-09
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    64   3e-09
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...    64   3e-09
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    64   4e-09
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    64   4e-09
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    63   5e-09
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    63   5e-09
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    62   9e-09
UniRef50_Q7T3J8 Cluster: Beta actin; n=2; Oncorhynchus|Rep: Beta...    60   4e-08
UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmi...    59   8e-08
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...    58   1e-07
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...    58   1e-07
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    58   2e-07
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    58   2e-07
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    58   2e-07
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...    57   3e-07
UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytic...    57   4e-07
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    57   4e-07
UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3 actin...    56   6e-07
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    56   6e-07
UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2; Leis...    56   8e-07
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    56   8e-07
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...    56   1e-06
UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep: A...    56   1e-06
UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep: A...    56   1e-06
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_P53946 Cluster: Actin-related protein 5; n=7; Saccharom...    56   1e-06
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    55   1e-06
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    55   2e-06
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    55   2e-06
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    54   3e-06
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    54   4e-06
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    54   4e-06
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    53   5e-06
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    53   7e-06
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    52   1e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   2e-05
UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena ...    51   2e-05
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    51   3e-05
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    51   3e-05
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    50   4e-05
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_Q12406 Cluster: Actin-related protein 7; n=2; Saccharom...    50   4e-05
UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19; Euteleos...    50   5e-05
UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit (A...    48   2e-04
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    48   2e-04
UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces cere...    48   2e-04
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    48   2e-04
UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -...    48   3e-04
UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza sativa...    47   3e-04
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    47   5e-04
UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related prote...    47   5e-04
UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1; Tetra...    46   6e-04
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    46   6e-04
UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    46   8e-04
UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1; ...    46   8e-04
UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces cere...    46   0.001
UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative, expr...    45   0.002
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    45   0.002
UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n...    44   0.002
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    44   0.002
UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n...    44   0.004
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.004
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|R...    43   0.006
UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    43   0.008
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    42   0.013
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    42   0.013
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.017
UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    41   0.030
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    41   0.030
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    41   0.030
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    40   0.040
UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related prot...    40   0.053
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    40   0.053
UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26; Chordata...    40   0.053
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    40   0.053
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    40   0.070
UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin - ...    40   0.070
UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1; ...    40   0.070
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.070
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    39   0.093
UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Re...    39   0.12 
UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2; T...    39   0.12 
UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2; Cryp...    39   0.12 
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    39   0.12 
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    38   0.16 
UniRef50_Q5KBY2 Cluster: RNA polymerase II transcription factor,...    38   0.16 
UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1; Tetra...    38   0.21 
UniRef50_A7RTR6 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.21 
UniRef50_O94241 Cluster: Actin-like protein arp6; n=1; Schizosac...    38   0.21 
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    38   0.28 
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.28 
UniRef50_P45890 Cluster: Actin-like protein 13E; n=8; Eumetazoa|...    38   0.28 
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    38   0.28 
UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-rela...    37   0.37 
UniRef50_A2XWR6 Cluster: Putative uncharacterized protein; n=1; ...    37   0.37 
UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;...    37   0.37 
UniRef50_A0BG81 Cluster: Chromosome undetermined scaffold_105, w...    37   0.49 
UniRef50_Q10250 Cluster: Uncharacterized protein C56F8.02; n=1; ...    37   0.49 
UniRef50_UPI0000DA41DA Cluster: PREDICTED: hypothetical protein;...    36   0.65 
UniRef50_UPI00005A3A0C Cluster: PREDICTED: hypothetical protein ...    36   0.65 
UniRef50_Q6PB40 Cluster: Crim2 protein; n=3; Murinae|Rep: Crim2 ...    36   0.86 
UniRef50_Q6CPA7 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    36   0.86 
UniRef50_Q12509 Cluster: Actin-like protein ARP6; n=4; Saccharom...    36   0.86 
UniRef50_A0H4X8 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4; Tryp...    36   1.1  
UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23; Magnolio...    36   1.1  
UniRef50_UPI0000E8802E Cluster: Penicillin-binding protein, tran...    35   1.5  
UniRef50_Q0RUY6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.5  
UniRef50_UPI000065FABE Cluster: Histone deacetylase 6 (HD6).; n=...    35   2.0  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   2.0  
UniRef50_Q5CSJ5 Cluster: ARP3 actin related protein; n=2; Crypto...    35   2.0  
UniRef50_UPI0000E80BE6 Cluster: PREDICTED: hypothetical protein;...    34   2.6  
UniRef50_UPI0000499D03 Cluster: actin; n=1; Entamoeba histolytic...    34   2.6  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   2.6  
UniRef50_Q7QTA6 Cluster: GLP_15_20269_21672; n=1; Giardia lambli...    34   2.6  
UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_Q0UTE0 Cluster: Predicted protein; n=1; Phaeosphaeria n...    34   2.6  
UniRef50_A7I4I2 Cluster: Putative uncharacterized protein precur...    34   2.6  
UniRef50_Q6CJF4 Cluster: Actin-like protein ARP6; n=2; Saccharom...    34   2.6  
UniRef50_P91766 Cluster: Acetylcholine receptor subunit alpha-li...    34   2.6  
UniRef50_UPI0000D9E9B5 Cluster: PREDICTED: hypothetical protein;...    34   3.5  
UniRef50_Q6AG01 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_A4RYY1 Cluster: Predicted protein; n=2; Ostreococcus|Re...    34   3.5  
UniRef50_Q3M0W2 Cluster: Actin 4-2; n=3; Paramecium tetraurelia|...    34   3.5  
UniRef50_A6R471 Cluster: Predicted protein; n=1; Ajellomyces cap...    34   3.5  
UniRef50_Q3JL15 Cluster: Putative uncharacterized protein; n=1; ...    33   4.6  
UniRef50_A5CAW6 Cluster: Putative uncharacterized protein; n=1; ...    33   4.6  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   4.6  
UniRef50_Q2H5W0 Cluster: Putative uncharacterized protein; n=1; ...    33   4.6  
UniRef50_A4UCJ1 Cluster: Putative uncharacterized protein; n=1; ...    33   4.6  
UniRef50_Q4TD34 Cluster: Chromosome undetermined SCAF6552, whole...    33   6.1  
UniRef50_Q6AG37 Cluster: Transcriptional regulator, sugar-bindin...    33   6.1  
UniRef50_Q8GPN6 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_A2SCI7 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_A0U399 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_Q5VNE1 Cluster: Putative uncharacterized protein P0491D...    33   6.1  
UniRef50_Q22579 Cluster: Putative uncharacterized protein; n=2; ...    33   6.1  
UniRef50_Q8IUQ3 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    33   6.1  
UniRef50_Q640R3 Cluster: Hepatocyte cell adhesion molecule precu...    33   6.1  
UniRef50_Q3JWP0 Cluster: Putative uncharacterized protein; n=5; ...    33   8.0  
UniRef50_Q0SES8 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_A0V6T5 Cluster: 4'-phosphopantetheinyl transferase; n=1...    33   8.0  
UniRef50_Q5Z5L8 Cluster: Putative uncharacterized protein B1077E...    33   8.0  
UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|R...    33   8.0  
UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  

>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  182 bits (443), Expect = 7e-45
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 49  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 108

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 109 FNVPAMYVAIQAVLSLYASGRTTGI 133



 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 46/52 (88%), Positives = 47/52 (90%)
 Frame = +1

Query: 112 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+Y GDEAQSKRGILT   P
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYDGDEAQSKRGILTLKYP 52



 Score = 95.9 bits (228), Expect = 8e-19
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 134 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERG 179


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  182 bits (442), Expect = 9e-45
 Identities = 81/85 (95%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHG+V+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 70  LKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 129

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 130 FNVPAMYVAIQAVLSLYASGRTTGI 154



 Score =  129 bits (311), Expect = 7e-29
 Identities = 61/69 (88%), Positives = 63/69 (91%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVGDEAQSK
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSK 64

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 65  RGILTLKYP 73



 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 42/46 (91%), Positives = 43/46 (93%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAI+RLDLAGRDLTD LM IL ERG
Sbjct: 155 VLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTDNLMTILMERG 200


>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  177 bits (431), Expect = 2e-43
 Identities = 79/85 (92%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA+YVAIQAVLSLYASGRTTG+
Sbjct: 128 FAAPAVYVAIQAVLSLYASGRTTGV 152



 Score =  137 bits (331), Expect = 3e-31
 Identities = 62/71 (87%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILR+DLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRMDLAGRDLTDYLMKILTERG 198


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  177 bits (431), Expect = 2e-43
 Identities = 78/85 (91%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRV+PEEHPVLLTEAPLNPK NREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+ PAMYV+IQA+LSLYASGRTTG+
Sbjct: 127 FDVPAMYVSIQAILSLYASGRTTGI 151



 Score =  105 bits (252), Expect = 9e-22
 Identities = 48/68 (70%), Positives = 55/68 (80%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+ YVGDEAQ+KR
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKECYVGDEAQNKR 62

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 63  GILTLKYP 70



 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 37/46 (80%), Positives = 41/46 (89%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGY LPHAI R+D+AGRDLT ++MK  TERG
Sbjct: 152 VLDSGDGVSHTVPIYEGYVLPHAINRIDMAGRDLTYHMMKWFTERG 197


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  164 bits (399), Expect = 1e-39
 Identities = 73/85 (85%), Positives = 79/85 (92%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK NREKM ++MFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNREKMXRVMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA+ VA+ AVLSLYASGRTTG+
Sbjct: 129 FGAPAVCVAVLAVLSLYASGRTTGI 153



 Score =  110 bits (265), Expect = 3e-23
 Identities = 51/68 (75%), Positives = 57/68 (83%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+YVGDEAQ +R
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDAYVGDEAQVQR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILT+RG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTQRG 199


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score =  155 bits (375), Expect = 1e-36
 Identities = 66/85 (77%), Positives = 77/85 (90%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L++PI HGI T+WDD+E+IW HTFY ELR+ PEEHP+L+TE PLNPKANR+KMTQIMFET
Sbjct: 45  LRWPIVHGISTSWDDVEEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQKMTQIMFET 104

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPA Y AIQ+VLSLYASGRTTG+
Sbjct: 105 FNTPAFYTAIQSVLSLYASGRTTGI 129



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 36/48 (75%), Positives = 39/48 (81%)
 Frame = +1

Query: 124 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           GDDAPRAVFP+I GR R  GVMVGM QK+ YVGDEAQSKRGIL+   P
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKNCYVGDEAQSKRGILSLRWP 48



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 23/45 (51%), Positives = 35/45 (77%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSG  V++TVP+YEG+ LP+++ +L L G  +T+YLMKIL  +
Sbjct: 130 VVDSGYDVTYTVPVYEGHCLPYSVSKLALGGNHVTEYLMKILNNK 174


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score =  149 bits (360), Expect = 8e-35
 Identities = 67/84 (79%), Positives = 73/84 (86%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           KY IEHGIVT+WD M KIW HTF NEL+VAPEEHPVLLTE PLNPKANREK  ++MFETF
Sbjct: 140 KYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREKTIKVMFETF 199

Query: 438 NTPAMYVAIQAVLSLYASGRTTGM 509
            TPA Y+AIQA LSLYASGRTTG+
Sbjct: 200 KTPATYIAIQAALSLYASGRTTGI 223



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 34/63 (53%), Positives = 41/63 (65%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M   G++D Y+G    +KR
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMT--GKQDVYIG-SVNAKR 134

Query: 244 GIL 252
           G+L
Sbjct: 135 GVL 137


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score =  141 bits (341), Expect = 2e-32
 Identities = 58/85 (68%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YP+EHGIVT W DME IW H F  +L++ PE+HP+L+TEAPLNP++NREKM Q+MFE 
Sbjct: 80  LNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRSNREKMCQVMFEQ 139

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN P MY++IQAVL+LYASGRTTG+
Sbjct: 140 FNVPCMYISIQAVLALYASGRTTGV 164



 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 26/38 (68%), Positives = 34/38 (89%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 622
           V+DSGDGVSH VP+YEG+ALP +I R+D+AGRD+T +L
Sbjct: 165 VVDSGDGVSHIVPVYEGFALPPSIQRMDVAGRDVTSHL 202



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/74 (44%), Positives = 42/74 (56%), Gaps = 11/74 (14%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG-----------MGQKDSYVGD 225
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G               D +VGD
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAGSLTSSTSGSTIASDTDLFVGD 69

Query: 226 EAQSKRGILTSNTP 267
            AQ  RG+L  N P
Sbjct: 70  AAQKNRGLLRLNYP 83


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score =  138 bits (334), Expect = 1e-31
 Identities = 56/85 (65%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYPIEHGI+ NWDDMEKIWHH+FYN L V PE+HP+L+TE    PKAN+EK+ ++MFE+
Sbjct: 111 VKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKANKEKLIEVMFES 170

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA+YVAIQ +LSL++SGRT+G+
Sbjct: 171 FRVPALYVAIQDILSLFSSGRTSGL 195



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/58 (37%), Positives = 34/58 (58%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+++G+E   K
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDTFIGNEVIEK 105



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 19/46 (41%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           +++SGD +++ VPI  G  LP +I+ +++AG DL+  LMK L  +G
Sbjct: 196 IVNSGDQMTYGVPIEGGDILPDSIMTMEVAGHDLSMALMKSLVNKG 241


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score =  135 bits (327), Expect = 8e-31
 Identities = 60/102 (58%), Positives = 79/102 (77%)
 Frame = +3

Query: 204 ERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP 383
           E  V ++   E +    ++YP+EHGIVT+WDDMEKIW H  Y+EL+   E+HP+LLTE P
Sbjct: 53  EVFVGKKAAAELRGLLKIRYPLEHGIVTDWDDMEKIWSHV-YSELKCDAEQHPLLLTEPP 111

Query: 384 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           LNP++NR+   QI+FETFN PA++ +IQAVLSLYASGRTTG+
Sbjct: 112 LNPRSNRDTAAQILFETFNVPALHTSIQAVLSLYASGRTTGV 153



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 24/46 (52%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLD GDGVSH VP+Y+G+ +P++I R+D+AGRD+T+++  +L + G
Sbjct: 154 VLDVGDGVSHAVPVYQGFTVPNSIRRMDVAGRDVTEHMQTLLRKSG 199



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 28/65 (43%), Positives = 44/65 (67%), Gaps = 1/65 (1%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK-RGIL 252
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G  + + +VG +A ++ RG+L
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAGALEGEVFVGKKAAAELRGLL 68

Query: 253 TSNTP 267
               P
Sbjct: 69  KIRYP 73


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score =  134 bits (325), Expect = 1e-30
 Identities = 55/87 (63%), Positives = 71/87 (81%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L+ PIE+G ++NWDD+EKIWHHTFYNEL VAPEEHPV+L E P++P+ NREK  Q+MFET
Sbjct: 65  LRQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNREKKIQMMFET 124

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGMCW 515
           FN    Y+ +QAVL+L++ G TTG+ W
Sbjct: 125 FNVSGFYLGMQAVLALFSIGCTTGVVW 151



 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 31/63 (49%), Positives = 43/63 (68%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD +VG EA  K  +L  
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKDFFVGFEAVQKSDLLVL 65

Query: 259 NTP 267
             P
Sbjct: 66  RQP 68



 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 27/46 (58%), Positives = 35/46 (76%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V D+G+GVS TVPIYE Y LPHAI+R  ++G D+T +L K L +RG
Sbjct: 150 VWDAGEGVSFTVPIYEAYGLPHAIMRSTISGADITKHLQKTLLDRG 195


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score =  133 bits (321), Expect = 4e-30
 Identities = 66/117 (56%), Positives = 83/117 (70%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LK+PI++GI+ NWD+MEKIWHHTF  ++RV PE+HPVLLTEA +NP  NR +M +IMFE 
Sbjct: 61  LKHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHPVLLTEAAMNPLENRRRMVEIMFEC 119

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYPSTRDTHSLTPSCVWTWPVA 605
           FN P  YVA+QAVLSLYASGR+TG+ +          P   D H L P  V  +P+A
Sbjct: 120 FNVPFTYVAMQAVLSLYASGRSTGVVFDSGDGVSHSVP-VFDGHYL-PHAVQRFPLA 174



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 29/63 (46%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++Y+G EAQ  RG+L  
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERETYIGHEAQHMRGVLAL 61

Query: 259 NTP 267
             P
Sbjct: 62  KHP 64



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V DSGDGVSH+VP+++G+ LPHA+ R  LAG D+T +L+K+L E+G
Sbjct: 145 VFDSGDGVSHSVPVFDGHYLPHAVQRFPLAGVDVTLHLIKLLQEQG 190


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score =  128 bits (310), Expect = 9e-29
 Identities = 53/85 (62%), Positives = 71/85 (83%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++ YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +MTQI+FE
Sbjct: 64  NMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQILFE 123

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTG 506
           TFN PA+Y A QAVLSL ASGRT+G
Sbjct: 124 TFNFPALYTANQAVLSLIASGRTSG 148



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/67 (44%), Positives = 43/67 (64%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 246
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 247 ILTSNTP 267
            L    P
Sbjct: 62  ELNMYYP 68



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 22/45 (48%), Positives = 35/45 (77%)
 Frame = +2

Query: 512 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           ++SGDG+++ VP+  GY L  +  +LD+AG+DLT YLMK+L++ G
Sbjct: 151 IESGDGMTYFVPVMNGYPLHLSTTKLDIAGQDLTLYLMKLLSDNG 195


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score =  126 bits (304), Expect = 5e-28
 Identities = 52/84 (61%), Positives = 70/84 (83%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++ YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +MTQI+FE
Sbjct: 64  NMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQILFE 123

Query: 432 TFNTPAMYVAIQAVLSLYASGRTT 503
           TFN PA+Y A QAVLSL ASGRT+
Sbjct: 124 TFNFPALYTANQAVLSLIASGRTS 147



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/67 (44%), Positives = 43/67 (64%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 246
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 247 ILTSNTP 267
            L    P
Sbjct: 62  ELNMYYP 68


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score =  126 bits (303), Expect = 6e-28
 Identities = 52/85 (61%), Positives = 68/85 (80%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L +P++ G+V NWDDMEKIWHHT Y+ELRV PEEHP+L+T+ P   K +REKM QIMFET
Sbjct: 45  LMHPMQRGVVKNWDDMEKIWHHTLYHELRVQPEEHPILMTDTPFASKMDREKMAQIMFET 104

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+TP  YV + ++L+L ASGR +G+
Sbjct: 105 FDTPKFYVTLGSLLALNASGRRSGI 129



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 32/43 (74%), Positives = 36/43 (83%)
 Frame = +1

Query: 124 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           G DAPRAVFP+IVG  +H+G+ VGM QK  YVGDEAQSKRGIL
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQKSYYVGDEAQSKRGIL 43



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 25/46 (54%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VL SG  V++TVPIYE   L HA+ ++++ G DLTD+L+KI++ERG
Sbjct: 130 VLQSGGSVTYTVPIYEEKPLLHALQKVEIGGMDLTDHLLKIMSERG 175


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score =  125 bits (302), Expect = 8e-28
 Identities = 52/96 (54%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           RE+  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 28/46 (60%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ +L   L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEG 202


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score =  124 bits (299), Expect = 2e-27
 Identities = 50/85 (58%), Positives = 69/85 (81%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L +P++HG+VT+WDDMEKIW H + + LR  P++ PVLLTEAPLNP  NR KM +I FET
Sbjct: 71  LNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPPENRAKMVEIFFET 130

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA+YVA+Q +++LYA+G++TG+
Sbjct: 131 FQVPALYVALQGLMALYATGKSTGV 155



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 28/67 (41%), Positives = 40/67 (59%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 246
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK  YVG EAQ  R 
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQEAQDNRS 67

Query: 247 ILTSNTP 267
           ILT N P
Sbjct: 68  ILTLNHP 74



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 22/46 (47%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VL+ GDGV+  +PIY+G  L  +I R D AG D+T+YL  +  E+G
Sbjct: 156 VLECGDGVTAVIPIYQGRCLFQSISRSDFAGGDVTNYLAGLFLEKG 201


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score =  123 bits (297), Expect = 3e-27
 Identities = 53/85 (62%), Positives = 68/85 (80%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L+YPI HG+V+NWD+ME +W H F   L  APE+HPVLLTEA LNP  NR++M ++MFE 
Sbjct: 84  LRYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALNPLQNRQRMVELMFEA 142

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+ P  +VA+QAVL+LYASGRTTG+
Sbjct: 143 FSVPLTFVAVQAVLALYASGRTTGV 167



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 31/63 (49%), Positives = 45/63 (71%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM     ++ YVG +AQ  RG+LT 
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVGHDAQHMRGVLTL 84

Query: 259 NTP 267
             P
Sbjct: 85  RYP 87



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 32/46 (69%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSH+VP++EGY LPHA+ RLDLAG D+T  L K+L E G
Sbjct: 168 VLDSGDGVSHSVPVFEGYCLPHAVQRLDLAGADVTLQLQKLLLESG 213


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score =  120 bits (290), Expect = 2e-26
 Identities = 52/83 (62%), Positives = 67/83 (80%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           YP+EHGIV++WD ME++W H  Y +LRV PE   VLLTEAPLNP +NREKM + +FE+F 
Sbjct: 72  YPMEHGIVSDWDQMERVWRHA-YEQLRVPPERQAVLLTEAPLNPISNREKMAETLFESFG 130

Query: 441 TPAMYVAIQAVLSLYASGRTTGM 509
            PA++V IQAVL+LY+SGRT G+
Sbjct: 131 VPALHVQIQAVLTLYSSGRTDGL 153



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 25/44 (56%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
           VLDSGDGV+H VP++EG  +P ++ RL+LAGRDLT+++M++L++
Sbjct: 154 VLDSGDGVTHLVPVFEGQTMPQSVRRLELAGRDLTEWMMELLSD 197



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/62 (43%), Positives = 38/62 (61%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G   +         +  YVGDEA  ++
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTGVSMNTRSSGSSSSQRVYVGDEALQEK 66

Query: 244 GI 249
           G+
Sbjct: 67  GL 68


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score =  120 bits (289), Expect = 3e-26
 Identities = 54/84 (64%), Positives = 64/84 (76%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           + YPIEHGIV +W+DMEKIWH+ F  +L V   EHPVL+TE P NP  NR+KM QIMFET
Sbjct: 68  INYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNPMYNRQKMAQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTG 506
           F  PA YVA  A+LSLY+SGR +G
Sbjct: 128 FQIPAFYVANPALLSLYSSGRVSG 151



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 22/47 (46%), Positives = 35/47 (74%)
 Frame = +2

Query: 506 YVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           +V+++G GV+ T+ +YEGY L  A  R  LAGR++T YLM++L ++G
Sbjct: 152 FVIETGAGVTQTLAVYEGYCLEAATHRTGLAGREMTHYLMRLLNKKG 198



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 27/69 (39%), Positives = 40/69 (57%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V    G++++++G+     
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHV---DGKREAFIGEAIYKH 62

Query: 241 RGILTSNTP 267
           R +L  N P
Sbjct: 63  REVLGINYP 71


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score =  119 bits (286), Expect = 7e-26
 Identities = 50/85 (58%), Positives = 68/85 (80%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YP+E+G+VT+WD+MEKIW + + +EL V P E PVLLTE PLNP ++REKM ++MFE+
Sbjct: 71  LTYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHREKMAELMFES 130

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA+YVA+Q + +L+A  RTTGM
Sbjct: 131 FQVPALYVALQGLAALHACARTTGM 155



 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 38/63 (60%), Positives = 48/63 (76%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D YVG+EAQSKRGIL+ 
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRDWYVGEEAQSKRGILSL 71

Query: 259 NTP 267
             P
Sbjct: 72  TYP 74



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/46 (56%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+ TVPI+ G  L   + RLD AGR +T YL ++L E G
Sbjct: 156 VLDSGDGVTVTVPIHGGSCLLQGVTRLDFAGRGITKYLARLLMEIG 201


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score =  116 bits (278), Expect = 7e-25
 Identities = 45/88 (51%), Positives = 63/88 (71%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           D+  PIE+G++ NWDD+EK+WHHT+YNEL V P++HPV++TE     +  REK  Q+ FE
Sbjct: 64  DISKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQHAREKTIQMFFE 123

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGMCW 515
           TFN P  Y  +Q+V +L + G TTG+ W
Sbjct: 124 TFNVPGYYSGVQSVFALLSCGLTTGIVW 151



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/63 (36%), Positives = 37/63 (58%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G    D +VG+E  +K  ++  
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIGGKNVDFFVGNEVFTKSDLVDI 65

Query: 259 NTP 267
           + P
Sbjct: 66  SKP 68



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGT 649
           V D G+G S  VP+YEGY  PHA+L+  + G  LT +    L   GT
Sbjct: 150 VWDGGEGYSSVVPVYEGYQQPHAVLQSPICGEVLTKFFTDKLNAAGT 196


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score =  114 bits (275), Expect = 2e-24
 Identities = 59/77 (76%), Positives = 59/77 (76%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE                  MTQIMFETFN
Sbjct: 21  YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE------------------MTQIMFETFN 62

Query: 441 TPAMYVAIQAVLSLYAS 491
           TPAMYVAIQAVLSLYAS
Sbjct: 63  TPAMYVAIQAVLSLYAS 79



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +1

Query: 112 AGFAGDDAPRAVFPSIVGRP 171
           AGFAGDDAPRAVFPSIVGRP
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score =  113 bits (273), Expect = 3e-24
 Identities = 45/83 (54%), Positives = 65/83 (78%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           YP++HGI+ +WDDMEK+W+H F  EL+V   EHP L++E+PL P+  RE+  Q+MFETFN
Sbjct: 68  YPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIREQTVQMMFETFN 127

Query: 441 TPAMYVAIQAVLSLYASGRTTGM 509
            P++Y+AI A L L++ G+TTG+
Sbjct: 128 VPSLYMAISAALQLHSIGKTTGI 150



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 30/68 (44%), Positives = 46/68 (67%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD ++G++A  KR
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKDEFIGEDAYLKR 61

Query: 244 GILTSNTP 267
           G+L  + P
Sbjct: 62  GVLKFSYP 69



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 21/46 (45%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V D GD  +H VP+ +G+ +P    R+ LAG+DLT ++ K+L ERG
Sbjct: 151 VCDIGDSATHAVPVKDGFVIPDTSSRIQLAGKDLTSFMAKVLRERG 196


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score =  113 bits (272), Expect = 4e-24
 Identities = 58/77 (75%), Positives = 62/77 (80%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           KY IEHGIV NWDDME I HH FYN+L +APEE  +LLTE PLN KA  E MTQIMFETF
Sbjct: 122 KYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELYILLTEIPLNLKAKGE-MTQIMFETF 179

Query: 438 NTPAMYVAIQAVLSLYA 488
           NTPAMY+AIQ VL LYA
Sbjct: 180 NTPAMYLAIQTVLFLYA 196



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 18/24 (75%), Positives = 21/24 (87%)
 Frame = +1

Query: 184 VMVGMGQKDSYVGDEAQSKRGILT 255
           +MVGMGQKDSY+ +EAQ K GILT
Sbjct: 97  IMVGMGQKDSYIRNEAQRKWGILT 120


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score =  111 bits (266), Expect = 2e-23
 Identities = 47/86 (54%), Positives = 62/86 (72%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           D+ YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MFE
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMFE 126

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            +N   +++ +QAVLSLYA G  TG+
Sbjct: 127 KYNFAGVFIQVQAVLSLYAQGLLTGL 152



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 23/46 (50%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H VP+ +G++ PH   R+++AGR +T YL+ +L+ RG
Sbjct: 153 VIDSGDGVTHVVPVVDGFSYPHITKRMNVAGRHITSYLVDLLSRRG 198



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score =  111 bits (266), Expect = 2e-23
 Identities = 47/86 (54%), Positives = 62/86 (72%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           D+ YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MFE
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMFE 126

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            +N   +++ +QAVLSLYA G  TG+
Sbjct: 127 KYNFAGVFIQVQAVLSLYAQGLLTGL 152



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score =  109 bits (262), Expect = 6e-23
 Identities = 51/94 (54%), Positives = 60/94 (63%)
 Frame = +3

Query: 174 PSGCDGRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 353
           PSG  G    + ++  R  +  +     K P+E  I+TNWD  EKIWHHT  NEL VAPE
Sbjct: 10  PSGVRGGRDRKTVMGYRTQSIGREICLSKIPLERXIITNWDXQEKIWHHTLNNELEVAPE 69

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 455
           EHP L T+A  NPKANREKM Q MFE F+ PAMY
Sbjct: 70  EHPTLFTKAAWNPKANREKMAQXMFEPFSVPAMY 103


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score =  109 bits (262), Expect = 6e-23
 Identities = 45/92 (48%), Positives = 65/92 (70%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 413
           E + Y  + +P+EHG+V NW+DM  +W +TF  ++ + P    +LLTE P+NPKANR+KM
Sbjct: 61  ENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQKM 120

Query: 414 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
            ++MFE +    +YVAIQAVL+LYA G  TG+
Sbjct: 121 CEVMFEEYGFGGVYVAIQAVLTLYAQGLQTGV 152



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 30/46 (65%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H VP+Y+G+ALPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 153 VVDSGDGVTHIVPVYDGFALPHLTRRLDVAGRDVTRYLIKLLLMRG 198



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 32/65 (49%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQ-KDSYVGDEAQSKRGIL 252
           LVVDNG+G  K G+AG + P  VFPSIVGRP       +G  Q KD  +GDEA   R  L
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEERLGTSQLKDIMIGDEAAENRSYL 66

Query: 253 TSNTP 267
               P
Sbjct: 67  QVTHP 71


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score =  109 bits (261), Expect = 8e-23
 Identities = 44/82 (53%), Positives = 61/82 (74%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++HGIV NW   E +W HTF NEL+++ EEHPVLLTE PL PK +RE   Q+ FE+F  
Sbjct: 75  PVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPKLHRELCCQLFFESFGV 134

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PA+Y+A  ++LS+Y S +T+G+
Sbjct: 135 PALYLATTSLLSMYGSSKTSGL 156



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/40 (55%), Positives = 31/40 (77%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMK 628
           VLD G+GV+H+V I+EG  +P+AI RLD+ G DLT  ++K
Sbjct: 157 VLDIGEGVAHSVLIHEGCIMPYAITRLDMGGFDLTSQIVK 196



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV---GRPRHQGVMVGMG 201
           +E  AL++D GS + KAGFAG + P+  FP++V   G       +VG G
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNG 51


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score =  108 bits (260), Expect = 1e-22
 Identities = 47/92 (51%), Positives = 70/92 (76%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 413
           EQ+    L+YPI HGI+ NW+DM+ IW +  Y+EL+V+ +E+PVLLTE  +NP  ++ ++
Sbjct: 65  EQRGLLKLQYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYPVLLTEPAINPINHKFRV 123

Query: 414 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
            Q  FE FN PA+++A+Q VLSL+ASG+TTG+
Sbjct: 124 AQQFFENFNAPALFIAVQGVLSLFASGKTTGV 155



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 26/65 (40%), Positives = 42/65 (64%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D Y+G+ +  +RG+L  
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSDYYLGNISDEQRGLLKL 72

Query: 259 NTPSN 273
             P N
Sbjct: 73  QYPIN 77



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 22/46 (47%), Positives = 34/46 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++ GDGVS  VP+++GY+L +A  R+DL GRD+T++L  +L   G
Sbjct: 156 VVEIGDGVSQIVPVFDGYSLQYAQQRIDLGGRDITEHLNLLLRRSG 201


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score =  108 bits (259), Expect = 1e-22
 Identities = 44/83 (53%), Positives = 64/83 (77%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           YPI++G + +W+ +E+IW + F  +L+++P  HPVLLTEAP N K N+EKMTQIMFE F 
Sbjct: 63  YPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHPVLLTEAPCNSKINQEKMTQIMFENFE 122

Query: 441 TPAMYVAIQAVLSLYASGRTTGM 509
            P ++++ Q VLSLY+ G+TTG+
Sbjct: 123 VPFLHISNQTVLSLYSLGKTTGV 145



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 20/44 (45%), Positives = 32/44 (72%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
           +LDSG+G ++ VPIYEG+ L   + +LD+AG + T+Y+ + L E
Sbjct: 146 ILDSGEGATYCVPIYEGFQLRQQLSKLDIAGSNCTNYMSQTLKE 189


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score =  108 bits (259), Expect = 1e-22
 Identities = 51/64 (79%), Positives = 55/64 (85%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDSYVG EA SKRGIL+
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDSYVGWEAHSKRGILS 60

Query: 256 SNTP 267
            +TP
Sbjct: 61  LSTP 64


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score =  108 bits (259), Expect = 1e-22
 Identities = 41/82 (50%), Positives = 64/82 (78%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++FE FNT
Sbjct: 134 PLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNT 193

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM++A Q+ LS+Y+ GRT+G+
Sbjct: 194 PAMHIAYQSRLSMYSYGRTSGL 215



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 26/46 (56%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++ G GVS+ VPIYEGY LP    RLD AG DLT YL+ +L   G
Sbjct: 216 VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAG 261



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score =  105 bits (252), Expect = 9e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA Y++ QAVL+LYAS   TG+
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGL 155



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T+ LM++L   G
Sbjct: 156 VVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASG 201



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 256 SNTP 267
            ++P
Sbjct: 71  LHSP 74


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score =  105 bits (251), Expect = 1e-21
 Identities = 46/90 (51%), Positives = 63/90 (70%)
 Frame = +3

Query: 240 KRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 419
           ++Y DL  P+EHGIV NW+D   +  + F  +L++  E+HP+L+TEAPLNPK NR+KM +
Sbjct: 62  RQYLDLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLNPKDNRKKMCE 121

Query: 420 IMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           I FE FN P + V  QA+L LYA G  TG+
Sbjct: 122 IFFEQFNFPRLQVCPQALLVLYAQGLMTGV 151



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 26/46 (56%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H +PI E Y L H   R+D++GRD+T+ L+K+LT RG
Sbjct: 152 VVDSGDGVTHIMPIAENYILSHLTGRMDISGRDVTEQLVKLLTLRG 197


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score =  102 bits (245), Expect = 7e-21
 Identities = 42/85 (49%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L +P+  G+VT+WD+ME++W + F  +L   P +HPVLLTE+P N  A+R+K+ QIMFET
Sbjct: 69  LTFPVTRGVVTDWDEMERLWGYVF-QKLHARPTKHPVLLTESPKNRAADRDKLLQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN P+ ++ +Q +L+LYA G  TG+
Sbjct: 128 FNVPSTFLGVQGLLALYACGLVTGV 152



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 21/42 (50%), Positives = 31/42 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           VL+SG G +H VP+++G+ +PHA L  +L G DL+ +LMK L
Sbjct: 153 VLESGAGATHVVPVHQGFGIPHATLSQELGGHDLSHFLMKRL 194



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/61 (39%), Positives = 37/61 (60%)
 Frame = +1

Query: 70  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 249
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG       M   G ++  +    ++ R +
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVGIQISPDNMTASGLQNRNILTGWETSRSL 60

Query: 250 L 252
           L
Sbjct: 61  L 61


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score =  102 bits (244), Expect = 9e-21
 Identities = 41/85 (48%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           + YP+E G++T+WDDME +W H +   L++ P + PVL+TE  LNP ANR+++ ++ FE 
Sbjct: 129 ISYPVERGLITSWDDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQIVEVFFEH 188

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
              PA Y++IQAVL+L+A+G TTG+
Sbjct: 189 LGVPAFYMSIQAVLALFAAGFTTGL 213



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/63 (41%), Positives = 39/63 (61%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L+ 
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQS-RAAPGGLELCVGDQAQDWRSSLSI 129

Query: 259 NTP 267
           + P
Sbjct: 130 SYP 132


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score =  102 bits (244), Expect = 9e-21
 Identities = 39/82 (47%), Positives = 63/82 (76%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MFETF  
Sbjct: 114 PLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGI 173

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM+V  Q++LS+Y+ G+T+G+
Sbjct: 174 PAMHVTSQSLLSIYSYGKTSGL 195



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 27/46 (58%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++SG GVSH VPI EG  LP    R D AG DLT+YLM++L E G
Sbjct: 196 VVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAG 241



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score =  101 bits (243), Expect = 1e-20
 Identities = 41/85 (48%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           + YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE 
Sbjct: 66  ISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEH 125

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
              PA Y++IQAVL+L+A+G TTG+
Sbjct: 126 LGVPAFYMSIQAVLALFAAGFTTGL 150



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 27/46 (58%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+YLM ++   G
Sbjct: 151 VLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHG 196



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 27/63 (42%), Positives = 38/63 (60%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L  
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 259 NTP 267
           + P
Sbjct: 67  SYP 69


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score =  101 bits (242), Expect = 2e-20
 Identities = 46/94 (48%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query: 231 TEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 407
           +E +   ++ YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NRE
Sbjct: 62  SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 408 KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           K+ ++MFET+    +YVAIQAVL+LYA G  TG+
Sbjct: 122 KIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGV 155



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 29/46 (63%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YEG++LPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 156 VVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRG 201



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R +L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 253 TSNTP 267
             N P
Sbjct: 69  EVNYP 73


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score =  101 bits (241), Expect = 2e-20
 Identities = 41/93 (44%), Positives = 65/93 (69%)
 Frame = +3

Query: 231 TEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           T ++ + ++  P+  G++ NWD ME+IW+HTFY  L + P EHP+LL E   N +A REK
Sbjct: 75  TYRRPHMEIINPLSDGLIKNWDAMEQIWNHTFYERLHINPIEHPILLAEPTYNTRAIREK 134

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +T+IMFE ++ PA+++A  AVLS +AS + + +
Sbjct: 135 VTEIMFEKYHAPALFIAKNAVLSSFASSKASSL 167



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 22/61 (36%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDSYVGDEAQSK 240
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +++   VG G  +    D+++ K
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTGDSEMGEKDDSEPK 64

Query: 241 R 243
           R
Sbjct: 65  R 65



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 17/45 (37%), Positives = 31/45 (68%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           VLDSG G++   P++EG+ + + I++ +LAG  LT+   +IL+ +
Sbjct: 168 VLDSGGGMTSVTPVFEGFVVKNGIVKSNLAGNRLTEEYYRILSSK 212


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score =  100 bits (239), Expect = 4e-20
 Identities = 43/69 (62%), Positives = 54/69 (78%)
 Frame = +3

Query: 303 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 482
           +K W+H F ++L V+ ++HPV LTE P NPK N EKM Q MFE +  PAMYV+IQA+LSL
Sbjct: 235 KKFWNHAFNDQLCVSSDQHPVFLTEPPFNPKVNTEKMAQYMFECYGIPAMYVSIQAILSL 294

Query: 483 YASGRTTGM 509
           YASGRTTG+
Sbjct: 295 YASGRTTGI 303



 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 34/46 (73%), Positives = 41/46 (89%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG GVSHTVPIYEG A+ ++IL LDLAG DLTDY+MK+L+ERG
Sbjct: 304 VIDSGGGVSHTVPIYEGKAMTNSILHLDLAGNDLTDYMMKMLSERG 349


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score =  100 bits (239), Expect = 4e-20
 Identities = 46/91 (50%), Positives = 59/91 (64%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 413
           EQ +  +LK PI   +++N D++E  W H F  EL +   EHPVL+TE+P N K  REK+
Sbjct: 59  EQSKNLNLKCPISDRVISNIDEIEVFWQHIFSKELNINTSEHPVLMTESPQNTKIMREKV 118

Query: 414 TQIMFETFNTPAMYVAIQAVLSLYASGRTTG 506
           TQIM ETF  PA Y A   VLSLYA+G  +G
Sbjct: 119 TQIMMETFKVPAYYTAYPGVLSLYANGMASG 149



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDEA--QS 237
           EV+ +V+D G+   +AGF GD  P+ + P+++GR +  Q     +  KD YVG E   QS
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGRLKSPQDKAAAIATKDIYVGSEVFEQS 61

Query: 238 K 240
           K
Sbjct: 62  K 62



 Score = 39.1 bits (87), Expect = 0.093
 Identities = 13/44 (29%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
           V+D+G+ ++  +P+Y+ + + H   ++++ GR L  YL K+L +
Sbjct: 151 VIDAGETITQILPVYQCFGMTHITGKVEVGGRSLNAYLKKLLND 194


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score =   99 bits (238), Expect = 5e-20
 Identities = 40/81 (49%), Positives = 61/81 (75%)
 Frame = +3

Query: 267  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
            +  G+V++WD +E +W H FY +L+V PEE  VL+ ++P++P+ NREK+ +I+FE F+ P
Sbjct: 914  LNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEILFERFHVP 973

Query: 447  AMYVAIQAVLSLYASGRTTGM 509
            AM    QA+L+LYA GRTTG+
Sbjct: 974  AMQTVHQALLTLYAYGRTTGL 994



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 25/51 (49%), Positives = 30/51 (58%)
 Frame = +2

Query: 509  VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
            V+ SG G S+  PI  G   P    RLD+AG DLTDYL ++L   G  SLP
Sbjct: 995  VVGSGHGTSYVAPIITGDLAPIDTYRLDVAGADLTDYLTQLLLS-GGHSLP 1044


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score =   99 bits (238), Expect = 5e-20
 Identities = 55/100 (55%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +3

Query: 180 GCDGRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEK-IWHHTFYNELRVAPEE 356
           GCD     +  V       +K    LKYP + GIV NWDD  K IWHHTFY EL VAPE 
Sbjct: 15  GCDKSKQKDAYVEDE-AQSKKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAPEA 73

Query: 357 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVL 476
           H VLLTE  LN K N +KMTQ MFETF+TPA+ V+ Q++L
Sbjct: 74  HLVLLTEVLLNLKVNHDKMTQSMFETFSTPAI-VSSQSML 112


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score =   99 bits (238), Expect = 5e-20
 Identities = 42/83 (50%), Positives = 60/83 (72%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           YP++ GIV NWD MEK WH + ++ LR  P+E   +LTE P+NP  NRE + +I FETFN
Sbjct: 80  YPMKSGIVENWDLMEKFWHRSIFDYLRAEPDETTFILTEPPMNPPENRENIAEIFFETFN 139

Query: 441 TPAMYVAIQAVLSLYASGRTTGM 509
              +++++QAVLSL+++G  TGM
Sbjct: 140 AKGLHISVQAVLSLFSTG-LTGM 161



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 23/46 (50%), Positives = 33/46 (71%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H +P+ +GY +   I  + LAGRD+T ++  +L ERG
Sbjct: 162 VLDSGDGVTHCIPVADGYVIGSCIKHIPLAGRDITQFIQNLLKERG 207



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%)
 Frame = +1

Query: 82  VVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQK---DSYVGDEA 231
           V+DNG+G  K G+AG+  P+   P++V      Q V +        D Y+G EA
Sbjct: 16  VIDNGTGFTKMGWAGNTEPQFDIPTVVADHQEKQKVQMSKNTNENLDYYIGYEA 69


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 44/86 (51%), Positives = 61/86 (70%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++MFE
Sbjct: 54  VNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNPTKNREKIIEVMFE 113

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
           T+    +Y+AIQAVL+LYA G  TG+
Sbjct: 114 TYQFAGVYIAIQAVLTLYAQGLLTGV 139



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 28/49 (57%), Positives = 38/49 (77%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRS 655
           V+DSGDGV+H  P+YEG++LPH   RLD+AGRD+T YL+K+ +    RS
Sbjct: 140 VVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKVPSGAQRRS 188



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 40/78 (51%), Positives = 60/78 (76%)
 Frame = +3

Query: 276 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 455
           G+VT+WD +E +W+H FY++L V P+E  VL+ ++P++P+ NREK+ +++FE F  PAM 
Sbjct: 167 GVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREKVVELLFENFGVPAMQ 226

Query: 456 VAIQAVLSLYASGRTTGM 509
              QA+LSLYA GRTTG+
Sbjct: 227 TVHQALLSLYAYGRTTGL 244



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+ SG G S+  PI  G   P  + RLD+AG+DL++YL ++L   G
Sbjct: 245 VMGSGHGTSYVAPIITGELAPLNLYRLDVAGKDLSEYLSQLLLAGG 290



 Score = 41.5 bits (93), Expect = 0.017
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 168
           + +AA+V+D G+G  K G AG+D  RA+ P+ VGR
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVGR 140


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 42/84 (50%), Positives = 61/84 (72%), Gaps = 1/84 (1%)
 Frame = +3

Query: 261  YPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
            YP+   G+V++WD +E +W H FY  L V PEE  VL+ ++P++P+ NREK+ +I+FE F
Sbjct: 952  YPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPRTNREKVAEILFERF 1011

Query: 438  NTPAMYVAIQAVLSLYASGRTTGM 509
            + PAM    QA+L+LYA GRTTG+
Sbjct: 1012 HVPAMQTVHQALLALYAYGRTTGL 1035



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 25/51 (49%), Positives = 30/51 (58%)
 Frame = +2

Query: 509  VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
            VL SG G S+  PI  G   P    RLD+AG DLT+YL ++L   G  SLP
Sbjct: 1036 VLGSGYGTSYVAPILTGDLAPLDTYRLDVAGVDLTEYLAQLLL-AGGYSLP 1085



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 64   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 177
            +++AA+V+D G+G  K G A +D   +V PS V   +H
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQH 934


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 42/80 (52%), Positives = 55/80 (68%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           +L +PI+HGIV +WD ME+IW H  Y  LRV PEEH  +LTE P NP  NRE   ++MFE
Sbjct: 66  NLYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANPPENREHTAEVMFE 125

Query: 432 TFNTPAMYVAIQAVLSLYAS 491
           TF    +++A+Q  L+L AS
Sbjct: 126 TFGVKQLHIAVQGALALRAS 145



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/46 (52%), Positives = 37/46 (80%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H VPI +G+ + +AI  + LAGRD+T+++++ L ERG
Sbjct: 164 VVDSGDGVTHIVPIVDGFVMHNAIQHIPLAGRDITNFVLEWLRERG 209



 Score = 36.7 bits (81), Expect = 0.49
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGDEA 231
           +V+DNG+G  K G+AG++ P  + P+        R R   V   +   D YVGDEA
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPTAYADNEASRRRSHDVFSDL---DFYVGDEA 58


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 41/85 (48%), Positives = 61/85 (71%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YPIE GI+T WDDME +W HTF +E++  P++   +L++ P NPK N+EKM +I FE 
Sbjct: 77  LTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPKPNKEKMAEIFFEK 135

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F +P + +A QA L+L++ G+T G+
Sbjct: 136 FQSPGICLANQAALALFSLGKTCGL 160



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/67 (55%), Positives = 48/67 (71%), Gaps = 4/67 (5%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK----DSYVGDEAQSKRG 246
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+  +  K    DSYVG+EAQ++RG
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVLDDLTTKLNFRDSYVGEEAQNRRG 73

Query: 247 ILTSNTP 267
           +LT   P
Sbjct: 74  VLTLTYP 80



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
           ++DSG GV+H VPI+    LP   L++DLAG DL + L   L +
Sbjct: 161 IVDSGHGVTHVVPIHPENPLPPTTLQMDLAGGDLDEALFSHLVD 204


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 42/81 (51%), Positives = 59/81 (72%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           + HG+VT+WD +E++WH  FY+EL V PEE  VL T+APL+P  NREKM +++FE F  P
Sbjct: 48  LTHGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSPIINREKMAELLFEGFGVP 107

Query: 447 AMYVAIQAVLSLYASGRTTGM 509
           A+ V  + VL+ Y+ G TTG+
Sbjct: 108 AVLVMPRPVLATYSYGCTTGV 128



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 26/45 (57%), Positives = 31/45 (68%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           VL SG G S+ V + +GY LPHA  RLDLAG DLT YL ++L  R
Sbjct: 129 VLGSGAGTSYVVAVQDGYVLPHASFRLDLAGNDLTAYLSQMLAAR 173



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPS 156
           +++ A+V+D G G  ++G AGD+ PR+V PS
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS 40


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 49/102 (48%), Positives = 63/102 (61%)
 Frame = +3

Query: 198 GTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 377
           G E + R R  +      +L YPI HG V NWD ME+ W    +N LR  PE+H  LLTE
Sbjct: 128 GDEAIARSRNSSTY----NLSYPIVHGQVDNWDAMERFWQQCIFNYLRCDPEDHYFLLTE 183

Query: 378 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTT 503
           +PL    +RE   +IMFETFN P +Y+A+Q VL+L A+G TT
Sbjct: 184 SPLTAPESREYTGEIMFETFNVPGLYIAVQPVLAL-AAGYTT 224



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 19/51 (37%), Positives = 34/51 (66%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           V+D GDG +H VP+ +GY +  +I  + +AG+D+T ++ +++ ERG    P
Sbjct: 280 VVDVGDGATHVVPVADGYVIGSSIKSIPIAGKDVTLFVQQLMRERGEHVPP 330


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 41/85 (48%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ FE+
Sbjct: 110 LVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSPATNREKLVEVAFES 169

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
             +PAMYVA Q+VLS+YA GR +G+
Sbjct: 170 LRSPAMYVASQSVLSVYAHGRVSGL 194



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 24/46 (52%), Positives = 35/46 (76%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+D+G GV++TVP+++GY L HA  RLDLAG  LT +L ++L + G
Sbjct: 195 VVDTGHGVTYTVPVFQGYNLLHATERLDLAGNHLTAFLAEMLLQAG 240



 Score = 39.5 bits (88), Expect = 0.070
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 42/78 (53%), Positives = 54/78 (69%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGI+ +WD MEK      +  LR  PE+H  L+TE PLN   NRE + +IMFETF
Sbjct: 76  KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETF 135

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 136 NVPGLYIAVQAVLALAAS 153



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 20/45 (44%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EG+ +   I  + +AGRD+T ++ ++L ER
Sbjct: 168 VIDSGDGVTHAIPVAEGHVIGSCIKHIPIAGRDITYFIQQLLRER 212



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)
 Frame = +1

Query: 82  VVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQS 237
           V+D G+G  K G+AG+  P+ + P+         VG    + ++ G+   D ++GDEA  
Sbjct: 10  VIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAID 69

Query: 238 KRGILT 255
           K    T
Sbjct: 70  KPNYAT 75


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 41/86 (47%), Positives = 59/86 (68%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           D+ +PI +G + +W D+EK+W H F+NELRV+PE H  LLT+    P A RE+  +IM E
Sbjct: 68  DVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPETHCFLLTQPVNTPAAQRERTLEIMME 127

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
           TF+  ++Y+    VLSLY+ G TTG+
Sbjct: 128 TFHAHSLYLGTSQVLSLYSYGLTTGL 153



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/65 (43%), Positives = 41/65 (63%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +  VG+EA  K+GIL
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNEQEVGEEALLKQGIL 67

Query: 253 TSNTP 267
             + P
Sbjct: 68  DVHHP 72



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/46 (50%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG  V+H VPI+EGYAL   + +  +AG  LT YL  +L E+G
Sbjct: 154 VVDSGKDVTHAVPIHEGYALVRHVTQSPVAGAALTRYLGGLLREQG 199


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 96.3 bits (229), Expect = 6e-19
 Identities = 42/79 (53%), Positives = 54/79 (68%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFET
Sbjct: 74  IKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133

Query: 435 FNTPAMYVAIQAVLSLYAS 491
           FN P +Y+A+QAVL+L AS
Sbjct: 134 FNVPGLYIAVQAVLALAAS 152



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGR++T ++  +L ER
Sbjct: 167 VVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLRER 211



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 8/65 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 232 QSKRG 246
               G
Sbjct: 67  FDATG 71


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 39/91 (42%), Positives = 65/91 (71%)
 Frame = +3

Query: 237 QKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 416
           QK    +K+PIE G + NWDDMEK+ +++F+  L ++ +E+P+L+T++P N K NRE++T
Sbjct: 70  QKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFNSKMNRERLT 129

Query: 417 QIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           Q++FET+N+    V  +A LSL  SG+ + +
Sbjct: 130 QLLFETYNSKLASVTNRASLSLIGSGKESAI 160



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/72 (30%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +1

Query: 61  DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGM-GQKDSYVGDEA 231
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   +K  + G E 
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNKKVIFAGHEV 67

Query: 232 QSKRGILTSNTP 267
           ++++  ++   P
Sbjct: 68  ETQKTNISIKHP 79



 Score = 41.9 bits (94), Expect = 0.013
 Identities = 19/41 (46%), Positives = 27/41 (65%)
 Frame = +2

Query: 521 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           G G S+TVPIY+G  +  A+  L L G DL+++LM+ L  R
Sbjct: 165 GFGESYTVPIYQGKIITKAMSHLPLGGNDLSNFLMEFLKNR 205


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 41/86 (47%), Positives = 56/86 (65%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YP+    +  W D+  +W +  Y+EL +   EHP ++TE   N   NREK+T+I+FE 
Sbjct: 64  LSYPMHADKLETWTDVVDLWEYLLYDELDIGEGEHPFIVTEIAKNHPKNREKLTEILFEQ 123

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGMC 512
           F+ PAMY+A Q  LSLYASG TTG+C
Sbjct: 124 FSAPAMYLADQLSLSLYASGMTTGVC 149



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 3/71 (4%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYVGDEAQSKRG 246
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    GD A +K G
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKYGDAAVAKSG 60

Query: 247 ILTSNTPSNTE 279
           ++  + P + +
Sbjct: 61  VMHLSYPMHAD 71


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 20/45 (44%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L +R
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDR 211



 Score = 40.3 bits (90), Expect = 0.040
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 232 QSK 240
             K
Sbjct: 67  IEK 69


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 39/77 (50%), Positives = 54/77 (70%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P++   +RE   +IMFETF
Sbjct: 388 KHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRECAGEIMFETF 447

Query: 438 NTPAMYVAIQAVLSLYA 488
           N P +Y+++Q+VLSL A
Sbjct: 448 NVPGLYISVQSVLSLSA 464



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +2

Query: 497 YHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           Y   V+D GDG  H VP+  GY +  +I     +G D+T +++++L ERG    P
Sbjct: 488 YTGVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAP 542


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 44/100 (44%), Positives = 61/100 (61%)
 Frame = +3

Query: 180 GCDGRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 359
           G   + G  +L   +    +     L YPI++GIV NW+DMEK   +TFY +LRV P+ H
Sbjct: 34  GHPNKQGDTKLFYGKEAVARFSTSKLVYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQYH 93

Query: 360 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 479
            VLLTE  +N K NR KM +IMFET++ P++ +  Q  LS
Sbjct: 94  SVLLTETTMNTKENRNKMAEIMFETYDIPSIKIENQQKLS 133



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 183
           +++D GSG  K GF G+  P     +IVG P  QG
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQG 40


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEAPLNPKANREKMTQIMFE 431
           LKYPI+ GI+ +WD +  I     +N+  +  E EHP+LLTE P+NP ANREK  QI+FE
Sbjct: 68  LKYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPNANREKTMQILFE 127

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
           TF  P + +  +AVL LYA G+ TG+
Sbjct: 128 TFQAPLISLVNKAVLPLYAVGKLTGV 153



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG   ++ VP+YEGY L HA+LR D AG   T   ++IL + G
Sbjct: 154 VVDSGQDDTNIVPVYEGYYLQHAVLRRDYAGNACTQEFLQILNKSG 199



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/63 (39%), Positives = 35/63 (55%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGS   KAGF G  AP    P++VGRP+ +        +D Y G+EA +K   L+ 
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKLENSDEDF--EDQYFGEEAMAKANALSL 68

Query: 259 NTP 267
             P
Sbjct: 69  KYP 71


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 42/44 (95%), Positives = 43/44 (97%)
 Frame = +3

Query: 378 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           APLNPKANREKMTQIMFETFNTPAMYV IQAVLSLYASGRTTG+
Sbjct: 1   APLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGI 44



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 29/31 (93%), Positives = 29/31 (93%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAG 601
           VLDSGDGVSHTVPIYEGYALPHAILRL L G
Sbjct: 45  VLDSGDGVSHTVPIYEGYALPHAILRLILLG 75


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 89.4 bits (212), Expect = 7e-17
 Identities = 37/82 (45%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           PI+ GIV++WD ++ IW H F + L + P EHP+LL E PLN +  REK  ++MFE +  
Sbjct: 95  PIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAAELMFEKYKV 154

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PA+++A   VL+ +A+GR T +
Sbjct: 155 PALFMAKNPVLTSFATGRATSL 176



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 39



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           V+D G G +   P+++GY L  A++   L G  LTD L+K L  +G +  P
Sbjct: 177 VVDCGGGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKGIKIRP 227


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 89.0 bits (211), Expect = 9e-17
 Identities = 38/85 (44%), Positives = 57/85 (67%)
 Frame = +3

Query: 255  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
            L+Y    G+V NW ++E IW H   +EL V  E+HP+LLTE    PK  RE++ +++FET
Sbjct: 1303 LRYLPIGGVVDNWAELEHIWDHVVSHELNVKWEDHPILLTELASAPKRQRERILEVLFET 1362

Query: 435  FNTPAMYVAIQAVLSLYASGRTTGM 509
            + TPA +V  Q  L+L+A+G T+G+
Sbjct: 1363 YKTPACFVVNQGALALHANGETSGL 1387



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 24/59 (40%), Positives = 36/59 (61%)
 Frame = +1

Query: 79   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
            +++DNGS M +AG A   AP    P++VGR + + +     +KD YVG+E   K G+LT
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGRLK-KDIESYRNRKDVYVGNELTKKYGLLT 1293



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509  VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
            VL SG GV+  VP+Y+G  + +A+  L  AGR +T  L +IL +
Sbjct: 1388 VLSSGSGVTEVVPVYQGCTITNAVTTLPTAGRGVTRRLQRILMD 1431


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score = 89.0 bits (211), Expect = 9e-17
 Identities = 38/55 (69%), Positives = 44/55 (80%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 419
           +KYPIE GIVTNW+DME IWHHTFYNELRV P+E  V  T+ P + KA+REK TQ
Sbjct: 26  IKYPIERGIVTNWEDMETIWHHTFYNELRVDPKELLVFFTDVPKSTKASREKTTQ 80


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 36/82 (43%), Positives = 54/82 (65%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N    REK  ++MFE +  
Sbjct: 122 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKV 181

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PA+++A  AVL+ +ASGR T +
Sbjct: 182 PALFLAKNAVLTSFASGRATSL 203



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 159
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36



 Score = 36.7 bits (81), Expect = 0.49
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG G +    +++GY L  ++    + G  LTD +MK L  +G
Sbjct: 204 VVDSGGGSTVVAAVHDGYVLQKSVATSPIGGEFLTDCMMKSLESKG 249


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 37/95 (38%), Positives = 60/95 (63%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+++G+V +WD  + I  HT+   ++     HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 87  PLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNI 146

Query: 444 PAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYP 548
           PA ++   AVL+ +A+GR+TG+         T  P
Sbjct: 147 PAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIP 181



 Score = 40.7 bits (91), Expect = 0.030
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV ALV D GS   +AG+AG+D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           +LDSG   +  +P+++GY L   I++  LAG  +T    ++  E     +P
Sbjct: 169 ILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVP 219


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 40/86 (46%), Positives = 58/86 (67%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           +L+ PI+ GI+ +W+D+E IW   F  EL+V   +  V+LT+A L P  ++EKM QIMFE
Sbjct: 56  NLQQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTPPIHKEKMAQIMFE 114

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            F    + V +Q++L LY SGRTTG+
Sbjct: 115 GFGMKGLDVMMQSLLELYFSGRTTGV 140



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/46 (52%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+D G G+   VPIY GY + HA LRL  AG ++ +YL K+L ERG
Sbjct: 141 VVDCGYGMCQVVPIYNGYMMEHATLRLMCAGEEINEYLRKLLIERG 186



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG 201
           +++DNGSG+ KAG + ++ P+ VFP +VG  +    +  +G
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETNKLENIG 46


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 40/86 (46%), Positives = 55/86 (63%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           +L  P+E G V NW DME +W ++F  +L    + + VL+TE  LNP  NR+K  +++FE
Sbjct: 67  ELTKPVEEGTVKNWQDMELLWDYSF-KKLGAETKGNTVLMTEPVLNPAQNRKKTAEVLFE 125

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            FN   M + IQA+LSLY  G TTGM
Sbjct: 126 QFNFGRMQIGIQALLSLYCEGLTTGM 151



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 25/46 (54%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           +LDSGDGV+H +P+YE + LPH + R+++AGR +T+YL+K+L  RG
Sbjct: 152 LLDSGDGVTHCIPVYENFILPHLVKRMNIAGRHMTEYLIKLLFRRG 197



 Score = 41.5 bits (93), Expect = 0.017
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           +V D+G+G  K G+AGD+ P+   P+++GRP  R    +  +  K+  +G EA   + +L
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRPMLRFNQKIDDVELKEIMIGGEAAPYQAML 66

Query: 253 TSNTP 267
               P
Sbjct: 67  ELTKP 71


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 85.8 bits (203), Expect = 8e-16
 Identities = 39/83 (46%), Positives = 57/83 (68%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P++ GIV+NW+DMEKI+    Y E +VAPEE  +LLTE PL  K +  K+ +IMFET
Sbjct: 66  LTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAPEESDILLTEPPLTSKNDHNKLIEIMFET 125

Query: 435 FNTPAMYVAIQAVLSLYASGRTT 503
           F T ++ +  Q++LS Y+S  ++
Sbjct: 126 FCTQSVSLLDQSMLSFYSSSSSS 148



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 622
           V+D GD V++ VP Y G  L   I+R +  G D+  YL
Sbjct: 172 VVDIGDSVTNIVPFYNGVLLKEGIVRQEFGGSDIVTYL 209


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 37/84 (44%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYPI +  + ++D ME +WH  F+  L   PE+  +L+T      K  +EK TQIMFET
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNPEDSSILITSQLNTSKNEKEKTTQIMFET 80

Query: 435 FNTPAMYVAIQAVLSLYASGRTTG 506
           FN     + IQ++LSL++SG+TTG
Sbjct: 81  FNISKFIIQIQSILSLFSSGKTTG 104



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/45 (37%), Positives = 29/45 (64%)
 Frame = +2

Query: 506 YVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
           +V+DSG+  ++ VPIYEGY L       ++AG+  + YL  ++T+
Sbjct: 105 FVVDSGNDTTYFVPIYEGYKLDIKDNFCNIAGKSCSTYLNHLITQ 149


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 35/82 (42%), Positives = 55/82 (67%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           PIE G V +W++MEK+W H  Y+ELRV PE H  ++ ++   P + +EK  ++M ETF+ 
Sbjct: 73  PIESGRVVSWENMEKLWGHVMYSELRVRPESHCFIVPQSVNTPASQKEKTLELMMETFHV 132

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
            ++++    VLSLY+ G TTG+
Sbjct: 133 HSLFLGASQVLSLYSYGLTTGL 154



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +  +GD A
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNEYEIGDVA 61

Query: 232 QSKRGILTSNTP 267
            +KRG+LT ++P
Sbjct: 62  LAKRGMLTVSSP 73



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG   +  VP++EGYAL   +   D+AG  LT+Y   +L   G
Sbjct: 155 VIDSGKDRTMAVPVHEGYALGRHVAESDVAGEKLTEYFASLLRLEG 200


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/101 (40%), Positives = 65/101 (64%)
 Frame = +3

Query: 207 RLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 386
           ++V   +  E K  P+ ++ I+ G V NWD ME IW+++F + L +  + HPVL+TE P 
Sbjct: 125 KVVGLEKMRELKEMPN-QFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHPVLITEFPR 182

Query: 387 NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           N +  R+K  +IM ETFN P++++  QA LSL+ SG  +G+
Sbjct: 183 NDENYRQKTLEIMMETFNVPSLHIGNQAELSLFGSGLLSGI 223



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/66 (31%), Positives = 38/66 (57%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           ++ I  G +TNW+ ME IW + F  EL     +HP+L+T  P+N +   + +T++    F
Sbjct: 492 EFVINRGTITNWEAMESIWRYIF-GELNSGSMDHPLLITGLPMNDEYCLQLVTELF--AF 548

Query: 438 NTPAMY 455
           N+  ++
Sbjct: 549 NSSFLF 554



 Score = 39.1 bits (87), Expect = 0.093
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           E + LVVD GS  CKAG+ G+  P  + PS+VG
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVG 455



 Score = 35.9 bits (79), Expect = 0.86
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           E +++V+D GS  CKAG A ++ P    PS+VG
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVG 100


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/104 (39%), Positives = 63/104 (60%)
 Frame = +3

Query: 198 GTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 377
           GT +++  R  T  + +      ++ G++ +W+  EKI  H++ N L   P EHPVL +E
Sbjct: 77  GTTKIIVPRARTNMESF------MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSE 130

Query: 378 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +  N +A REK+T+IMFE F  PA Y++   VLS +A GRT G+
Sbjct: 131 SSWNDRARREKLTEIMFEKFQVPAYYLSKNVVLSCFAQGRTHGL 174



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 16/54 (29%), Positives = 34/54 (62%)
 Frame = +2

Query: 500 HRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           H  ++DSG   +  VP+++GYA+ HA+++  + G  +T+ L ++L ++    +P
Sbjct: 172 HGLMVDSGATQTSVVPVFDGYAVTHAVVKCPIGGDLITEQLAQMLDQQKIDVIP 225



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 162
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 37/99 (37%), Positives = 62/99 (62%), Gaps = 5/99 (5%)
 Frame = +3

Query: 228 GTEQKRY-----PDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 392
           G + KRY     P  + PIE+ ++TN+D+M++IW   F  +L++ PE+HP L+ ++ LN 
Sbjct: 43  GFDDKRYISKFGPTFRSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALNS 102

Query: 393 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
             NR++  QI  E +N P+   A  + L+LY +G T+G+
Sbjct: 103 LENRQQTLQIFMEEYNVPSFCPAFASSLALYNAGYTSGI 141



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 17/46 (36%), Positives = 33/46 (71%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG+  +  +P++E + L H + RLD+ G+ +++YL K+L ++G
Sbjct: 142 VVDSGESNTDIIPVFECFTLTHLVSRLDVGGKHVSEYLKKLLNQQG 187



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPS 156
           +V+D G  + KAGF GD  P  VFPS
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS 31


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 33/91 (36%), Positives = 62/91 (68%)
 Frame = +3

Query: 237 QKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 416
           Q++   L +PI+HG + +W   E++ ++ FY  L + P +  V++T+ PL    + EK+T
Sbjct: 75  QRKKLSLTFPIDHGHIDDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLCSNRHEEKIT 134

Query: 417 QIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           ++MFE F T ++ +A+Q +++LY++GRTTG+
Sbjct: 135 ELMFEMFQTQSLNIALQGLMALYSAGRTTGV 165



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 18/44 (40%), Positives = 32/44 (72%)
 Frame = +2

Query: 515 DSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           D G+GV+  VP+Y+GY    ++ R D+ G+++T YL K+L+++G
Sbjct: 168 DIGEGVTQVVPVYDGYCDSSSLRRADIGGQEITMYLQKLLSDKG 211



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/63 (36%), Positives = 35/63 (55%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+D GS   KAG   D +P  +FPS+VG+ R + V         +VG+EA ++R  L+ 
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYVPEDEDNNPIFVGEEAIAQRKKLSL 81

Query: 259 NTP 267
             P
Sbjct: 82  TFP 84


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -3

Query: 509 HTGGTTGR-VQREHGLDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEKDGMFLGGDTEL 333
           H   +T R VQ +HGLDG VHG  VE  +HD                ++DG+ LG  T+L
Sbjct: 22  HNASSTARGVQGQHGLDGHVHGWGVEGLKHDLGHLLVVGLGVQGCLGQQDGVLLGSHTQL 81

Query: 332 IVEGMMPNLLHVIPVSDDSVFDGVFE 255
           +VEG++P+LLHV+PV DD+V  GV +
Sbjct: 82  VVEGVVPDLLHVVPVGDDAVLHGVLQ 107



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/71 (40%), Positives = 41/71 (57%)
 Frame = -2

Query: 255 GQDTSFALCLVSYVRVFLSHADHHTLMAGPSDDRGEYGARSIISCETGLAHTGAIVYYQR 76
           GQD S AL L++++ + L HA HH L+ G   D  E     II+C+ GLAH  A+V    
Sbjct: 108 GQDASLALGLIAHIGLHLMHAPHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGH 167

Query: 75  GNFLVAHLELV 43
           G  ++ H EL+
Sbjct: 168 GGIII-HGELI 177


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 35/86 (40%), Positives = 56/86 (65%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           D+ YPI +GI+ N D+M  +W +TF   L++ P EH +LL+E PL    +R  + ++MFE
Sbjct: 81  DMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINPSEHRLLLSEVPLFSSKHRCHLYEVMFE 140

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            +N  A+  A+Q  LSL+++G  TG+
Sbjct: 141 KYNFMAIQSAVQGTLSLFSNGLQTGV 166



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 23/45 (51%), Positives = 37/45 (82%)
 Frame = +2

Query: 512 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           ++SG+G+SH  PI+EGYALP A  R+DL GR++T++L++++  RG
Sbjct: 168 VESGEGISHCTPIFEGYALPKANRRVDLGGRNITEFLIRLMQRRG 212



 Score = 41.5 bits (93), Expect = 0.017
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           E   +V+DNGSG  K G+AG + P AVF + +GRP
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRP 38


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 35/85 (41%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L +PI HGIV +W  ME++ HHTF  E  +  EE  ++ TE    PK N E++ +++FE 
Sbjct: 69  LHHPIRHGIVKDWPRMEQVIHHTFV-EFGMNSEETSIVCTEPLFTPKRNSEQLAEVLFEA 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  P++ +    + +LY+SGRTTG+
Sbjct: 128 FGVPSIALIPSGMCALYSSGRTTGV 152



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 21/46 (45%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+   P+Y+ Y + +A  R +L G ++T++L  +L ERG
Sbjct: 153 VLDSGDGVTQVTPVYDSYIIRNAASRFNLGGHEVTEHLRTLLFERG 198



 Score = 33.9 bits (74), Expect = 3.5
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           ++VD GS + KAG   +  P  +FP++VG P
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVP 32


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 37/89 (41%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 246 YPD-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 422
           +PD   YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I
Sbjct: 59  HPDTFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEI 117

Query: 423 MFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +FE  + P++ +A Q  +SLYASG  TG+
Sbjct: 118 LFELLHVPSVLLADQLQMSLYASGLLTGV 146



 Score = 39.1 bits (87), Expect = 0.093
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           V+DSG G++   P ++G  LP +   L+ AG+DL+ YL+K L
Sbjct: 147 VVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSL 188



 Score = 36.7 bits (81), Expect = 0.49
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIV 162
           +++D+GSG  KAG AG + P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 35/77 (45%), Positives = 47/77 (61%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+EHG+V NWD ME+ W H F   L V P++  VLLTEA + P   RE   +IMFE+F  
Sbjct: 68  PLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVLLTEAAVTPYEQREMTAEIMFESFGV 127

Query: 444 PAMYVAIQAVLSLYASG 494
           P + +  QA+  L + G
Sbjct: 128 PRLCIGSQALFVLSSVG 144



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
           V++SG GV+  VPI  GYA+  A  R  +AG D+T Y++K L E
Sbjct: 152 VVESGAGVTQVVPIVAGYAVSGAARRFPVAGWDITQYVLKSLRE 195


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +3

Query: 228 GTEQKRYPDLKYP--IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 401
           G E   Y D++    + +G + NW+  E + ++   +ELRV PE+H +LLTE   +P ++
Sbjct: 58  GEEALLYSDIETMEVMHNGFIINWEAAENLCYYLLKHELRVNPEDHALLLTEPLFSPTSS 117

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           RE M ++ FE   TP ++VA Q VLS Y  G+ + +
Sbjct: 118 RENMAEMAFEVLGTPGLFVAPQPVLSAYTHGKISAL 153



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 18/46 (39%), Positives = 27/46 (58%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLD G   +  VP+ EG ++  +  + D+AGR LT YL  +L + G
Sbjct: 154 VLDMGHAATRVVPVLEGRSMACSSKQTDVAGRCLTWYLSTLLEDTG 199


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 33/92 (35%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREK 410
           E++    L+ P     + +WD +E +W +   N+L +   +EHPV+LT +    K   EK
Sbjct: 65  ERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTG 506
           M +++FE F+ PA+Y +   ++SLY  GRTTG
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTG 156



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/77 (33%), Positives = 44/77 (57%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++Y+G+ A  +R  L  
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERRATLHL 72

Query: 259 NTPSNTESSLTGMTWRR 309
            +P +T +    M+W R
Sbjct: 73  ESPYSTNAI---MSWDR 86


>UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC
           50318|Rep: Actin-3 - Cercomonas sp. ATCC 50318
          Length = 266

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 31/49 (63%), Positives = 43/49 (87%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRS 655
           VLDSGDG+++TVPIY+GYA+P A LR+DL+G D+TD+LM+++T RG  S
Sbjct: 27  VLDSGDGITYTVPIYDGYAIPQATLRMDLSGCDITDHLMELITARGHHS 75



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 15/25 (60%), Positives = 23/25 (92%)
 Frame = +3

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPA++++  A+L+LY+SGRTTG+
Sbjct: 2   FNTPAVHISNSAMLALYSSGRTTGV 26


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 35/71 (49%), Positives = 42/71 (59%)
 Frame = +2

Query: 254 PQIPHRTRNRH*LG*HGEDLASYLLQ*APCRPRGTXXXXXXXXXXXXXXXXEDDPDHVRN 433
           P++ HR R+ H LG HGEDLA +LLQ A C PR                  EDDPDHVR+
Sbjct: 31  PEVSHRARHHHQLGRHGEDLAPHLLQRAACGPRRAPHPGDRGPSQPKSQQREDDPDHVRD 90

Query: 434 IQHARHVRRHP 466
           +Q  R+VRRHP
Sbjct: 91  VQCTRNVRRHP 101


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 37/82 (45%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 441 TPAMYVAIQAVLSLYASGRTTG 506
               Y + QAVLSLYA GR +G
Sbjct: 117 VSGFYASEQAVLSLYAVGRISG 138


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 37/82 (45%), Positives = 48/82 (58%)
 Frame = -3

Query: 503 GGTTGRVQREHGLDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEKDGMFLGGDTELIVE 324
           GG    ++R+  L+  VH  RVE  EHD                E++GMFL GD +L+VE
Sbjct: 351 GGPARCIERQDSLNSYVHSRRVERLEHDLRHLLSVGLRVERSLGEENGMFLWGDAQLVVE 410

Query: 323 GMMPNLLHVIPVSDDSVFDGVF 258
           G+MP+LLHVIPV D SV D +F
Sbjct: 411 GVMPDLLHVIPVGDYSVLDRIF 432



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 10/76 (13%)
 Frame = -2

Query: 252 QDTSFALCLVSYVRVFLSHADHHTL----------MAGPSDDRGEYGARSIISCETGLAH 103
           +DT+  L LV+YV V L+HADH  L          +AGP+DD  + G+R +++ ET LAH
Sbjct: 435 EDTALGLGLVAYVGVLLAHADHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAH 494

Query: 102 TGAIVYYQRGNFLVAH 55
           + +IV ++ G  +VAH
Sbjct: 495 SRSIVNHESGYVVVAH 510


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 33/82 (40%), Positives = 55/82 (67%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           PI+HG +++WD  +K+W +T  N +  +     +LLTE PL   ++R+KM +I FE F+T
Sbjct: 62  PIDHGHISDWDKAQKVWDYTL-NCVDPSKSIKDILLTEPPLCSISHRKKMGEIFFEYFDT 120

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
             + +++  ++SLYASG TTG+
Sbjct: 121 LNLNLSVSGLMSLYASGLTTGL 142



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/46 (36%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLD G+GV+  +P+++GY   ++I+R D  G +L+ +L K++ + G
Sbjct: 143 VLDIGEGVTQCLPVFDGYIEKNSIIRSDFGGEELSMFLQKLICDIG 188



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 23/55 (41%), Positives = 29/55 (52%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           E   +V+DNGSG  KAG    + P  VFP+IVG  ++         K  Y GDEA
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVGIEKNDET------KRIYTGDEA 50


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 33/84 (39%), Positives = 48/84 (57%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + MFE
Sbjct: 64  EIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLETMFE 123

Query: 432 TFNTPAMYVAIQAVLSLYASGRTT 503
           +   PA Y+A Q   + +ASG+ T
Sbjct: 124 SLRCPATYLAKQETCAAFASGKGT 147



 Score = 40.3 bits (90), Expect = 0.040
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 31/80 (38%), Positives = 49/80 (61%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 449
           E+G++ +W+ +E IW H     L +  +EHPVLL+E   N  A R KM ++MFE    PA
Sbjct: 80  ENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAVRAKMVELMFEKHAPPA 139

Query: 450 MYVAIQAVLSLYASGRTTGM 509
           +++A   VLS +A G+ + +
Sbjct: 140 LFLAKSPVLSSFAVGKASSL 159



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVG 38



 Score = 33.1 bits (72), Expect = 6.1
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+D G   +    I++G+AL  +++R  L G  LTD ++K L ++
Sbjct: 160 VIDMGGKHTTVSAIHDGFALQKSVVRSPLGGEALTDVVLKYLEKK 204


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 32/87 (36%), Positives = 52/87 (59%)
 Frame = +3

Query: 246 YPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 425
           +  L + I+HG ++++D ME +W + F   L V  +  PVLLTEAP     +R K ++I 
Sbjct: 61  FMSLDHLIDHGHISDFDKMEGLWQYCF-TRLEVHSDCRPVLLTEAPFTSPKHRIKSSEIF 119

Query: 426 FETFNTPAMYVAIQAVLSLYASGRTTG 506
           FE FN   + +++  +LS+Y  G+ TG
Sbjct: 120 FERFNVDDLNISVAGLLSMYGLGKLTG 146



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/46 (45%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++ GDGV+  +P+ EGY+   +I R+D  G +LT YL K+L  RG
Sbjct: 148 VVEVGDGVTQVLPVIEGYSERSSIKRVDFGGIELTMYLQKMLCTRG 193



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPR 38


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 33/86 (38%), Positives = 49/86 (56%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           +L  PIE+G+V NW+   ++W   F N+     E+  +L  E P   + N+ KM QI+FE
Sbjct: 65  NLVNPIENGVVQNWEFQTQLWDELFANQFHCPLEDVCILTGEKPACTQQNKAKMAQILFE 124

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            FN        Q+VLSL++ GR TG+
Sbjct: 125 KFNCGGFSSIQQSVLSLFSIGRRTGL 150



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 25/67 (37%), Positives = 39/67 (58%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 246
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K  +VG+EA +K  
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNKAYFVGNEALAKEN 62

Query: 247 ILTSNTP 267
           +L    P
Sbjct: 63  LLNLVNP 69



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 19/45 (42%), Positives = 32/45 (71%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V D+G+G+   VP+YEGY +PHAI+  +L G  LT+ + +++T +
Sbjct: 151 VFDNGEGLGSIVPVYEGYTIPHAIIHTELCGSFLTENMKRLITTK 195


>UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_261, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 232

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELR--VAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           P+  G++ +WD ME + +H  Y  LR  +  E H +L T+    PKA RE++ Q+MFE F
Sbjct: 99  PVVRGLIRDWDTMEDLLNHVLYTGLRWEMGNEGH-ILFTDPLSTPKAFREQLVQLMFEIF 157

Query: 438 NTPAMYVAIQAVLSLYASGRTTG 506
           N    Y + Q VLSL+  GR +G
Sbjct: 158 NISDFYASEQVVLSLHVVGRISG 180


>UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Actin-57B - Tribolium castaneum
          Length = 291

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 41/95 (43%), Positives = 53/95 (55%), Gaps = 2/95 (2%)
 Frame = +3

Query: 327 YNELRVAPEEHPVLLTEAPLNP--KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT 500
           Y +L+VAPE HPVLLT+ P  P  KA  EK+ QIMFE F  PA+++   +VLSLY+ G  
Sbjct: 14  YKQLKVAPENHPVLLTK-PYFPISKATTEKIAQIMFEDFKIPALHLIYPSVLSLYSYGSL 72

Query: 501 TGMCWTPATVSPTPYPSTRDTHSLTPSCVWTWPVA 605
           TG+           YP   + H L  +     PVA
Sbjct: 73  TGLVVQSGNFESQFYP-IYEGHILERTLTRGLPVA 106


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 28/79 (35%), Positives = 50/79 (63%)
 Frame = +3

Query: 273 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 452
           +G V +WD  EK+    + N++RV P E+ +L++E+ L+ +  REK+ Q+ FE+   P  
Sbjct: 101 NGEVKDWDAFEKLLLDVYENQIRVQPSEYCLLISESSLHNQRQREKICQLAFESLKVPNF 160

Query: 453 YVAIQAVLSLYASGRTTGM 509
           ++    VLS ++SGR+T +
Sbjct: 161 FIVKSGVLSCFSSGRSTAL 179



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           M  E++ A+VVD GS   +AG++G+D PR V PS VG
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVG 37



 Score = 39.1 bits (87), Expect = 0.093
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-TERGTRSLP 661
           VLD+G   ++ VP+++GY L  ++ + D+ G  LT+ ++  L  E+ TR  P
Sbjct: 180 VLDTGAYSTYAVPVHDGYVLQKSVRKFDIGGEFLTEKILNNLQKEQNTRVYP 231


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           ++PI  G V NW+ ME +  + F   L +  E+H +L+T    +  ++R K+ ++M ETF
Sbjct: 66  EFPIVRGQVKNWEAMETVLTYAF-ESLGIKTEDHAILVTGFLSHRASHRMKLLEVMMETF 124

Query: 438 NTPAMYVAIQAVLSLYASGRTTGM 509
           N P++Y+   A L LY SG  TG+
Sbjct: 125 NVPSLYIGELAELCLYGSGILTGL 148


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 35/92 (38%), Positives = 56/92 (60%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 413
           EQKR   +K PI++G + +      ++ +   +E +   +  P+L TE  LNPK  REK 
Sbjct: 53  EQKREFQIKSPIKNGTIEDISMASALFKNAL-DECQGYGK--PILFTEPALNPKQIREKT 109

Query: 414 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
            Q++FE F  P++Y +IQ +LSL+AS +T G+
Sbjct: 110 IQLLFERFKVPSVYFSIQPILSLFASEKTDGL 141



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/45 (37%), Positives = 30/45 (66%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSG  ++  +PIYEGY +   + +  +AG DL +YL+  ++E+
Sbjct: 142 VIDSGADITQIIPIYEGYVISSCVHKQYVAGNDLLEYLVSTISEK 186



 Score = 39.9 bits (89), Expect = 0.053
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 222
           +V+D GS  C+ G AG+  P  +FPS VG PR +  +    + D YVG
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREKSQL----KPDFYVG 48


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 35/105 (33%), Positives = 54/105 (51%)
 Frame = +3

Query: 195 HGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 374
           HG + +   +   E++    L YPI+HGI+ NWD  + +       +L  +  E  V   
Sbjct: 44  HGCDVVSVGKDAAERRGLLHLTYPIQHGIIVNWDVWQLLLQQ-IEQQLDASLAEKSVFWV 102

Query: 375 EAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E P + +  R ++ QI+FE      M V I  +LSLYA+G TTG+
Sbjct: 103 EHPFSSRPQRARVAQILFEEKGIFGMCVGIAPLLSLYATGETTGI 147



 Score = 39.9 bits (89), Expect = 0.053
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGT 649
           VLD G+GVS      +GYA+   + R D  G  +T YL ++L E G+
Sbjct: 148 VLDVGEGVSSVAAAVQGYAVTGMMQREDFGGGAVTQYLQRLLREYGS 194


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/82 (35%), Positives = 49/82 (59%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++ +P+  GIV +WD ++ IW ++    L    + HP++LTE   N +AN+ K  +I FE
Sbjct: 84  EVLHPLTDGIVADWDAVQNIWEYSLAR-LNADTKTHPLMLTEPCWNTQANKLKALEIAFE 142

Query: 432 TFNTPAMYVAIQAVLSLYASGR 497
           +   PA Y+   AV S +A+G+
Sbjct: 143 SLEVPASYLVKDAVASAFAAGK 164



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EVA LV+D GS   + G+AG+D P+ V  +  G
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECG 47


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 26/32 (81%), Positives = 29/32 (90%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 350
           LKYPIE G+VTN DDMEKIWHHTFYN+LR+ P
Sbjct: 21  LKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 20/24 (83%), Positives = 20/24 (83%)
 Frame = +1

Query: 196 MGQKDSYVGDEAQSKRGILTSNTP 267
           MGQKDSYVGDEAQSK GILT   P
Sbjct: 1   MGQKDSYVGDEAQSKYGILTLKYP 24


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 29/92 (31%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +3

Query: 237 QKRYPDLKY-PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-PKANREK 410
           +K  P+  Y P ++G +TN DD+E+++H+ F  E+ + PE+  V+++  PLN P++ R  
Sbjct: 67  EKSDPNSLYNPFKNGYITNPDDIERLFHYIFEKEIHINPEKKSVIIS-TPLNGPQSQRNI 125

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTG 506
           + +I+FE +   +++++    L +Y + R TG
Sbjct: 126 IAEILFEKYKIGSLHISTPNTLGMYTTSRFTG 157


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 26/84 (30%), Positives = 52/84 (61%)
 Frame = +3

Query: 282 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 461
           VT+WD  E+I  H  + + ++   +HP++L E P   ++ R+KM ++ FE  + P  Y+A
Sbjct: 61  VTDWDSFEQIIQHAIWTKSKIKSSDHPLVLIEKPGLERSCRQKMVELAFEGLDVPEFYLA 120

Query: 462 IQAVLSLYASGRTTGMCWTPATVS 533
            + V++LY+ G ++G+  + + +S
Sbjct: 121 SEPVVALYSVGLSSGIVLSSSYMS 144



 Score = 32.7 bits (71), Expect = 8.0
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 640
           VL S    S+   I++G+  P+ ++ L   GRD+T Y M ++ +
Sbjct: 137 VLSSSYMSSNVSTIHDGHRPPYGLVHLGFGGRDVTQYAMDLIKD 180


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +3

Query: 276 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 455
           G+V + +    + HH  +  L V PEEHP+++TE   N    R+ MT++ FE    PA+Y
Sbjct: 113 GVVNDPEPASALLHHILHERLGVNPEEHPIMITEPAWNTPKARQVMTEMAFEGEKMPALY 172

Query: 456 VAIQAVLSLYASGRTTGM 509
                VLS +A+G+ T +
Sbjct: 173 FGSSGVLSAFAAGKPTAL 190



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV+ALV+D GS   +AG+AG+D PR V PS  G
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYG 39


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 28/85 (32%), Positives = 47/85 (55%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YP+  G V ++D +EK+  +    E RV P+  P L        + +RE++ +++FE+
Sbjct: 72  LTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSPFLFLVPADQTRLDRERLCELLFES 131

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN P   +      +LY+SGRT G+
Sbjct: 132 FNIPLAGLLTNTAATLYSSGRTRGL 156



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +1

Query: 70  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKR 243
           + ++VVD G+   + GF+G++APR +  S VG P  R     +     D   GD A +  
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTRRPRPTLLQHPFDIATGDAAYNDG 67

Query: 244 GILTSNTP 267
           G+L+   P
Sbjct: 68  GLLSLTYP 75



 Score = 36.3 bits (80), Expect = 0.65
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +2

Query: 512 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           LDSG G +    + EGY L H++    LAG  LTD L   L   G
Sbjct: 158 LDSGAGRTCVAAVEEGYTLAHSVRSSSLAGEALTDELFAALRAGG 202


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 27/74 (36%), Positives = 44/74 (59%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE +N 
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFELYNA 144

Query: 444 PAMYVAIQAVLSLY 485
           P++   I  + S Y
Sbjct: 145 PSVAYGIDGLFSFY 158



 Score = 35.9 bits (79), Expect = 0.86
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 35/88 (39%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +3

Query: 249 PDLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIM 425
           P LKY ++  ++ N D  E+I   T     L     EHP+LLTE   + +  REK  +IM
Sbjct: 68  PCLKY-VDGDLILNGDVFEEIIRTTSGKIGLSTDLREHPILLTEPSKHNRQIREKEVEIM 126

Query: 426 FETFNTPAMYVAIQAVLSLYASGRTTGM 509
           FE F+ PA+Y A +A+LS ++ GR++G+
Sbjct: 127 FEKFDVPAVYTAKKAILSAFSVGRSSGL 154



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           ++V A++VD GS M K G+ G+D PR V+PS+VG
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG 44


>UniRef50_Q7T3J8 Cluster: Beta actin; n=2; Oncorhynchus|Rep: Beta
           actin - Oncorhynchus nerka (Sockeye salmon)
          Length = 70

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +1

Query: 538 HRTHLRGIRTPSRHPASGLGRSRPHRLPHEDPHRAR 645
           H THLRG+R+  RHPASG GR RPHRLP EDP  AR
Sbjct: 4   HCTHLRGLRSAPRHPASGSGRPRPHRLPDEDPDGAR 39


>UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 221

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 28/38 (73%), Positives = 31/38 (81%)
 Frame = +2

Query: 533 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           S T+PI EGYA PHA+LRLDLAGR L  +LM ILTERG
Sbjct: 3   SPTLPIDEGYASPHAVLRLDLAGRGLAHHLMTILTERG 40


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 435 FNTPAMYVA-IQAVLSLYASGR 497
           F   ++Y+A  Q+++ LY + R
Sbjct: 121 FGFSSLYIAHPQSLVHLYEASR 142



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/74 (31%), Positives = 40/74 (54%)
 Frame = +2

Query: 422 HVRNIQHARHVRRHPSRALAVRVRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 601
           H +++ H     R P   L+   ++    V+D G   +H VP+   + L HAI R+DL G
Sbjct: 130 HPQSLVHLYEASRQPDSILS---KTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGG 186

Query: 602 RDLTDYLMKILTER 643
           +  T+YL ++++ R
Sbjct: 187 KAFTNYLKELVSYR 200



 Score = 32.7 bits (71), Expect = 8.0
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 62  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 121

Query: 435 FNTPAMYVA-IQAVLSLYASGR 497
           F   ++Y+A  Q+++ LY + R
Sbjct: 122 FGFSSLYIAHPQSLVHLYEASR 143



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/74 (31%), Positives = 40/74 (54%)
 Frame = +2

Query: 422 HVRNIQHARHVRRHPSRALAVRVRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 601
           H +++ H     R P   L+   ++    V+D G   +H VP+   + L HAI R+DL G
Sbjct: 131 HPQSLVHLYEASRQPDSILS---KTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGG 187

Query: 602 RDLTDYLMKILTER 643
           +  T+YL ++++ R
Sbjct: 188 KAFTNYLKELVSYR 201


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/52 (46%), Positives = 39/52 (75%)
 Frame = +3

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           EHP+LLTE   N + +REK+T++ FET  +PA Y+A ++VLS +A+G+ + +
Sbjct: 181 EHPLLLTEPAWNSRESREKLTELAFETLGSPAFYLANRSVLSSFAAGKPSSL 232



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 23/86 (26%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           +L YP+ +  +T+  ++E      FY+ L + P    +L  E+    + +RE++ ++MFE
Sbjct: 68  NLSYPVRNRRITSMPEVEHFLQDVFYSRLPLVPSNTMMLWVESVRTSREDRERLCEMMFE 127

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
           +F  P + +   +  +++++GRTTG+
Sbjct: 128 SFGLPQLGLVAASATTVFSTGRTTGL 153



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 2/70 (2%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVGDEAQS 237
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q   D Y GD A +
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQHYSDDYAGDAACA 62

Query: 238 KRGILTSNTP 267
           + G+L  + P
Sbjct: 63  QEGMLNLSYP 72



 Score = 41.9 bits (94), Expect = 0.013
 Identities = 20/46 (43%), Positives = 30/46 (65%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG+G ++   ++EGY L +A    D+AGR LTD L+  L  +G
Sbjct: 154 VVDSGEGCTNFNAVWEGYNLQYATHTSDVAGRVLTDRLLAFLRAKG 199


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 24/86 (27%), Positives = 49/86 (56%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++K    +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ +  FE
Sbjct: 67  EVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIMEAAFE 126

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
             + PA Y+  QAV   +A+ ++T +
Sbjct: 127 QLHVPAFYLTKQAVCVAFANSKSTAL 152



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQ 58


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/53 (47%), Positives = 39/53 (73%)
 Frame = +3

Query: 351 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           EEHP+LLTE  ++    RE+MT+I+FE +N PA+Y A +A L+ ++ GR+T +
Sbjct: 146 EEHPILLTEFNMHNHKIREQMTEILFEKYNIPALYFAKKAKLTSFSLGRSTSL 198


>UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 876

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 28/86 (32%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMFE 431
           L +P++    T+WD +  I  + + NEL    P  HPV++TE P   +   +K+  +MF 
Sbjct: 573 LVWPLDPRKDTDWDGLLAIIQNIYENELDGCDPASHPVVMTELPNMNEVATDKIKSMMFN 632

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
             N P + +   A+++LYA G+ TG+
Sbjct: 633 DLNVPFLKIVNPALMALYAEGKETGV 658


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 428
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 429 ETFNTPAMYVAIQAVLS 479
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155


>UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3
           actin-related protein 3 homolog B; n=1; Homo
           sapiens|Rep: PREDICTED: similar to ARP3 actin-related
           protein 3 homolog B - Homo sapiens
          Length = 406

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 25/42 (59%), Positives = 32/42 (76%)
 Frame = +3

Query: 366 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS 491
           L TE PLN   NRE + +IMFE+FN P +Y+A+QAVL+L AS
Sbjct: 257 LQTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAAS 298



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 21/45 (46%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L ER
Sbjct: 313 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRER 357


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 28/92 (30%), Positives = 48/92 (52%)
 Frame = +3

Query: 273 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 452
           +G+V NW+  E +  H +   ++ A E+  V+  E        RE++ +++FET   PA+
Sbjct: 81  NGLVANWEAYEGLLAHAYSTGVQAASEDFAVMYAEPTHACIRQRERIGELLFETHGAPAL 140

Query: 453 YVAIQAVLSLYASGRTTGMCWTPATVSPTPYP 548
            V+   VL+ YA+GR TG+       + T  P
Sbjct: 141 AVSPAVVLAAYANGRHTGVVLDVGDATTTAAP 172



 Score = 39.9 bits (89), Expect = 0.053
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG---RPRHQGVMVGMGQKDSYVGDEA 231
           D  V ++V D GS  CK GFAG+D P +++ S +G    P      V   ++   VGD+A
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIGAFPSPVVANGGVQPAKRGIIVGDQA 64

Query: 232 QSKRGILTSNTPSNTESSLTGMTWRRF-GIIPSTMSS 339
            + R    + TP+   + L    W  + G++    S+
Sbjct: 65  LAIRRDDMNVTPAFDANGLVA-NWEAYEGLLAHAYST 100


>UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 440

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           +E+G++ +W+  E++        +L       P+L+TE  L P   R+K+ +++FET   
Sbjct: 82  LENGVIVDWEGYEELLSRVARILDLENVENSTPLLVTEKALVPTHQRQKIAEVLFETHRV 141

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
            A   A+  VLSLYASG  TG+
Sbjct: 142 VATSFALSPVLSLYASGLGTGV 163



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +2

Query: 512 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILT 637
           ++ G   SH  P+++G +L HA   LD+ G DLT +   +++
Sbjct: 165 VELGHDQSHVAPVFQGLSLFHATHCLDVGGADLTRHFTSLMS 206


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 3/78 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIM 425
           LK P E  I+TNW+  E+I+ + F  ++    E+   +P++LTEA  NP   R+ M++++
Sbjct: 82  LKSPFERNIITNWNHQEQIFDYIF-TKMGFEGEQSIANPIVLTEALANPNFCRQNMSELL 140

Query: 426 FETFNTPAMYVAIQAVLS 479
           FE +  PA+   I A+ S
Sbjct: 141 FECYGIPAVSYGIDALYS 158


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/86 (29%), Positives = 43/86 (50%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           D  YPI  G++++ DD+E I    F   + V     P+++TE  L P   +++  ++ FE
Sbjct: 54  DYHYPINRGMISDCDDIEGILRFVFDENMGVDASTRPIIVTEEALCPNLRKQEYGELFFE 113

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            F TP +Y  +    +L      TG+
Sbjct: 114 KFETPGLYFELTGNCALIPLDLETGL 139


>UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep:
           Actin, putative - Plasmodium berghei
          Length = 505

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/75 (37%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +3

Query: 288 NWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAI 464
           N++ MEK++     ++ L V  ++HP+LLTE        REK T++MFE++N   M+++ 
Sbjct: 82  NFEAMEKLFEDISGSKALDVNFQDHPILLTEPNKIDSRYREKFTELMFESYNVYQMFLSK 141

Query: 465 QAVLSLYASGRTTGM 509
           ++VLS Y   RT+G+
Sbjct: 142 RSVLSCYGCARTSGL 156


>UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep:
           Actin, putative - Plasmodium vivax
          Length = 493

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/58 (43%), Positives = 40/58 (68%)
 Frame = +3

Query: 336 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           L +  EEHP+LL+E  ++    R +MT+I+FETFN PA+Y A +A L+ ++ GR+  +
Sbjct: 134 LNLKIEEHPILLSEENIHNHRVRAEMTEILFETFNIPAVYFAKKAKLTAFSLGRSNAL 191


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++ P +  +VT+WD ME +  +TF N  +     +HP+ +TE   NP  +R  M ++MFE
Sbjct: 489 IRSPFDTDVVTSWDAMEIVLDYTFSNLGIDTDRVQHPICMTETLCNPAYSRGIMNELMFE 548

Query: 432 TFNTPAMYVAIQAVLSLY 485
            +  P++   I  + S Y
Sbjct: 549 AYQVPSVNYGIDCLFSAY 566


>UniRef50_P53946 Cluster: Actin-related protein 5; n=7;
           Saccharomycetales|Rep: Actin-related protein 5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 755

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 6/88 (6%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIMFET 434
           P +   VTNW+  E+I  +TF++ L V P+    +P+LLTE     ++ R    QI+FET
Sbjct: 99  PFDGPFVTNWNLTEEILDYTFHH-LGVVPDNGIPNPILLTERLATVQSQRTNWYQILFET 157

Query: 435 FNTPAMYVAIQAVLSLY---ASGRTTGM 509
           +N P +   I ++ S Y    SG  TG+
Sbjct: 158 YNVPGVTFGIDSLFSFYNYNPSGNKTGL 185


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 23/79 (29%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           P++ G + +WD + K+W +    +L+V    E+P+++TE   N  A R K+ ++ F+ F 
Sbjct: 81  PVQDGCIQDWDGVAKLWEYAIKEKLKVDDLSEYPLVITEQMWNSSARRAKIAEMCFDKFR 140

Query: 441 TPAMYVAIQAVLSLYASGR 497
           +PA+      + + YA+ R
Sbjct: 141 SPAISFVKNPLCTAYAAVR 159



 Score = 38.3 bits (85), Expect = 0.16
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 168
           +EV ++V++ GS   + GF+GDD P+ V P+  G+
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGK 52


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 2/70 (2%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           ++ D+G+G  K GFAGD+ P   FP++VGRP  R    +     KD  +GDEAQ  RG+L
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRPTLRADEQLDDANLKDIMIGDEAQPYRGLL 64

Query: 253 TSNTPSNTES 282
               P    S
Sbjct: 65  ELTHPLERRS 74


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 3/89 (3%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQI 422
           D+   +E+G++ N+D +   W + + N      +  +E P++LTE P N   N+   TQI
Sbjct: 57  DIMTFMENGLIYNFDSIVHNWQYVYDNIDNNNAINAKEFPLMLTEQPWNTSKNKLATTQI 116

Query: 423 MFETFNTPAMYVAIQAVLSLYASGRTTGM 509
            FET   P   +    +  LY  GR+TG+
Sbjct: 117 AFETLEVPIFSLVKTPLSQLYHMGRSTGL 145



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 22/45 (48%), Positives = 25/45 (55%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 210
           A+V+DNGS   KAGFA DD P  VF S      +  V VG  Q D
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVGDKQVD 51


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 22/74 (29%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           P+E G +TNW   ++IW + F  +++++ P+++ +LLTEAP +    R+ M ++++E + 
Sbjct: 87  PMEKGYITNWGLEKEIWDYAFKRDDMKIKPQDYNLLLTEAPNSLDDLRKTMYEVVYEQYK 146

Query: 441 TPAMYVAIQAVLSL 482
             ++Y+   + L L
Sbjct: 147 FKSLYLTTSSTLGL 160


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 22/44 (50%), Positives = 31/44 (70%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 386
           L  PI +GIVT+ D +  +W++ F  ELR +PE HPVL++E PL
Sbjct: 63  LNCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHPVLISEYPL 106



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/63 (41%), Positives = 36/63 (57%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +VVDNG+G  KAG+AGD  PR + P ++GRP+           D +VG+ A + R  L  
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPKKCSKYT-----DWFVGEHANAIRNELIL 63

Query: 259 NTP 267
           N P
Sbjct: 64  NCP 66


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 3/80 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 425
           LK   +  +VT++D  E+I  H F   L +  E   +HP+++TE P NP   R+ M++++
Sbjct: 147 LKTQFDRDVVTHYDAQEQILDHAF-QRLGIDSEGAVKHPIVMTETPCNPNLCRQTMSELL 205

Query: 426 FETFNTPAMYVAIQAVLSLY 485
           FE +  P +   I ++ S Y
Sbjct: 206 FECYQIPNLAYGIDSLFSHY 225



 Score = 35.9 bits (79), Expect = 0.86
 Identities = 17/42 (40%), Positives = 24/42 (57%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           VL SG   SH +P+  G   P    RL++ G  LT YL+++L
Sbjct: 238 VLSSGFQTSHILPVINGQLDPAHCRRLNIGGTHLTGYLLRLL 279



 Score = 33.1 bits (72), Expect = 6.1
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           +++DNGS   + G+A +  PR  F +I+ R R
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQR 124


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/91 (34%), Positives = 47/91 (51%), Gaps = 1/91 (1%)
 Frame = +3

Query: 228 GTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANR 404
           G  +K Y +LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR
Sbjct: 63  GIPRKDY-ELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENR 121

Query: 405 EKMTQIMFETFNTPAMYVAIQAVLSLYASGR 497
           +K  +++ E     A Y+A  +    +A+GR
Sbjct: 122 KKSLEVLLEGMQFEACYLAPTSTCVSFAAGR 152



 Score = 38.3 bits (85), Expect = 0.16
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 168
           +EV+A+V+D GS     G++G D P+++ PS+ G+
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK 46


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMFE 431
           LK P    +V N D  E++  H F ++L V  P  +PV++ EA  NP   R ++T+++FE
Sbjct: 91  LKSPFIDNLVINLDVQEQVISHIF-DKLNVQKPLSNPVVINEALCNPGVCRSQLTELLFE 149

Query: 432 TFNTPAMYVAIQAVLSLY 485
           +FNTP +   +    S Y
Sbjct: 150 SFNTPKLMYYVDCFASYY 167



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKD 210
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQD 83


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 28/63 (44%), Positives = 36/63 (57%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDSY+G + Q +  + T 
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDSYMGGKIQGRLSVQTP 62

Query: 259 NTP 267
             P
Sbjct: 63  EYP 65


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 1/104 (0%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 441 TPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYPSTRDTHSL 572
            PA+   + A  S Y   +  G+C     V     P    THS+
Sbjct: 145 VPAVAFGVDAAFS-YKYNQLHGICKKDGIVL---CPGFTTTHSI 184



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 225
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -3

Query: 158 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 60
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena
           thermophila|Rep: Actin family protein - Tetrahymena
           thermophila SB210
          Length = 426

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/93 (26%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREK 410
           E+K   + K+PI++G + ++D +  ++ +     L+V       +L+ ++PLNPK  + K
Sbjct: 107 EKKFELEEKFPIQNGKIVDFDAIRDLYTYALEKLLQVNEISSCNLLIIDSPLNPKNYKHK 166

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           + +I+F+     ++     + LSL+++G TTG+
Sbjct: 167 LAEILFDDMKVNSVLFQNSSSLSLFSTGETTGL 199



 Score = 40.3 bits (90), Expect = 0.040
 Identities = 16/42 (38%), Positives = 29/42 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           V++SG  ++  +P++EG+A+PHA     LAG+ +T+ L + L
Sbjct: 200 VVESGHSLTTCIPVFEGFAIPHAFQHSYLAGQKMTEILKEEL 241


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 237
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH   +      D  +G+ A S
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH-AKLGPSNSNDPLIGESALS 59



 Score = 39.1 bits (87), Expect = 0.093
 Identities = 23/85 (27%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +K PI    + + +D   I ++ F   L +  E + +L++          E +T+   ET
Sbjct: 65  VKRPIVRSEIQSPEDFYSIVNYIFQT-LEIKGENNHILISRPSGASTQQLELITEYFIET 123

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+ P++     A LSL ++GR TG+
Sbjct: 124 FHVPSIAFISSAALSLLSTGRATGV 148



 Score = 36.3 bits (80), Expect = 0.65
 Identities = 16/46 (34%), Positives = 28/46 (60%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V + G  +++ VPI+E + L HA +  +L G+D+  YL  +L + G
Sbjct: 149 VAECGYSITNVVPIFEFFGLEHARITANLGGQDVDLYLKSLLKKIG 194


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMF 428
           ++K  +E+  + +WD  ++ W +    +L+    +  PVLLTE   N +A+R+K  +I+ 
Sbjct: 70  EIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSLEILL 129

Query: 429 ETFNTPAMYVAIQAVLSLYASGRTT 503
           E+    A Y+A  +    +A GR T
Sbjct: 130 ESMEFEACYLAANSSAVSFAMGRPT 154



 Score = 36.3 bits (80), Expect = 0.65
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 183
           +E+ A+V+D GS +   G++G D P+++ PS  G     G
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG 51


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/66 (40%), Positives = 37/66 (56%)
 Frame = +1

Query: 82  VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSN 261
           ++D GS   K+GF     P  V P++VG+  HQ    G  +++ YVGDEA  KRGIL+  
Sbjct: 425 IIDIGSCSIKSGFESVGTPSIVTPTVVGKNLHQ--TSGFVEQNLYVGDEAIDKRGILSLE 482

Query: 262 TPSNTE 279
            P   E
Sbjct: 483 YPMQKE 488


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 5/79 (6%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLTEAPLNPKANREKMTQIMF 428
           P+E G + NW+  + IW H F         R  P+E  +LLTE P  PK  ++   +I+F
Sbjct: 80  PVEKGFIVNWEAEKAIWEHEFMEAAVVEGFRCDPKETNLLLTEKPNCPKELQKNCDEIVF 139

Query: 429 ETFNTPAMYVAIQAVLSLY 485
           E F   + Y  +   L+ Y
Sbjct: 140 EQFEFASYYRCVGPRLNAY 158


>UniRef50_Q12406 Cluster: Actin-related protein 7; n=2;
           Saccharomyces cerevisiae|Rep: Actin-related protein 7 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 477

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 5/94 (5%)
 Frame = +3

Query: 237 QKRYPDLKYPI--EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK---AN 401
           +KR  D  Y +    G+  NWD +E  W + +  +L+V+PEE P+++T    N K   A 
Sbjct: 60  EKRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAI 119

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTT 503
            E+  ++ F+  N P   + I+ +    + G+++
Sbjct: 120 LERYYELAFDKLNVPVFQIVIEPLAIALSMGKSS 153


>UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19;
           Euteleostomi|Rep: Actin-related protein 5 - Homo sapiens
           (Human)
          Length = 607

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 425
           L+ P +  +  N +  E +  ++F + L V+ +   +HP++LTEA  NP  +R+ M++++
Sbjct: 94  LRSPFDRNVPVNLELQELLLDYSFQH-LGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELL 152

Query: 426 FETFNTPAMYVAIQAVLSLYASGRTTGMC 512
           FE +  P +   I ++ S Y +     MC
Sbjct: 153 FECYGIPKVAYGIDSLFSFYHNKPKNSMC 181


>UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit
           (Arp9), putative; n=20; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp9), putative -
           Aspergillus clavatus
          Length = 693

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/81 (33%), Positives = 41/81 (50%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           YPIE+G + +W     +  H  +N L   P   P++L   P+    +RE +TQ +FE F 
Sbjct: 146 YPIENGRIVDWPCFFALLTHV-HNTLS-PPFHTPIMLISEPVWSARDREAITQFVFEKFK 203

Query: 441 TPAMYVAIQAVLSLYASGRTT 503
           TPA  +   A+   Y  G +T
Sbjct: 204 TPAFCLMDSALAICYGYGTST 224


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +3

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E+P+L+TEAP N    REK  +I  ET+  PA +++   VL+ +A+G+ T +
Sbjct: 145 ENPLLMTEAPWNSPKAREKAIEISMETWGVPAFWLSKTPVLAAFAAGKATAL 196



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV+ALV+D G    +AG+AG++ P+ V PS  G
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYG 53


>UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces
           cerevisiae YNL059c ARP5Actin- related protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P53946
           Saccharomyces cerevisiae YNL059c ARP5Actin- related
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 724

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/85 (27%), Positives = 48/85 (56%), Gaps = 3/85 (3%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIMFET 434
           P +  +V+NW   E++  +TF  +LRV  +   ++ +++ E   +P A R  + Q++FE 
Sbjct: 88  PYDGALVSNWTVAEEVLDYTFA-KLRVGSDGCVDNHIIMNELMSSPAAQRRNLQQVLFEG 146

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           +   ++ + + A+ S YA+   TG+
Sbjct: 147 YGVRSVALGVDALFSYYANDGKTGL 171


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)
 Frame = +3

Query: 231 TEQKRYPDL--KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 404
           T+ K Y  L  K P E G + NWD  + +W + FYN       +  +LLT+ PL      
Sbjct: 39  TKCKDYASLVFKRPSEKGQLINWDIQKAVWDNLFYNPQTGVDTDSSLLLTQYPLTLPQVS 98

Query: 405 EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMC 512
             + Q++FE +     +    A L  ++SG+    C
Sbjct: 99  ANIDQVVFEEYGFEQYHRTEAANLVAWSSGQCLDAC 134


>UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -
           Trypanosoma cruzi strain CL Brener
          Length = 422

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 38/111 (34%), Positives = 61/111 (54%), Gaps = 9/111 (8%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTFYNEL-RVAPEE--HPVLLTEAPLNPKANREKMTQIMFETF 437
           IE G V +W+ ME++   ++ +EL +++ +E   P+LLTE  L P+  R+K+ +I+ E  
Sbjct: 84  IEKGEV-DWEAMEQLL--SYLDELLQLSSKEVQTPLLLTEKMLVPRTQRQKLAEILMEKH 140

Query: 438 NTPAMYVAIQAVLSLYASGRTTG----MCWTPATVSPT--PYPSTRDTHSL 572
              A++ A   VL+LYA+G  +G    M +    V P    YP    TH L
Sbjct: 141 GVTAVHFAQSPVLALYAAGICSGTSVEMGYNACHVVPVFQGYPLFHATHML 191


>UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza
           sativa|Rep: Os08g0128300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 257

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           V+D GDG  H VP+  GY +  +I     +G D+T +++++L ERG    P
Sbjct: 8   VVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAP 58


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +3

Query: 276 GIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           GIV++WD +E +  H F        E   + P+++TEA  N   +R+ M++++FE +N P
Sbjct: 121 GIVSSWDVVEHVLDHVFIKLGMNGVEGGIDMPIVMTEAVANLPYSRKTMSEMLFECYNAP 180

Query: 447 AMYVAIQAVLSLYASGRTTGM 509
           ++   I ++ S   +   TG+
Sbjct: 181 SVVYGIDSLFSYRHNRGKTGL 201



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGDEAQ 234
           A +V+DNGS   +AG++ +D PR   P I+   R R  G       +D Y    A+
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYRDRKAGKTFSFAGQDCYADTTAR 109


>UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related protein;
           n=5; Saccharomycetales|Rep: Vacuolar targeting,
           actin-related protein - Pichia stipitis (Yeast)
          Length = 775

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 425
           +K P +  +VTNWD ME +  ++  +   V       +P++LTE    P + R+ M +I+
Sbjct: 99  IKTPFDGPLVTNWDYMEVLLDYSLAHLGVVGDNGRLNNPLILTEPVGVPFSQRKNMYEIL 158

Query: 426 FETFNTPAMYVAIQAVLSLYASGRTT 503
           FE +  P +   I ++ S YA+  ++
Sbjct: 159 FEAYQAPKVTFGIDSLFSFYANSTSS 184


>UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 400

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/79 (27%), Positives = 38/79 (48%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           +  G+V NW+             +++ P E P+ L E  L+ K  R+K  + +FE+ N  
Sbjct: 79  LSQGMVNNWEQASNFIEQINKKLMQINPSETPLFLIEQALSTKDVRQKCVEAVFESMNFA 138

Query: 447 AMYVAIQAVLSLYASGRTT 503
           A+++    VLS Y   + T
Sbjct: 139 ALFIHKAPVLSSYVLAKET 157



 Score = 33.9 bits (74), Expect = 3.5
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 622
           ++DSG   ++ VPI EGY     ++R D+AG  LT  L
Sbjct: 160 LVDSGAYSTYVVPIVEGYVNQKGVIRSDIAGEYLTKSL 197


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 425
           L+   +  +VT+    E+I+ + F   L +  +    HPVLLTE   NP  +R  M+++M
Sbjct: 93  LRTQFDRNVVTHLHVQEQIFDYLF-GRLGINADGCVPHPVLLTECVANPNYSRMLMSELM 151

Query: 426 FETFNTPAMYVAIQAVLSLYASG 494
           FE +  P +  A+  +LS   +G
Sbjct: 152 FECYGIPGIVYAVDGLLSYRMNG 174



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPR 61


>UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 382

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 22/46 (47%), Positives = 29/46 (63%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+D GDG+   VP+ EG+    AI R+D  G +LT YL K+L E G
Sbjct: 148 VVDIGDGMIQVVPMEEGHLEKKAIRRIDFGGLELTMYLQKLLCELG 193



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/81 (27%), Positives = 43/81 (53%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           ++HG + ++D    +W + F + + V P+   VL+ E  L    +  K  +I+ E     
Sbjct: 68  VDHGHIFDYDIAAGLWKYAF-DTMDVEPKGASVLMIEPVLCSAEHHRKTGEILLEGMGVE 126

Query: 447 AMYVAIQAVLSLYASGRTTGM 509
            ++ ++  VLSLY  G+++GM
Sbjct: 127 EIHTSMSGVLSLYGVGKSSGM 147


>UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 731

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 437
           YPI +G +  W     +  H F     ++P  H P++    P+    +RE +TQ +FE F
Sbjct: 163 YPIRNGEIVEWSCFFALLSHIFKT---LSPPFHTPIMFIAQPVWTARDREAITQFVFEKF 219

Query: 438 NTPAMYVAIQAVLSLYASG 494
            TPA  +   A+ + YA G
Sbjct: 220 QTPAFCLMDSALAACYAYG 238


>UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein; n=1; Candida
           glabrata|Rep: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 529

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/87 (26%), Positives = 48/87 (55%), Gaps = 7/87 (8%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM-------F 428
           +HGI  NW  +E+++ + +  EL+V P E P+++T   L    NRE  T+I+       F
Sbjct: 87  DHGIPYNWKALERLYRYIYEKELKVDPSELPLVIT---LPSMTNRELETKIVENYMELAF 143

Query: 429 ETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E    P + + ++ +  + ++G+++ +
Sbjct: 144 EKLKVPVLQIVVEPLGIMLSTGKSSSL 170


>UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 544

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 2/80 (2%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV-LLTEAPLN-PKANREKMTQIMFET 434
           +P+  G V +W  M  +W++  ++ L +    +   +L   PL   +A    +TQI FE 
Sbjct: 80  WPMRKGYVRDWQQMIALWNYVLFHLLPIRRSHNDSNILISLPLPVSRATHAYLTQIFFEH 139

Query: 435 FNTPAMYVAIQAVLSLYASG 494
           FN+ A+ +A + +LS Y  G
Sbjct: 140 FNSAAITIAEKPLLSCYGVG 159


>UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative,
           expressed; n=5; Oryza sativa|Rep: Actin-related protein
           7, putative, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 398

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/38 (55%), Positives = 27/38 (71%)
 Frame = +3

Query: 393 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG 506
           +A RE++ Q+MFE FN    Y + QAVLSLYA GR +G
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQAVLSLYAVGRISG 193


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/84 (26%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIM 425
           L+   +  +VT+++  E+I+ + F  +L +  E    H V++TE   NP   R  M++++
Sbjct: 60  LRTQFDRNVVTHYNVQEQIFDYIF-TKLGINSENSVPHKVMITECLFNPNYCRSLMSELL 118

Query: 426 FETFNTPAMYVAIQAVLSLYASGR 497
           FE ++ P +   + ++LS +++ R
Sbjct: 119 FECYDIPGLSYGVDSLLSFHSNQR 142



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           +V+DNGS  C+AG+   + P  VF +I+ +PR
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPR 36


>UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Sclerotinia sclerotiorum 1980
          Length = 669

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 437
           +P+  G + N        HH  +N+L  +P  H PV+L   P     N E +TQ +FE F
Sbjct: 97  WPLREGRIENLPAFCAFLHHV-HNQL--SPTLHTPVMLIAQPSWTAKNHEDLTQFIFEKF 153

Query: 438 NTPAMYVAIQAVLSLYASG 494
            TPA+ +   A+ + YA G
Sbjct: 154 RTPALCIMDSALATSYAFG 172


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/52 (38%), Positives = 31/52 (59%)
 Frame = +3

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           + P+L+TE   NP   REK  +I  E + TPA Y+A    L+ +ASG+ + +
Sbjct: 139 DSPLLMTECGWNPVKAREKTIEIAMEKWGTPAFYLARNGPLAAFASGKASAL 190



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 168
           +EV+A+++D G    +AGFAG+D P++V P+  G+
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK 49


>UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 445

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = +3

Query: 336 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           L +A  E+P+L+TE+P N    REK  ++  E +  PA ++    VL+ +A+G+ T +
Sbjct: 95  LELALGENPLLMTESPWNTPKAREKAIELAMEGWGVPAFWLTKTPVLAAFAAGKATAL 152


>UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n=1;
           Schizosaccharomyces pombe|Rep: SWI/SNF and RSC complex
           subunit Arp9 - Schizosaccharomyces pombe (Fission yeast)
          Length = 523

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +3

Query: 249 PDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMT 416
           P+   PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  T
Sbjct: 108 PNEIQPIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELAT 166

Query: 417 QIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           Q  FE    P   +A + ++ LYA G   G+
Sbjct: 167 QFFFEECQVPGFTIAYEPLMGLYAIGILHGL 197


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNE---LRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           P+E G + NW+  ++IW   F+++    +  P +  ++LTE P +  + +    QI+FE 
Sbjct: 80  PVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILTEQPNSLPSLQTHCDQIVFEE 139

Query: 435 FNTPAMYVAIQAVLSLY 485
           +   + Y  +  V + Y
Sbjct: 140 YGFASYYRGLGPVFNAY 156



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 18/45 (40%), Positives = 29/45 (64%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           ++DSG   +   PI +G  L  AI RLD+ G+ +T+YL ++L+ R
Sbjct: 179 LIDSGYSHTTVTPILQGRPLHPAIRRLDVGGKLMTNYLTRLLSVR 223



 Score = 36.3 bits (80), Expect = 0.65
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDD----APRAVFPSIVGRPRHQGVMVG 195
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ + VG
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKIYVG 63


>UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n=6;
           Euteleostomi|Rep: ARP5 actin-related protein 5 homolog -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 592

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 3/80 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 425
           LK   +   V N+D  E ++ + F + L +  +   EHP+++TE   NP   R+ M++++
Sbjct: 93  LKSAFDRDTVVNFDIQELVFDYIFMH-LGINTQGRVEHPLVVTEPACNPLQCRQMMSELL 151

Query: 426 FETFNTPAMYVAIQAVLSLY 485
           FE +  P +   + ++ SL+
Sbjct: 152 FECYGVPRVAYGVDSLFSLH 171


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDD 132
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/77 (27%), Positives = 41/77 (53%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +K P +  ++ +    E I+ + F+        E+PVL+TE   NP   R+ M++++FE 
Sbjct: 85  IKSPFDSNLLVHPPSQESIFDYIFHKFGIENEIENPVLITEPTSNPTFCRKYMSELLFEC 144

Query: 435 FNTPAMYVAIQAVLSLY 485
           +N  ++   I ++ S Y
Sbjct: 145 YNIKSVVYGIDSLFSFY 161



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 168
           +++DNGS  C+AGFA D +P+ +F S+VG+
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGK 62


>UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|Rep:
           Actin6-2 - Paramecium tetraurelia
          Length = 394

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/93 (22%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREK 410
           E+K    L  PI+ G + N + M++ W +   + L+++  ++  +L+ +   N K  + K
Sbjct: 68  EKKLNVQLSNPIKDGKIDNVESMKEFWQYILEDGLQISELQQVNLLIIDQVKNSKEYKSK 127

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           + ++ F+     ++     A LSL+++G  +G+
Sbjct: 128 LAEVFFDYLKVQSVLFMNSASLSLFSTGLVSGL 160


>UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 405

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 19/52 (36%), Positives = 32/52 (61%)
 Frame = +3

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +HP+++TE     K  R+   +I+FE  + PA Y+A +A LS ++ GR + M
Sbjct: 126 QHPMMVTEPTAECKQFRDCTLEILFEQLDVPAAYLAKRATLSAFSVGRQSAM 177


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSG   +   P+Y G  L  AI RLD+ G+ LT+YL ++++ R
Sbjct: 199 VVDSGYSHTTVTPLYRGQPLQRAIRRLDIGGKHLTNYLKEMVSMR 243



 Score = 38.3 bits (85), Expect = 0.16
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 8/48 (16%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEAP 383
           P+E G + NW+  ++IW  +F++E       LR+  PE+  ++LTEAP
Sbjct: 91  PVEKGYIVNWEAQKEIWETSFFDEKTVRSKDLRIENPEDTTLVLTEAP 138


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Frame = +2

Query: 509 VLDSGDGVSHTV--PIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSG   SHTV  P+Y G  L   I RLDL G+ LT+YL ++++ R
Sbjct: 210 VVDSG--YSHTVITPVYRGRPLQRGIRRLDLGGKHLTNYLKELVSMR 254



 Score = 39.1 bits (87), Expect = 0.093
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 8/64 (12%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYN-------ELRVA-PEEHPVLLTEAPLNPKANREKMTQ 419
           P+E G   NW+  ++IW ++F++       EL +A PE+  ++ TEAP    A ++   +
Sbjct: 91  PVEKGYTVNWEAQKEIWENSFFDERTVRSKELHIADPEDVTIIFTEAPNALPALQKNADE 150

Query: 420 IMFE 431
           I+ E
Sbjct: 151 IIME 154


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +1

Query: 70  VAALVVDNGSGMCKAGFAGD 129
           VAALVVDNGSGM KAGFAGD
Sbjct: 1   VAALVVDNGSGMXKAGFAGD 20



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +3

Query: 324 FYNELRVAPEEHPVLLTEAPL 386
           F  +LRVAPEEHPVLLTEAPL
Sbjct: 17  FAGDLRVAPEEHPVLLTEAPL 37



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = +2

Query: 557 GYALPHAILRLDLAGRDL 610
           GYALPHAILRLDLAGRDL
Sbjct: 38  GYALPHAILRLDLAGRDL 55


>UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 645

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 25/78 (32%), Positives = 36/78 (46%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           +PI+ G + +W     +  H  YN L   P    +LL   P       EK+TQ  FE F 
Sbjct: 101 WPIQDGRIVDWPCFYALLTHV-YNTLN-PPFHTAILLIAQPAWTPREHEKLTQFFFEKFK 158

Query: 441 TPAMYVAIQAVLSLYASG 494
           TPA  +   A+ + +A G
Sbjct: 159 TPAFGLMDAALATTWAYG 176


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 5/95 (5%)
 Frame = +3

Query: 228 GTEQKRYPDLKYPIE----HGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNP 392
           G +   YP   Y I+    +G V +WD  ++ W     N L +      P  LTE   N 
Sbjct: 75  GEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPIWNT 134

Query: 393 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGR 497
             NR+K  +++ E     A Y++       +ASGR
Sbjct: 135 VENRKKSLEVLLEGLQFEACYLSPTPTCISFASGR 169



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +E++A+V+D GS     G++G D P+A+ PS  G
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYG 45


>UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 488

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 7/85 (8%)
 Frame = +3

Query: 276 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR-------EKMTQIMFET 434
           G+  NW+ +EK W + F  +L+  P E PVL+T  P +   N        E+  +I FE 
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTELPVLIT-IPSSISKNEDIENKVIEQYCKIAFEK 131

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  P + +  +++      G+ T +
Sbjct: 132 FKIPYLQIVNESLSISLGLGKKTSL 156


>UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria annulata
          Length = 468

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 17/53 (32%), Positives = 34/53 (64%)
 Frame = +3

Query: 351 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           ++ PV+++E  L+    R+  T+++FETF    +++  ++ LS YAS  T+G+
Sbjct: 110 QDTPVIVSEPSLHNPKFRQNFTELLFETFKVENVFLCKRSALSCYASACTSGV 162


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 19/78 (24%), Positives = 38/78 (48%)
 Frame = +3

Query: 276 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 455
           G+ T+W+ +E+     +  +LRV PEE PV +T  P      R +  +++      P + 
Sbjct: 65  GVPTDWEMLERFCRWIYATQLRVGPEELPVCITVPPDLSATVRSQFHELVLCKLRAPVLQ 124

Query: 456 VAIQAVLSLYASGRTTGM 509
           +  + +    + GR+T +
Sbjct: 125 LISEPLAVTLSLGRSTAL 142


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           P E G++ NWD    IW   F  + L + P E  +L+TE   N     E   Q++FE F 
Sbjct: 63  PFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEPYFNLPNIAETYDQMIFEEFE 122

Query: 441 TPAMYVAIQAVLSLY 485
             + +    A L  Y
Sbjct: 123 FQSYFRCAPAALIPY 137



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+D G   +H VPI +G  +   + R+D+ G+ LT++L  +++ R
Sbjct: 154 VIDMGYSYTHVVPIRDGQIVWEHVKRIDVGGKLLTNHLKHLISFR 198


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 40.3 bits (90), Expect = 0.040
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 5/115 (4%)
 Frame = +3

Query: 255 LKYPIEHG--IVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQ 419
           L+Y  + G  +V NWD ME +  + F     +      + P+++TE   N    R  M +
Sbjct: 117 LRYAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEPIANLNYPRRMMNE 176

Query: 420 IMFETFNTPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYPSTRDTHSLTPSC 584
           I+FE ++ P++   I ++ S   +  T G+  + +  S    P   ++ +L  +C
Sbjct: 177 ILFECYSAPSVAYGIDSLFSYRYNKGTDGLIISSSHTSTHVIP-VLNSKALLSNC 230



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 195
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKG 99


>UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related
           protein, putative; n=1; Filobasidiella neoformans|Rep:
           Protein-vacuolar targeting-related protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 724

 Score = 39.9 bits (89), Expect = 0.053
 Identities = 13/52 (25%), Positives = 31/52 (59%)
 Frame = +3

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +HP+++TE   NP  +R   ++++FE +N P++   + ++ +    G+  G+
Sbjct: 123 QHPIVMTERLANPLFSRAMTSELLFELYNAPSVAFGVDSLFAFSRQGKKDGL 174


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 39.9 bits (89), Expect = 0.053
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 3/80 (3%)
 Frame = +3

Query: 279 IVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 449
           ++ NWD ME +  + F     +      + P++LTE   N    R  M +I+FE ++ PA
Sbjct: 179 VIGNWDVMEGVLDYIFLKLGVDGANGSVDRPIVLTEPIANLGYTRRMMNEILFECYSAPA 238

Query: 450 MYVAIQAVLSLYASGRTTGM 509
           +   I ++ S   +  T G+
Sbjct: 239 VAYGIDSLFSYRYNRGTDGL 258



 Score = 36.7 bits (81), Expect = 0.49
 Identities = 14/34 (41%), Positives = 25/34 (73%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           +A+V+DNGS + KAG++ D +PR + P ++ + R
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYR 144


>UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26;
           Chordata|Rep: Actin-related protein 6 - Homo sapiens
           (Human)
          Length = 396

 Score = 39.9 bits (89), Expect = 0.053
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           P + G + NWD   ++W + F  E+ +V   +  +++TE   N  + +E M +I+FE + 
Sbjct: 59  PFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQ 118

Query: 441 TPAMYVAIQAVLSLY 485
             A+       LS +
Sbjct: 119 FQAVLRVNAGALSAH 133


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 39.9 bits (89), Expect = 0.053
 Identities = 17/77 (22%), Positives = 40/77 (51%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           ++  ++ +W+   + +H+ F + L +  +E P+L+TE        R+ + +  +E F+ P
Sbjct: 88  LKDSVIIDWEAAIEQYHYYFDDVLTLNYKEQPILITEPVWCTPQYRQTLLETFYENFDFP 147

Query: 447 AMYVAIQAVLSLYASGR 497
           A+++A       +  GR
Sbjct: 148 ALFLAKSPTCISFQQGR 164



 Score = 35.9 bits (79), Expect = 0.86
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 210
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +   +K+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKN 62


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 39.5 bits (88), Expect = 0.070
 Identities = 26/64 (40%), Positives = 31/64 (48%)
 Frame = +2

Query: 65  RKLPRW**TMAPVCARPVSQEMMLLAPYSPRSSEGPAIRV*WSAWDRKTRT*ETRHRAKE 244
           RKL  W  TMA VCAR     MM     S    + P I+V W  W R+T   E + RA+ 
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRTAMWEMKPRARG 61

Query: 245 VS*P 256
            S P
Sbjct: 62  ESSP 65


>UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin -
           Aedes aegypti (Yellowfever mosquito)
          Length = 400

 Score = 39.5 bits (88), Expect = 0.070
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           + G + NWD  + +W + F ++   V   E P+L+TE   N ++ +E M +I++E ++  
Sbjct: 65  QRGYLVNWDIQKTVWDYMFSSDCCPVNFSETPLLITEPLFNFQSIQEAMLEILYEEYDCD 124

Query: 447 AM 452
           A+
Sbjct: 125 AV 126



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+D G   +H VP  +G     AI R+D+ G+ LT++L +I++ R
Sbjct: 154 VVDMGYSFTHVVPFVKGVKQKEAIRRIDVGGKLLTNHLKEIISYR 198


>UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 692

 Score = 39.5 bits (88), Expect = 0.070
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 4/90 (4%)
 Frame = +3

Query: 324 FYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTT 503
           F   L V P++  VL+ E P+   + +E + Q++F     P++      +LSL A G  T
Sbjct: 173 FIQHLMVDPKQRKVLVVENPMLSSSIQEMICQVLFNNLQVPSVSFVPAPLLSLLAVGCIT 232

Query: 504 GMC----WTPATVSPTPYPSTRDTHSLTPS 581
           G+     +  AT+ P  Y     +H  + S
Sbjct: 233 GLVVEVGYLEATLMPVYYGRPLMSHVASTS 262


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 39.5 bits (88), Expect = 0.070
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +1

Query: 103 MCKAGFAGDDAPRAVFPSI 159
           MCKAGFAGDDAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 39.1 bits (87), Expect = 0.093
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V++NGSG  K G AG+  P  V P+ VG+P+ +          S + D+        TS
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPKKKASSHYTESHSSAIADQKDRSESHSTS 71

Query: 259 NTPS 270
            + S
Sbjct: 72  ESSS 75



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +3

Query: 330 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP-AMYVAIQAVLSLYASGRTTG 506
           N L V PE   + LTEA L P  +R+   +I+FE F  P A +++ Q   S +    T  
Sbjct: 128 NYLSVIPESSSICLTEANLCPAQSRQLSAEIIFEDFGFPLACFLSSQTASSYFYQNYTPS 187

Query: 507 MCWTPATVSPTPYPSTRDTHSLTP 578
              +   +   P  ST  T   +P
Sbjct: 188 RAKSDPVLYSYP-DSTISTSRYSP 210


>UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 503

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +2

Query: 455 RRHPSRALAVRVRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           ++  ++ L V  RS    VLD G   +H     +G  +P  I RL+L G+ LT+YL +++
Sbjct: 174 KKRDAKDLCVVARS--GVVLDCGFSFAHATAFVDGTEVPRGIKRLNLGGKALTNYLKELV 231

Query: 635 TER 643
           + R
Sbjct: 232 SFR 234



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 20/75 (26%), Positives = 33/75 (44%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L+ P + G V +W+   +I        L V P    +++TE P      RE + +++FE 
Sbjct: 90  LRRPCDRGYVVHWEQQREILDDALRRTLGVDPTRCDLIITEPPFALPRTREALDEMVFEY 149

Query: 435 FNTPAMYVAIQAVLS 479
           F      V   A L+
Sbjct: 150 FGFRRALVTTPAKLT 164


>UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 451

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/58 (29%), Positives = 32/58 (55%)
 Frame = +3

Query: 336 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           L + P  HP+L+ E     K  R+   +++FE     A Y+A +A L+ ++ GR++ +
Sbjct: 120 LGLDPSIHPILVVEPTAESKQFRDSSLEVIFEQIGACASYLAKRAALTAFSVGRSSAL 177


>UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2;
           Cryptosporidium|Rep: Actin-like protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 367

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 20/75 (26%), Positives = 38/75 (50%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P   G++ +      IW + F N++ ++P +  +L+TE  LNP + +  + +I+FE F  
Sbjct: 44  PFSEGLLIDVSMENDIWEYIF-NKMNISPGDIGLLVTEPFLNPSSLQHSLFEIIFEQFGF 102

Query: 444 PAMYVAIQAVLSLYA 488
               V     +S +A
Sbjct: 103 NKAIVTNPPAISQFA 117


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 168
           E  A+V+D G    K GFAG+  PR + PS++ R
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR 45


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGT 649
           VLD+G   +  +P+YEGY +  A+  L L GR + + L + L E GT
Sbjct: 137 VLDAGYNETVVLPVYEGYPIIKAVESLPLGGRAIHENLERQLKETGT 183



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPS 156
           E  A V D G+   K GFAG+ +PRA  PS
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPS 41


>UniRef50_Q5KBY2 Cluster: RNA polymerase II transcription factor,
           putative; n=1; Filobasidiella neoformans|Rep: RNA
           polymerase II transcription factor, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 513

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 6/108 (5%)
 Frame = +3

Query: 204 ERLVRRRRGTEQKRYPDLKYPIE-HGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTE 377
           E LV  ++    +   +L++P   + +  +W+  E I  H      + +      +LL  
Sbjct: 77  EELVGAQKENNWESSLELRWPFRPNKVADDWEGREYIMSHLLALLGINIQTNSSALLLIP 136

Query: 378 APLNPK---ANREKMTQIMFETFNTPAMYVAIQAVLS-LYASGRTTGM 509
            P  P    + +   TQ  FE+ NTP M+  + A LS LYA G TTG+
Sbjct: 137 PPSPPTFTLSTQALYTQFAFESLNTP-MFSILPAPLSGLYALGATTGI 183


>UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 725

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 17/76 (22%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMFETF 437
           P E  I+  +  +E + +   +NE+ V     +HP+++TE   NP+  R+ + +  FE +
Sbjct: 106 PYERNIIQQFGLLENL-NDFIFNEIGVVESKVDHPLIITEPVANPEYCRQNLLEQYFECY 164

Query: 438 NTPAMYVAIQAVLSLY 485
             P++ + +    + +
Sbjct: 165 EIPSVMIGVDTFFATF 180


>UniRef50_A7RTR6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 210

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 19/48 (39%), Positives = 27/48 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTR 652
           V+D GD +   +P+ EG  +     RL   GR +TD L + LTE+G R
Sbjct: 83  VVDVGDHID-VIPVVEGCIIESGATRLPYGGRQVTDTLARHLTEKGHR 129


>UniRef50_O94241 Cluster: Actin-like protein arp6; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein arp6 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 401

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 15/45 (33%), Positives = 29/45 (64%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSG   +H +P+ +      A+ R+D+ G+ LT+YL ++++ R
Sbjct: 160 VIDSGYSFTHIIPVIDFSVQEQAVKRVDVGGKLLTNYLKEVISYR 204


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 37.5 bits (83), Expect = 0.28
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 631
           VLD G G +H+VP  EG  +  A LR ++ G  L  YL  +
Sbjct: 201 VLDCGFGATHSVPFVEGKPIQRAALRSNIGGSHLNAYLKNV 241



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +1

Query: 82  VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           VVDNGSG+ K   A    P  V P+ +G P+ +     +    +  GD+
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHPKRKFTSQNLADGSASGGDD 61


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 37.5 bits (83), Expect = 0.28
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 180
           +++++D G+   +AG+ GDD PR+V P+ +G P  +
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKE 50



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +3

Query: 387 NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYPSTRDTH 566
           NP  N  K+ +I FE     +++ + + VLS +A GRT+G+       S +     +D H
Sbjct: 146 NPN-NSIKLAEIAFEKLEVASLFTSRRPVLSCFACGRTSGIV-VDIGASVSNVSCVQDGH 203

Query: 567 SLTPSCVWTWPVA 605
            +  S +  +PVA
Sbjct: 204 CIQGS-IQEYPVA 215


>UniRef50_P45890 Cluster: Actin-like protein 13E; n=8;
           Eumetazoa|Rep: Actin-like protein 13E - Drosophila
           melanogaster (Fruit fly)
          Length = 398

 Score = 37.5 bits (83), Expect = 0.28
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 447 AMYVAIQAVLSLY 485
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136



 Score = 33.5 bits (73), Expect = 4.6
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = +2

Query: 488 VRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           + S +  ++D G   +H VP   G  +   I R+D+ G+ LT+ L ++++ R
Sbjct: 148 MESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYR 199


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 37.5 bits (83), Expect = 0.28
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +3

Query: 162 RKAPPSGCDGRHGTERLVRRRRGTEQKRYPDLKY--PIEHGIVTNWDDMEKIWHHTFYNE 335
           R  P S    +H  +R+       E      L Y  PIE G V NWD  ++IW  TF   
Sbjct: 26  RLVPNSIVKAKHEKKRVFVAHEQEECSDKFSLFYVRPIERGYVVNWDTQQQIWEKTF-GS 84

Query: 336 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           + V      + LT+      A  +  ++I+F+ F
Sbjct: 85  MDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae); n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae) - Nasonia vitripennis
          Length = 373

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 15/65 (23%), Positives = 34/65 (52%)
 Frame = +3

Query: 315 HHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 494
           H+ F+    ++P++  +++ E+PL P   R  + ++MF  F   ++ V    ++++   G
Sbjct: 73  HYIFFKRTVISPKDIRIVILESPLIPSKFRNTLVKVMFRHFEVGSLMVLPAHLVTISTLG 132

Query: 495 RTTGM 509
             T M
Sbjct: 133 MDTAM 137


>UniRef50_A2XWR6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 507

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 424 CSKHSTRPPCTSPSKPCSRCTRPVVPPVCAGLRRRCLPHRTHLR 555
           C  H+  PPCT P +P +    P++P  CA  R  C   R+  R
Sbjct: 282 CPGHAASPPCTGPRRPTAHRAPPLIPSRCAA-RTTCGAARSSYR 324


>UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;
           Leishmania|Rep: Actin-related protein 2, putative -
           Leishmania major
          Length = 392

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 15/42 (35%), Positives = 29/42 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           V++ G+G+SH  P+++G+ L  A   + +AGR +T+ L ++L
Sbjct: 134 VVECGEGLSHCTPVFDGFVLATAQRVVGVAGRAVTERLGQVL 175


>UniRef50_A0BG81 Cluster: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 386

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +2

Query: 491 RSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 622
           R    Y++DS    ++ VPI++G  +   + R+D+ GR LT+ L
Sbjct: 144 RKQFTYIIDSSHSATYLVPIFDGEIMYSGLRRIDIGGRLLTNQL 187


>UniRef50_Q10250 Cluster: Uncharacterized protein C56F8.02; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C56F8.02 - Schizosaccharomyces pombe (Fission yeast)
          Length = 1517

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +1

Query: 124 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTPSNTESSL 288
           G+  PRA F  ++  P H G+++ M  KD   G+E  S +G  +  TP N  S +
Sbjct: 502 GNQNPRATFVPLLCLPEHGGMVISM--KDWIGGEEFMSPKGFKSPRTPENEISEV 554


>UniRef50_UPI0000DA41DA Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 163

 Score = 36.3 bits (80), Expect = 0.65
 Identities = 24/75 (32%), Positives = 34/75 (45%)
 Frame = +1

Query: 436 STRPPCTSPSKPCSRCTRPVVPPVCAGLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPHR 615
           S  PP +S  +P   C   V PP  A L RR L  + HLR + +P+   A+   R+  + 
Sbjct: 27  SNAPPSSSAPRPA--CNGLVPPPPTASLGRRTLGGQAHLRPLGSPAASRAAAWLRTFHYN 84

Query: 616 LPHEDPHRARYSFTT 660
                P  A  + TT
Sbjct: 85  CSPPPPEEAGCAATT 99


>UniRef50_UPI00005A3A0C Cluster: PREDICTED: hypothetical protein
           XP_846344; n=1; Canis lupus familiaris|Rep: PREDICTED:
           hypothetical protein XP_846344 - Canis familiaris
          Length = 191

 Score = 36.3 bits (80), Expect = 0.65
 Identities = 39/136 (28%), Positives = 59/136 (43%), Gaps = 6/136 (4%)
 Frame = +3

Query: 162 RKAPPSGCDGRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHH--TFYNE 335
           R APPS      G + LV  R  + + + P + +P+  G++ +     K+ H    F +E
Sbjct: 15  RPAPPSPHSAPGGQQGLVLCRLPSPEGKLPPITFPVLTGLLLSSSHGCKVCHSLTPFCDE 74

Query: 336 LRVAPEEHPVL--LTEAPLNPKANRE--KMTQIMFETFNTPAMYVAIQAVLSLYASGRTT 503
           L    E  PV   LTE  +      E  KMT  + +      M VA +   S+   G   
Sbjct: 75  LEGLQEVLPVFSWLTEHNVEFLKPWEVTKMTTSLRDQLPLQKMLVATR---SIPVRGLGA 131

Query: 504 GMCWTPATVSPTPYPS 551
             C +P++ SP P PS
Sbjct: 132 PDCISPSSFSPLPPPS 147


>UniRef50_Q6PB40 Cluster: Crim2 protein; n=3; Murinae|Rep: Crim2
           protein - Mus musculus (Mouse)
          Length = 744

 Score = 35.9 bits (79), Expect = 0.86
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = -3

Query: 236 LCASSPTYESFCPMPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 60
           LC +   Y S C    +TP WRG PT+ GN +  + +P +P   + +P+ T+  A   S
Sbjct: 147 LCDALEAYASHCRQAGVTPVWRG-PTLCGNHSWVSKTPLQPQASL-DPVPTSLPALCRS 203


>UniRef50_Q6CPA7 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome E of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 438

 Score = 35.9 bits (79), Expect = 0.86
 Identities = 20/81 (24%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV-LLTEAPLNPKANREKMTQIMFETFNTP 446
           ++G+  +WD M+  W + F   L +  E++PV ++  + LN    +  M Q++   +  P
Sbjct: 69  KNGLPNDWDMMDAQWQYIF-QSLGIQFEDYPVCVVLPSDLNSARRKRFMEQLL--GYGFP 125

Query: 447 AMYVAIQAVLSLYASGRTTGM 509
            + +  +AV +  + GR++G+
Sbjct: 126 MVQLLNEAVCNTLSQGRSSGI 146


>UniRef50_Q12509 Cluster: Actin-like protein ARP6; n=4;
           Saccharomycetales|Rep: Actin-like protein ARP6 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 438

 Score = 35.9 bits (79), Expect = 0.86
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 407 EDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRY--VLDSGDGVSHTVPIYEGYALPHAI 580
           ++D D VR    + +     S+        YH +  V+DSG   +  +P+ +G     A+
Sbjct: 154 DEDIDIVRGNSDSTNSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAV 213

Query: 581 LRLDLAGRDLTDYLMKILTER 643
            +LD+ GR LT  L + L+ R
Sbjct: 214 KKLDIGGRFLTGLLKETLSFR 234


>UniRef50_A0H4X8 Cluster: Putative uncharacterized protein; n=1;
           Chloroflexus aggregans DSM 9485|Rep: Putative
           uncharacterized protein - Chloroflexus aggregans DSM
           9485
          Length = 508

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 2/53 (3%)
 Frame = +1

Query: 427 SKHSTRPPCTSPSKPCSRCTRPVVPPVCAGLRRRCL--PHRTHLRGIRTPSRH 579
           ++H   PP T  + PC   TR  +P  C    R  L  P  TH RGI  P  H
Sbjct: 332 ARHCRAPPPTRTALPCPDATRTALP--CPDATRTALPCPDATHPRGITVPRCH 382


>UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma cruzi
          Length = 372

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSL 658
           VLD G   + T  + +GYAL + +    LAGR +T  L+++L      SL
Sbjct: 140 VLDVGHNQATTTAVLDGYALRNTVASSSLAGRSVTGRLIEMLDREQLESL 189


>UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23;
           Magnoliophyta|Rep: Actin-related protein 8 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 471

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 10/73 (13%)
 Frame = +3

Query: 321 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 470
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 471 VLSLYASGRTTGM 509
           VL+LYA+ RT+G+
Sbjct: 241 VLALYAARRTSGI 253


>UniRef50_UPI0000E8802E Cluster: Penicillin-binding protein,
           transpeptidase:Penicillin-binding protein, dimerization
           domain; n=1; Methylophilales bacterium HTCC2181|Rep:
           Penicillin-binding protein,
           transpeptidase:Penicillin-binding protein, dimerization
           domain - Methylophilales bacterium HTCC2181
          Length = 580

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 30/132 (22%), Positives = 54/132 (40%), Gaps = 1/132 (0%)
 Frame = +3

Query: 189 GRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL 368
           G HG  ++++ R+G       +++ P++   V     ++K   +  Y  L  A E+H  L
Sbjct: 191 GEHGFRKVLKNRKGNVVDDLQEIQIPVDGKDVIL--SLDKRLQYASYKALEKAVEKHAAL 248

Query: 369 LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMCWTP-ATVSPTPY 545
              A L      E +    + +FN      +  A  S Y   R     + P +T+ P   
Sbjct: 249 SGSAVLINARTGEVLAMSNYPSFNP---NTSRSAQRSKYIKNRVVTDIFEPGSTLKPLTV 305

Query: 546 PSTRDTHSLTPS 581
            +    +S+TPS
Sbjct: 306 SAALKNNSVTPS 317


>UniRef50_Q0RUY6 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. RHA1|Rep: Putative uncharacterized
           protein - Rhodococcus sp. (strain RHA1)
          Length = 187

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 28/76 (36%), Positives = 37/76 (48%), Gaps = 5/76 (6%)
 Frame = +1

Query: 448 PCTSPSKPCSRCTRPVVPPVCAGLRRRCLPHRTHLRGIRTPSRHPA-----SGLGRSRPH 612
           PC  PS+P +R + P  P  C+     C P  +  R  R P RHP+     +G+G+ R  
Sbjct: 22  PC--PSRPANRSSIPGGP--CSPA---CAPGSSRAR--RGPCRHPSPDLGPAGIGQVRGA 72

Query: 613 RLPHEDPHRARYSFTT 660
           R P    HRAR S  T
Sbjct: 73  RAPRTPDHRARKSALT 88


>UniRef50_UPI000065FABE Cluster: Histone deacetylase 6 (HD6).; n=1;
           Takifugu rubripes|Rep: Histone deacetylase 6 (HD6). -
           Takifugu rubripes
          Length = 1154

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 22/55 (40%), Positives = 29/55 (52%)
 Frame = -1

Query: 274 CSMGYLRSGYLFCSVPRLLRTSLSVPCRPSHPDGGAFRRSRGIRREEHHLLRNRP 110
           C +  L+S  +FCSVP  +R SL     PS  D G  R SRG  R+     R++P
Sbjct: 837 CFLASLKSELVFCSVPESVRASL-----PSPKDHGK-RSSRGKGRKSEETRRDKP 885


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           ++ ++V+D G    K G+AGD+ P  VF S VG P
Sbjct: 6   DILSIVIDLGFENTKVGYAGDENPTNVFSSNVGMP 40


>UniRef50_Q5CSJ5 Cluster: ARP3 actin related protein; n=2;
           Cryptosporidium|Rep: ARP3 actin related protein -
           Cryptosporidium parvum Iowa II
          Length = 311

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 21/84 (25%), Positives = 37/84 (44%)
 Frame = +3

Query: 246 YPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 425
           Y D+ +P  +    +W+ +E  W      E+       PVLL+E    P   ++   +  
Sbjct: 85  YQDITHPFNYLDGLDWNLLETFWTDIISREMCYDTTMCPVLLSEPHNAPFDFQDHSMEFF 144

Query: 426 FETFNTPAMYVAIQAVLSLYASGR 497
           FE+ + P+     Q +LS+ A  R
Sbjct: 145 FESLSVPSFNCISQELLSVDAVQR 168


>UniRef50_UPI0000E80BE6 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 113

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 28/74 (37%), Positives = 33/74 (44%), Gaps = 6/74 (8%)
 Frame = +1

Query: 448 PCTSPSKPCSRCTRPVVPPVCAGLRRRCLPH--RTHLRGIRTPSRHPASG---LGR-SRP 609
           P  +P   C    RP   P  A  RRR  PH  RT +   R+P R P+      GR SRP
Sbjct: 32  PAATPRVRCGLRGRPSFAPPRAESRRRWGPHVSRTPVITSRSPRRLPSLSPHRAGRPSRP 91

Query: 610 HRLPHEDPHRARYS 651
            R P     R R+S
Sbjct: 92  RRSPQRAEPRMRHS 105


>UniRef50_UPI0000499D03 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 338

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 8/89 (8%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTF-------YNELRVAPEEHPVLLTEAPLNPKANRE-KMTQ 419
           P+  G V +W++++ I+   F       Y+++    ++  V +T  PLN + N   +M Q
Sbjct: 52  PMSRGKVIDWEELQDIFEEVFESFKNSYYDDIL---KDASVFVTH-PLNTQTNFPFQMEQ 107

Query: 420 IMFETFNTPAMYVAIQAVLSLYASGRTTG 506
           I+FE F    + +  Q +++L  S +T+G
Sbjct: 108 ILFEYFGVSNVCLKPQPLMALIQSNKTSG 136


>UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium
           (Vinckeia)|Rep: Actin-like 6 - Plasmodium yoelii yoelii
          Length = 538

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V+++V+D G    K G++GD+ P+ +F S VG P
Sbjct: 6   DVSSIVIDLGFENIKLGYSGDENPKNIFSSNVGVP 40


>UniRef50_Q7QTA6 Cluster: GLP_15_20269_21672; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_15_20269_21672 - Giardia lamblia
           ATCC 50803
          Length = 467

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/51 (27%), Positives = 27/51 (52%)
 Frame = +3

Query: 357 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +P+ L +        R+ +   +FET + PA+Y+  Q   + Y+ G+TT +
Sbjct: 121 YPMALFQPHFVQPLERDLIASCLFETHSIPALYIGDQEAAAAYSVGKTTAL 171


>UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 675

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +3

Query: 261 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           YPI+ G + N +       H  + +L       PV+L  +P   + + E +T+ +FE   
Sbjct: 103 YPIQAGRIANMEAFLAFLEHV-HAQLTTTYHNTPVMLMASPQWTRPDCETITRYVFEKTK 161

Query: 441 TPAMYVAIQAVLSLY 485
           TPA+ +    + + Y
Sbjct: 162 TPALCLIHSGIATQY 176


>UniRef50_Q0UTE0 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 153

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 448 PCTSPSKPCS-RCTRPVVPPVC-AGLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPHRLP 621
           PCTSP KP S  C     PPV  A    +  PH  H       +R   +    + P RL 
Sbjct: 62  PCTSPPKPQSGLCGTAQSPPVATADASNQSKPHLLHFLHFFPLARQEETFCTLAAPVRLR 121

Query: 622 HEDPHRA 642
           H+ P  A
Sbjct: 122 HQPPRNA 128


>UniRef50_A7I4I2 Cluster: Putative uncharacterized protein
           precursor; n=1; Candidatus Methanoregula boonei 6A8|Rep:
           Putative uncharacterized protein precursor -
           Methanoregula boonei (strain 6A8)
          Length = 162

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +3

Query: 462 IQAVLSLYASGRT-TGMCWTPATVSPTPYPSTRDTHSLTPSCVWTWP 599
           I  + +L+ +G T TG   T  T +PTP P T    S++PS + T P
Sbjct: 10  ILVIFALFCAGCTETGSQGTGITATPTPLPLTTAVPSVSPSAITTLP 56


>UniRef50_Q6CJF4 Cluster: Actin-like protein ARP6; n=2;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 415

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSG   +  VPI +G     AI +LD+ GR LT  L + ++ R
Sbjct: 168 VIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFR 212


>UniRef50_P91766 Cluster: Acetylcholine receptor subunit alpha-like
           precursor; n=31; Coelomata|Rep: Acetylcholine receptor
           subunit alpha-like precursor - Manduca sexta (Tobacco
           hawkmoth) (Tobacco hornworm)
          Length = 516

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%)
 Frame = +1

Query: 445 PPCTSPSKPCSRCTRPVVPPVCAGLRR--RC 531
           PPC  P  PC+ C     P +C  LRR  RC
Sbjct: 396 PPCAPPLAPCAACAPAEAPALCDALRRWHRC 426


>UniRef50_UPI0000D9E9B5 Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 219

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 21/59 (35%), Positives = 25/59 (42%)
 Frame = +1

Query: 445 PPCTSPSKPCSRCTRPVVPPVCAGLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPHRLP 621
           P   SP   C RC     PP    L+ R  P      G++TP+RH    LG  RP   P
Sbjct: 39  PQAPSPLDSCCRCDFWTGPPRVPCLKPRHCPRFPLQSGVQTPNRH----LGGPRPSEAP 93


>UniRef50_Q6AG01 Cluster: Putative uncharacterized protein; n=1;
           Leifsonia xyli subsp. xyli|Rep: Putative uncharacterized
           protein - Leifsonia xyli subsp. xyli
          Length = 358

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 445 PPCTSPSKPC-SRCTRPVVPPVCAGLRRRCLP 537
           PP   P+ PC SR  R +VPP CA + R  +P
Sbjct: 301 PPAPLPAAPCPSRSPREMVPPHCATMARTLMP 332


>UniRef50_A4RYY1 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 358

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = +3

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E  V+  EA       RE+  ++ FE FN   +    +AV ++YA GR +G+
Sbjct: 87  EGMVVACEASGTSNRTRERTARMFFEEFNVGGLAFLDKAVCAMYACGRASGV 138


>UniRef50_Q3M0W2 Cluster: Actin 4-2; n=3; Paramecium
           tetraurelia|Rep: Actin 4-2 - Paramecium tetraurelia
          Length = 345

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 16/61 (26%), Positives = 34/61 (55%)
 Frame = +3

Query: 327 YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG 506
           + +L V  +++ +LL       K + +K+ +I+FE+   P  +    A LS +++GR+T 
Sbjct: 74  FEKLGVQSKDYSLLLANN-FQTKHDLQKVVEILFESVEIPNFFTIRNAALSTFSAGRSTA 132

Query: 507 M 509
           +
Sbjct: 133 L 133


>UniRef50_A6R471 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 451

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 5/55 (9%)
 Frame = +1

Query: 175 HQGVMVGMGQKDSYVGDEAQS-KRG----ILTSNTPSNTESSLTGMTWRRFGIIP 324
           H+ ++ G   +  Y GD+ +  KRG    + TS  P +     TG+ W R G +P
Sbjct: 385 HEAILYGQELQADYPGDQGREYKRGAGRYLFTSRLPGSQVQGCTGICWSRSGRVP 439


>UniRef50_Q3JL15 Cluster: Putative uncharacterized protein; n=1;
           Burkholderia pseudomallei 1710b|Rep: Putative
           uncharacterized protein - Burkholderia pseudomallei
           (strain 1710b)
          Length = 544

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 23/76 (30%), Positives = 29/76 (38%), Gaps = 2/76 (2%)
 Frame = +1

Query: 424 CSKHSTRPPCTSPSKPCSRCTRPVV--PPVCAGLRRRCLPHRTHLRGIRTPSRHPASGLG 597
           C   + RP    P +PC  C R     PP+   LR         +R +R   R PA    
Sbjct: 161 CPPRAGRPRRRPPHRPCRPCRRHDARRPPLRRALRANA--STATIRTVRATRRSPACRAA 218

Query: 598 RSRPHRLPHEDPHRAR 645
            +R  R     P RAR
Sbjct: 219 FNRRRRCAPPSPRRAR 234


>UniRef50_A5CAW6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 451

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 11/74 (14%)
 Frame = +3

Query: 321 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQ----IMFETFNTPAMYVAIQ 467
           T Y+ + V P   P++L+  P+       + KA+R ++ +    ++F+  N PA+    Q
Sbjct: 178 TIYSRMHVKPSAQPIVLS-VPICHYDDNESAKASRRQLKETIHSVLFD-MNVPAVCAINQ 235

Query: 468 AVLSLYASGRTTGM 509
           A L+LYA+ +T+G+
Sbjct: 236 ATLALYAAKQTSGI 249


>UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1;
           Plasmodium vivax|Rep: Actin-related protein, putative -
           Plasmodium vivax
          Length = 600

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           ++ ++VVD G    K G+AGD+ P  +F S VG P
Sbjct: 6   DILSIVVDLGFENTKIGYAGDENPTNIFSSNVGVP 40


>UniRef50_Q2H5W0 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 520

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 24/88 (27%), Positives = 37/88 (42%)
 Frame = +3

Query: 312 WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS 491
           +H   + +L   P+   +L+     +P   R    +   E    P + V   A+  +  S
Sbjct: 225 FHQAMHAKLHTRPDLLSLLIPS--FSPGCRRLTPGKGFLEALLEPNVTVVSDAITGITPS 282

Query: 492 GRTTGMCWTPATVSPTPYPSTRDTHSLT 575
           G TT    TP+  +PT  P T  TH LT
Sbjct: 283 GITTTTT-TPSPATPTHAPPTTTTHPLT 309


>UniRef50_A4UCJ1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 1017

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +2

Query: 437 QHARHVRRHPSRALAVRVRSYHRYVLDSGDGVSHTV 544
           QH +H +R P  A A RVR  HR   D GDG S+ +
Sbjct: 30  QHPQHPQRPPLSAAATRVRQQHRD--DDGDGSSNRI 63


>UniRef50_Q4TD34 Cluster: Chromosome undetermined SCAF6552, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF6552,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 338

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 16/24 (66%), Positives = 17/24 (70%)
 Frame = +1

Query: 562 RTPSRHPASGLGRSRPHRLPHEDP 633
           R PSR  A GLGR+R HRLPH  P
Sbjct: 41  RRPSRARAPGLGRAR-HRLPHPPP 63


>UniRef50_Q6AG37 Cluster: Transcriptional regulator, sugar-binding
           family; n=2; Actinobacteria (class)|Rep: Transcriptional
           regulator, sugar-binding family - Leifsonia xyli subsp.
           xyli
          Length = 406

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 28/70 (40%), Positives = 30/70 (42%), Gaps = 2/70 (2%)
 Frame = +1

Query: 442 RPPCTSPSKP-CSRCTRPVVP-PVCAGLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPHR 615
           RPP  + S+P C     P  P P   G RRR    R H RG   P     SG GR RP  
Sbjct: 326 RPP--TESRPHCDHRDFPARPRPRVGGPRRRDPRRRPH-RGFAAPLPERDSGRGRGRPRT 382

Query: 616 LPHEDPHRAR 645
            P   PH  R
Sbjct: 383 AP---PHSER 389


>UniRef50_Q8GPN6 Cluster: Putative uncharacterized protein; n=1;
           Streptomyces avermitilis|Rep: Putative uncharacterized
           protein - Streptomyces avermitilis
          Length = 291

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 21/62 (33%), Positives = 25/62 (40%), Gaps = 5/62 (8%)
 Frame = +1

Query: 436 STRPPCTSPSKPCSRCTRPVVPPVCAGLRRR-----CLPHRTHLRGIRTPSRHPASGLGR 600
           S RPPC S       C+   +    +  RRR     C   R+     R PSRH  SG  R
Sbjct: 142 SIRPPCRSSETTAGACSTSRIRSASSPPRRRMPGSCCAARRSGPPSCRGPSRHAPSGCWR 201

Query: 601 SR 606
            R
Sbjct: 202 RR 203


>UniRef50_A2SCI7 Cluster: Putative uncharacterized protein; n=1;
           Methylibium petroleiphilum PM1|Rep: Putative
           uncharacterized protein - Methylibium petroleiphilum
           (strain PM1)
          Length = 438

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = -1

Query: 541 GVGDTVAGVQHIPVVRPDAYSESTAWMATYMAGVLNVSNMIW-VIFSLLA 395
           G    +AGV  +P+ RP A+    AW+A + AG     N +W V F+L A
Sbjct: 217 GAQRLMAGVLQLPL-RPQAWLGFQAWLAVFAAGFWPEGNAVWRVGFALAA 265


>UniRef50_A0U399 Cluster: Putative uncharacterized protein; n=1;
           Burkholderia cenocepacia MC0-3|Rep: Putative
           uncharacterized protein - Burkholderia cenocepacia MC0-3
          Length = 1122

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +1

Query: 514 GLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPHRLPHEDPHRAR 645
           G RRR  PH+ HL  +  P R   +   + R  RLP   P   R
Sbjct: 155 GTRRRARPHQRHLDAVAVPVRPDVARQDQRRRSRLPGRPPEPRR 198


>UniRef50_Q5VNE1 Cluster: Putative uncharacterized protein
           P0491D10.24; n=3; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0491D10.24 - Oryza sativa subsp. japonica (Rice)
          Length = 262

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 2/55 (3%)
 Frame = +1

Query: 442 RPPCTSPSKPCSRCTRPVVPPVC--AGLRRRCLPHRTHLRGIRTPSRHPASGLGR 600
           RPP   P +P +  +    PP C     RR   PH     G R+PS   ASG GR
Sbjct: 85  RPP---PPRPAAALSADRPPPPCPPTDRRRSSAPHLASRTGRRSPSPRLASGTGR 136


>UniRef50_Q22579 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 1844

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = -3

Query: 245 PLLLCASSPTYESFCPMPTITP*WRGLPTIEGN-TARGASSPAKPALHIPEPLSTTNAAT 69
           PL++ +SS    S     TITP  +G+PT   N      S+P  P   +    STT A +
Sbjct: 464 PLVVSSSSSGSSSTVVTSTITPSTQGVPTSTSNQPTPSTSNPTTPKSTVTASPSTTGATS 523

Query: 68  SSS 60
           ++S
Sbjct: 524 TAS 526


>UniRef50_Q8IUQ3 Cluster: Putative uncharacterized protein; n=1;
           Homo sapiens|Rep: Putative uncharacterized protein -
           Homo sapiens (Human)
          Length = 172

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 5/60 (8%)
 Frame = -1

Query: 229 PRLLRTSLSVPCRPSHPDGGAFR--RSRGIRREEHHLLRNRPCTYRSHCLL---PTRQLP 65
           PR+ RT LS+   P  PDGG  R  R+ G+  E         C +R    +   P RQLP
Sbjct: 108 PRVCRTLLSLAVCPQPPDGGRMRGLRAPGLHPEHAQFRDLSGCRHRKSGKMVCHPVRQLP 167


>UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 555

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           +V+DNG+  CKAG+ G ++P+ VF +++ R +
Sbjct: 23  IVIDNGTYECKAGYCG-ESPQMVFKNVLYRQK 53


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 757,494,935
Number of Sequences: 1657284
Number of extensions: 18043359
Number of successful extensions: 72502
Number of sequences better than 10.0: 258
Number of HSP's better than 10.0 without gapping: 65374
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 72224
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50000004659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).