SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P52813 Cluster: 40S ribosomal protein S3a; n=17; Eukary...   153   3e-36
UniRef50_P61247 Cluster: 40S ribosomal protein S3a; n=209; Eukar...   140   4e-32
UniRef50_A7NWS5 Cluster: Chromosome chr5 scaffold_2, whole genom...   125   9e-28
UniRef50_UPI00015608D3 Cluster: PREDICTED: similar to ribosomal ...   120   5e-26
UniRef50_UPI000041A636 Cluster: PREDICTED: similar to ribosomal ...   118   2e-25
UniRef50_Q54ZW5 Cluster: 40S ribosomal protein S3A; n=2; Dictyos...   111   2e-23
UniRef50_Q5EMY6 Cluster: 40S ribosomal protein S1-like protein; ...   109   6e-23
UniRef50_UPI000049A095 Cluster: 40S ribosomal protein S3a; n=3; ...   102   1e-20
UniRef50_A3F4R3 Cluster: Ribosomal protein S3a; n=1; Taenia asia...   101   2e-20
UniRef50_Q23DE3 Cluster: Ribosomal S3Ae family protein; n=1; Tet...    95   2e-18
UniRef50_Q9U4U0 Cluster: Antigen; n=10; Trypanosomatidae|Rep: An...    91   2e-17
UniRef50_A0CCR3 Cluster: Chromosome undetermined scaffold_168, w...    90   4e-17
UniRef50_Q8SS05 Cluster: 40S RIBOSOMAL PROTEIN S3A; n=1; Encepha...    80   4e-14
UniRef50_Q9AW90 Cluster: 40S ribosomal Protein S3a; n=1; Guillar...    77   3e-13
UniRef50_A2FDS0 Cluster: Ribosomal protein S3Ae, putative; n=4; ...    75   2e-12
UniRef50_UPI00005042B8 Cluster: UPI00005042B8 related cluster; n...    69   1e-10
UniRef50_Q7QT21 Cluster: GLP_675_17761_17015; n=1; Giardia lambl...    66   1e-09
UniRef50_A4D1I1 Cluster: Similar to ribosomal protein S3a; 40S r...    54   3e-06
UniRef50_A7QAT4 Cluster: Chromosome chr5 scaffold_72, whole geno...    52   1e-05
UniRef50_Q8Q0F2 Cluster: 30S ribosomal protein S3Ae; n=6; Euryar...    52   1e-05
UniRef50_Q8ZT21 Cluster: 30S ribosomal protein S3Ae; n=4; Pyroba...    51   3e-05
UniRef50_Q8TVD1 Cluster: 30S ribosomal protein S3Ae; n=1; Methan...    43   0.006
UniRef50_Q0W2K9 Cluster: 30S ribosomal protein S3AE; n=2; Euryar...    39   0.10 
UniRef50_Q3SAA8 Cluster: SSU ribosomal protein S3AE; n=2; enviro...    39   0.14 
UniRef50_A7D401 Cluster: Ribosomal protein S3Ae; n=2; Halorubrum...    37   0.41 
UniRef50_Q9YCV8 Cluster: 30S ribosomal protein S3Ae; n=12; Archa...    36   0.72 
UniRef50_Q87BL9 Cluster: DNA helicase; n=5; Xylella fastidiosa|R...    36   1.3  
UniRef50_Q30XF1 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_A4F9H9 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_Q5V296 Cluster: 30S ribosomal protein S3Ae; n=4; Haloba...    35   1.7  
UniRef50_O27964 Cluster: 30S ribosomal protein S3Ae; n=1; Archae...    34   2.9  
UniRef50_Q3LW71 Cluster: Ribosomal protein S3a; n=1; Bigelowiell...    34   3.9  
UniRef50_A5UKY8 Cluster: Small subunit ribosomal protein S3Ae; n...    33   5.1  
UniRef50_A4YCU2 Cluster: Ribosomal protein S3Ae; n=1; Metallosph...    33   5.1  
UniRef50_Q119K9 Cluster: Putative uncharacterized protein precur...    33   6.7  
UniRef50_Q9SZU4 Cluster: Putative uncharacterized protein F6G17....    33   6.7  
UniRef50_A7S0H0 Cluster: Predicted protein; n=1; Nematostella ve...    33   6.7  
UniRef50_Q55JL4 Cluster: Putative uncharacterized protein; n=2; ...    33   6.7  
UniRef50_Q2TZP1 Cluster: Predicted RNA-binding protein homologou...    33   6.7  
UniRef50_Q1DMY3 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_A7F286 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_A0RTS7 Cluster: Ribosomal protein S3AE; n=2; Thermoprot...    33   6.7  
UniRef50_Q0KDB8 Cluster: L-Amino-acid oxidase; n=3; cellular org...    33   8.9  
UniRef50_A6R232 Cluster: Predicted protein; n=1; Ajellomyces cap...    33   8.9  
UniRef50_A2SQ57 Cluster: Ribosomal protein S3Ae; n=1; Methanocor...    33   8.9  

>UniRef50_P52813 Cluster: 40S ribosomal protein S3a; n=17;
           Eukaryota|Rep: 40S ribosomal protein S3a - Anopheles
           gambiae (African malaria mosquito)
          Length = 269

 Score =  153 bits (372), Expect = 3e-36
 Identities = 73/104 (70%), Positives = 85/104 (81%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL NFHGM LTTDKLR MVKKWQTLIE ++DVKTTDG++LRVFCIGFT KDS+SQRKTCY
Sbjct: 99  VLTNFHGMALTTDKLRSMVKKWQTLIECSVDVKTTDGFMLRVFCIGFTIKDSMSQRKTCY 158

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQH+Q++ IR KM  II R++T++D         PDSIAKDIEK
Sbjct: 159 AQHSQIKNIRAKMTAIIKREITSTDLKGVVEKLLPDSIAKDIEK 202



 Score =  150 bits (363), Expect = 4e-35
 Identities = 70/84 (83%), Positives = 76/84 (90%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPFTRKDWYDVKAP+MF  RQVG TLVNRTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGSKKKVVDPFTRKDWYDVKAPNMFKNRQVGKTLVNRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ + DAERSFRKF+L+AE V GR
Sbjct: 74  LQNEPDAERSFRKFKLVAESVNGR 97


>UniRef50_P61247 Cluster: 40S ribosomal protein S3a; n=209;
           Eukaryota|Rep: 40S ribosomal protein S3a - Homo sapiens
           (Human)
          Length = 264

 Score =  140 bits (338), Expect = 4e-32
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 1e-29
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>UniRef50_A7NWS5 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr5 scaffold_2, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 656

 Score =  125 bits (302), Expect = 9e-28
 Identities = 60/104 (57%), Positives = 74/104 (71%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL NF GMD TTDKLR +V+KWQTLIEA++DVKTTD Y LR+FCI FT K     +KTCY
Sbjct: 491 VLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQNKKTCY 550

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQ +Q+R IR+KM EI+T   T+ D         P+SI ++IEK
Sbjct: 551 AQSSQIRQIRRKMREIMTNMATSCDLKELVKKFIPESIGREIEK 594



 Score =  124 bits (299), Expect = 2e-27
 Identities = 61/84 (72%), Positives = 69/84 (82%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK  DPF +KDWYD+KAPS+F  R VG TLV+RTQGTKIASEGLK RVFE+SLAD
Sbjct: 408 KKGGKKKAADPFAKKDWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEISLAD 467

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQAD D  +++RK RL AE VQGR
Sbjct: 468 LQADED--QAYRKIRLRAEDVQGR 489


>UniRef50_UPI00015608D3 Cluster: PREDICTED: similar to ribosomal
           protein S3a; n=1; Equus caballus|Rep: PREDICTED: similar
           to ribosomal protein S3a - Equus caballus
          Length = 153

 Score =  120 bits (288), Expect = 5e-26
 Identities = 58/86 (67%), Positives = 69/86 (80%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK VD  ++KDWYD+KAP+MF+ R +G TLV RTQGTKIAS+GLKG VFE+SLAD
Sbjct: 14  KKGAKKKAVDQISKKDWYDMKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGGVFEMSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKRC 96


>UniRef50_UPI000041A636 Cluster: PREDICTED: similar to ribosomal
           protein S3a isoform 5; n=18; Eutheria|Rep: PREDICTED:
           similar to ribosomal protein S3a isoform 5 - Homo
           sapiens
          Length = 211

 Score =  118 bits (283), Expect = 2e-25
 Identities = 59/86 (68%), Positives = 69/86 (80%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDV AP+MF+ R +G TLV RTQGTKIAS+   GRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVNAPAMFNIRNIGKTLVTRTQGTKIASD---GRVFEVSLAD 70

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 71  LQND---EVAFRKFKLITEDVQGKNC 93



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +1

Query: 460 IRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           IRKKM EI+TR+V  +D         PDSI KD+EK
Sbjct: 111 IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDVEK 146



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 128 LKEVVNKLIPD-SIGKDVEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 176


>UniRef50_Q54ZW5 Cluster: 40S ribosomal protein S3A; n=2;
           Dictyostelium discoideum|Rep: 40S ribosomal protein S3A
           - Dictyostelium discoideum AX4
          Length = 273

 Score =  111 bits (267), Expect = 2e-23
 Identities = 53/102 (51%), Positives = 73/102 (71%)
 Frame = +1

Query: 205 KVFPQIQINRRICARTYVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVF 384
           +VF +I++         VL NF+GMDLT+DKLR ++ KW TLIE  +DVKTTDGY LRVF
Sbjct: 78  QVFRKIKLRAEEVEGRNVLTNFYGMDLTSDKLRSLIHKWSTLIECFVDVKTTDGYFLRVF 137

Query: 385 CIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITRDVTNSD 510
            I FT K    ++KT YA+ ++V+AIRKKM +I+T  V+++D
Sbjct: 138 AICFTKKGESQKKKTSYAKTSRVKAIRKKMVDILTETVSSND 179



 Score =   99 bits (238), Expect = 5e-20
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 6/90 (6%)
 Frame = +2

Query: 2   KKGVKK--KIVDPFTRKDWYDVKAPSMFSK----RQVGTTLVNRTQGTKIASEGLKGRVF 163
           KKG KK  K VDPFTRK+WY V+AP+ F K     +VG T VNRTQGTK+AS+GLKGRV+
Sbjct: 6   KKGSKKGGKKVDPFTRKEWYVVRAPTQFFKSPADNKVGFTPVNRTQGTKLASDGLKGRVY 65

Query: 164 EVSLADLQADTDAERSFRKFRLIAEYVQGR 253
           EVSLAD++   D  + FRK +L AE V+GR
Sbjct: 66  EVSLADMK--DDESQVFRKIKLRAEEVEGR 93


>UniRef50_Q5EMY6 Cluster: 40S ribosomal protein S1-like protein;
           n=9; Dikarya|Rep: 40S ribosomal protein S1-like protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 256

 Score =  109 bits (262), Expect = 6e-23
 Identities = 52/86 (60%), Positives = 64/86 (74%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG+KKK  DPF RKDWY +KAP+ F+ R VG TLVNR+ G K A++ LKGR+FEVSLAD
Sbjct: 13  KKGLKKKTQDPFARKDWYGIKAPAPFNIRDVGKTLVNRSSGMKNANDALKGRIFEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D D   +FRK +L  + VQG+ C
Sbjct: 73  LQKDED--HAFRKIKLRVDEVQGKNC 96



 Score =  107 bits (256), Expect = 3e-22
 Identities = 51/103 (49%), Positives = 70/103 (67%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHG+D T+DKLR +V+KWQ+LIEAN+ VKTTD Y+LR+F I  T +     +KT YA
Sbjct: 97  LTNFHGLDFTSDKLRSLVRKWQSLIEANVTVKTTDDYLLRLFAIAVTKRRPNQIKKTTYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
             +Q+RAIR+KM EII R+ +     +      P+ I ++IEK
Sbjct: 157 ASSQIRAIRRKMTEIIQREASTCTLQQLTNKLIPEVIGREIEK 199


>UniRef50_UPI000049A095 Cluster: 40S ribosomal protein S3a; n=3;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S3a - Entamoeba histolytica HM-1:IMSS
          Length = 257

 Score =  102 bits (244), Expect = 1e-20
 Identities = 44/81 (54%), Positives = 63/81 (77%)
 Frame = +1

Query: 268 FHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHT 447
           FHG+ LTTDKLR +VKKW TLIE ++DVKTTDG+++R+FCIGFT++ S   +KT YA+  
Sbjct: 102 FHGLKLTTDKLRSIVKKWCTLIETSVDVKTTDGHLIRIFCIGFTSRKSNQIKKTSYAKSA 161

Query: 448 QVRAIRKKMCEIITRDVTNSD 510
           Q++ IRK M  +IT++  + +
Sbjct: 162 QIKKIRKIMNNLITKEAASRE 182



 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 44/86 (51%), Positives = 58/86 (67%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG K+KI +PF++K+WY+VK P  F +R VG  +VN+T GT+IASE LKGRV EV+LAD
Sbjct: 15  KKGSKRKIAEPFSKKEWYNVKVPKNFKRRTVGQIVVNKTAGTRIASEQLKGRVVEVNLAD 74

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           L  +        KF+   E V G+ C
Sbjct: 75  LMENEKFGAYNYKFK--CEDVNGKDC 98


>UniRef50_A3F4R3 Cluster: Ribosomal protein S3a; n=1; Taenia
           asiatica|Rep: Ribosomal protein S3a - Taenia asiatica
           (Asian tapeworm)
          Length = 183

 Score =  101 bits (242), Expect = 2e-20
 Identities = 50/102 (49%), Positives = 65/102 (63%)
 Frame = +1

Query: 253 YVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTC 432
           + L NFHGMDLT DKL  MV KWQ+ IEA++DVKTTDGY LR F I FT K    Q+   
Sbjct: 21  HCLTNFHGMDLTHDKLCGMVLKWQSTIEAHVDVKTTDGYTLRFFVIAFTKKQE-DQKSHA 79

Query: 433 YAQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKD 558
           YAQ T+++ +R ++ E++ R+V   D         PDSI +D
Sbjct: 80  YAQTTRIKKLRAEIVEVVQREVARCDLKSVVQKLIPDSIGQD 121


>UniRef50_Q23DE3 Cluster: Ribosomal S3Ae family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Ribosomal S3Ae family
           protein - Tetrahymena thermophila SB210
          Length = 265

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 46/104 (44%), Positives = 65/104 (62%), Gaps = 3/104 (2%)
 Frame = +1

Query: 265 NFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSL---SQRKTCY 435
           +F+G+D+T D+L  M++KWQTLIEA +D KT DGY++RVF + FT K S    S   TCY
Sbjct: 102 SFYGLDITRDRLCSMIRKWQTLIEARVDCKTNDGYIIRVFTLAFTKKTSAGKQSSTSTCY 161

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           A+ +QVRAIR+K+   IT +        +  +   +   K IEK
Sbjct: 162 AKSSQVRAIRRKINTFITNEAAKLGIAEFSKNLIGEDYTKKIEK 205



 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 41/84 (48%), Positives = 60/84 (71%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KK+ +DP +RK+WYD +AP  FS +  G TLV ++ G +IASE +KGRV E +LAD
Sbjct: 15  KKGAKKRTIDPLSRKEWYDFRAPIPFSSKSFGKTLVTKSSGNRIASEEIKGRVVESTLAD 74

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           L+ D   ++++RK +L+ + V GR
Sbjct: 75  LK-DNSNDKAWRKVKLVIDEVDGR 97


>UniRef50_Q9U4U0 Cluster: Antigen; n=10; Trypanosomatidae|Rep:
           Antigen - Leishmania major
          Length = 264

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 41/84 (48%), Positives = 56/84 (66%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           K+G + K  +   RK+WYDV AP+ F KRQ   T+ N+TQGT+IA++ L+GRVFE +LAD
Sbjct: 14  KRGKRGKAQETMARKEWYDVVAPANFEKRQFAKTICNKTQGTRIAADVLRGRVFEANLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           L      E ++RK R   + VQGR
Sbjct: 74  LNQSAGEEEAYRKVRFTVQEVQGR 97



 Score = 76.2 bits (179), Expect = 7e-13
 Identities = 30/79 (37%), Positives = 52/79 (65%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           +L  FH M++TTDK+  +++KW T +E  ++VKT DGY +R+F + FT   +  Q + CY
Sbjct: 99  LLTQFHSMEVTTDKMANLLRKWCTTMETTVEVKTADGYTMRLFVVAFTKPQANQQSRNCY 158

Query: 436 AQHTQVRAIRKKMCEIITR 492
           A+   V+ +R ++ ++I R
Sbjct: 159 AKQRLVKWLRMRITKMIKR 177


>UniRef50_A0CCR3 Cluster: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 291

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 43/101 (42%), Positives = 66/101 (65%)
 Frame = +1

Query: 265 NFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQH 444
           +F+G+D T DK+  M+KK QTLIE  ++ ++ DGY+LR+F I FT      QRKT YAQ 
Sbjct: 98  SFYGLDSTKDKIFGMIKKRQTLIETQVEARSQDGYILRIFVIAFTKSIKNQQRKTTYAQR 157

Query: 445 TQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           +Q++ IRKK+ EI+ ++V+     +       +S+AK+I K
Sbjct: 158 SQIKDIRKKIVEIVLKEVSKKSITQLLGFFNQESLAKEIGK 198



 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 39/86 (45%), Positives = 59/86 (68%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG +KK +DP  RK+W+++ AP  F+    G T +N++ GT +A+E +KGRV E SLAD
Sbjct: 12  KKG-QKKTIDPLARKEWFELTAPVPFAAGGFGYTCINKSAGTVVATEAIKGRVVEASLAD 70

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ  +D + ++RK +LI + V+G  C
Sbjct: 71  LQGQSD-QMAWRKVKLIIDDVEGTRC 95


>UniRef50_Q8SS05 Cluster: 40S RIBOSOMAL PROTEIN S3A; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S3A
           - Encephalitozoon cuniculi
          Length = 189

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 39/100 (39%), Positives = 60/100 (60%)
 Frame = +1

Query: 268 FHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHT 447
           F GM+LT+DK + M+KKW TLIEA  D+   DG V RVF +G T +     +KTCY +H+
Sbjct: 52  FDGMELTSDKHKAMIKKWHTLIEAQKDIVAKDGSVFRVFVMGVTRRHPGYVKKTCYVKHS 111

Query: 448 QVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
             + IRK M ++I  +++  D  +       +++ K IE+
Sbjct: 112 DEKKIRKIMFDVIEEELSGCDVQKIMKKLANETVGKRIEE 151


>UniRef50_Q9AW90 Cluster: 40S ribosomal Protein S3a; n=1; Guillardia
           theta|Rep: 40S ribosomal Protein S3a - Guillardia theta
           (Cryptomonas phi)
          Length = 219

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 34/81 (41%), Positives = 52/81 (64%)
 Frame = +1

Query: 268 FHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHT 447
           FHG+ LT DK+  ++KKW TLIE  ++ KT DGY L++F I  + K    + KT Y   +
Sbjct: 96  FHGLTLTRDKICSLIKKWHTLIEVEVNFKTKDGYFLKLFLIAQSKKPKNMKSKTVYINSS 155

Query: 448 QVRAIRKKMCEIITRDVTNSD 510
           Q RA+R+++ +II ++  N D
Sbjct: 156 QKRALRRRITDIIIKEGINMD 176


>UniRef50_A2FDS0 Cluster: Ribosomal protein S3Ae, putative; n=4;
           Trichomonas vaginalis G3|Rep: Ribosomal protein S3Ae,
           putative - Trichomonas vaginalis G3
          Length = 247

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 36/86 (41%), Positives = 55/86 (63%)
 Frame = +1

Query: 232 RRICARTYVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDS 411
           R I A + V   F GM LT DKL  +++K++T+I+A++D KT DG++LR+F IGFT K +
Sbjct: 84  RSIAAGSEVYTQFAGMRLTHDKLDSIMRKYRTMIDASVDAKTADGFILRLFTIGFTKKLA 143

Query: 412 LSQRKTCYAQHTQVRAIRKKMCEIIT 489
            S +   YA   + R +R  M + +T
Sbjct: 144 NSHKNHTYANSHKARQVRDVMIKALT 169


>UniRef50_UPI00005042B8 Cluster: UPI00005042B8 related cluster; n=1;
           Rattus norvegicus|Rep: UPI00005042B8 UniRef100 entry -
           Rattus norvegicus
          Length = 237

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 39/82 (47%), Positives = 51/82 (62%)
 Frame = +2

Query: 8   GVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLADLQ 187
           G ++K      +KD YDVKA +MF+ R +G T V R Q TK+ S GL G VFE SLA LQ
Sbjct: 1   GARRKTARRAKKKDRYDVKALTMFNVRNIGKTQVLRKQETKMVSVGLNGLVFEASLASLQ 60

Query: 188 ADTDAERSFRKFRLIAEYVQGR 253
            D   +   RKF+LI E ++G+
Sbjct: 61  ND---KVVVRKFKLITEDMRGK 79



 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 47/122 (38%), Positives = 67/122 (54%), Gaps = 1/122 (0%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGF-TNKDSLSQRKTCY 435
           L N +GMDLT DK    V KWQ ++EA+ DVKT D Y+L +FC+G+ TN  +   R+   
Sbjct: 82  LTNSYGMDLTWDKRCNKVIKWQ-MVEAHADVKTADYYLLCLFCVGYTTNVTTRYARQLVC 140

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEKGLPWHLTLCAMFGIRK 615
           AQ+ QV  I     +I+  D   +D         PD++ KD+EK   +   L  +F +RK
Sbjct: 141 AQYQQVHQIWLITIQIM--DQRRTDLKEVLNKLVPDNVGKDVEKACQFIYPLHDVF-VRK 197

Query: 616 *K 621
            K
Sbjct: 198 VK 199


>UniRef50_Q7QT21 Cluster: GLP_675_17761_17015; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_675_17761_17015 - Giardia lamblia
           ATCC 50803
          Length = 248

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 31/86 (36%), Positives = 48/86 (55%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KK  ++K  DP+ +K+WY V AP+ F  R +G T V +T G ++A++ +  RV+EV+L D
Sbjct: 11  KKITQRKNPDPYLKKEWYPVIAPAHFKSRHIGQTPVTKTAGLRVATDVINHRVYEVNLGD 70

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           L    +      KF L  + V    C
Sbjct: 71  LNPGAEDLNGNTKFYLQTQLVSDGKC 96



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/80 (37%), Positives = 48/80 (60%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMD+T  K   + +K    I+  +D+ TTDGY+LRVF I FT++    +RK C+ 
Sbjct: 97  LTNFHGMDITRHKYGSLFRKGCDCIDVFMDIPTTDGYLLRVFVIAFTDRFRFQRRKNCHV 156

Query: 439 QHTQVRAIRKKMCEIITRDV 498
           +   +R +R  + E +  ++
Sbjct: 157 KGRVIRMMRAGIYETLHNEL 176


>UniRef50_A4D1I1 Cluster: Similar to ribosomal protein S3a; 40S
           ribosomal protein S3a; v-fos transformation effector
           protein 1; n=2; Eutheria|Rep: Similar to ribosomal
           protein S3a; 40S ribosomal protein S3a; v-fos
           transformation effector protein 1 - Homo sapiens (Human)
          Length = 119

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 28/34 (82%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTT 103
           KKG KKK++D F++KDWYDVKA +MF+ R +G T
Sbjct: 14  KKGAKKKVIDQFSKKDWYDVKALAMFNIRNIGKT 47


>UniRef50_A7QAT4 Cluster: Chromosome chr5 scaffold_72, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_72, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 168

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/83 (36%), Positives = 49/83 (59%)
 Frame = -3

Query: 250 SLHIFGD*SEFAERPFRVSVSL*ISQGNFENSSLQSFRSNFRSLGTVDKRGADLPLAEHR 71
           SLH+ G  S+       + + L ISQGN ++S L+ FR +  S  + +K  A++  AE R
Sbjct: 61  SLHVLGSQSDLPVG--MILIVLNISQGNLKHSVLEPFRGDLGSQSSANKGFANISDAEDR 118

Query: 70  RSLDIVPIFASEWVDNLLLNTFF 2
           R L+++P+  S+ V  LLL++ F
Sbjct: 119 RRLNVIPVLLSKRVGCLLLSSLF 141


>UniRef50_Q8Q0F2 Cluster: 30S ribosomal protein S3Ae; n=6;
           Euryarchaeota|Rep: 30S ribosomal protein S3Ae -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 204

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/79 (37%), Positives = 50/79 (63%)
 Frame = +1

Query: 274 GMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQV 453
           G +LTTD +R +VK+  + I+AN+DV+T DG+V+RV    FT K          A+ +Q+
Sbjct: 84  GHELTTDYVRSIVKRQTSRIDANVDVRTKDGFVIRVKPTCFTIK---------RARSSQM 134

Query: 454 RAIRKKMCEIITRDVTNSD 510
           +AIR+ M +I+ +  + +D
Sbjct: 135 QAIREMMVDIVKKRASETD 153



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 13/35 (37%), Positives = 26/35 (74%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTL 106
           +K V++K+ D +  K+WY+++AP+  ++  VGTT+
Sbjct: 3   RKKVQRKL-DGWKSKEWYNIEAPAYLNRVIVGTTM 36


>UniRef50_Q8ZT21 Cluster: 30S ribosomal protein S3Ae; n=4;
           Pyrobaculum|Rep: 30S ribosomal protein S3Ae -
           Pyrobaculum aerophilum
          Length = 221

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 31/101 (30%), Positives = 53/101 (52%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L  F G++LT D +R +V+K  + + A  +VKT DG V+R+  +G T     + +K+   
Sbjct: 88  LTRFKGLELTRDYIRSLVRKGTSKVTAITEVKTKDGMVMRIAVLGITTHRIGTAQKS--- 144

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDI 561
                 A+RKKM E + +     DSG++       ++A D+
Sbjct: 145 ------AMRKKMIETLVKKAAELDSGQFLKEILEGTLAADL 179


>UniRef50_Q8TVD1 Cluster: 30S ribosomal protein S3Ae; n=1;
           Methanopyrus kandleri|Rep: 30S ribosomal protein S3Ae -
           Methanopyrus kandleri
          Length = 211

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 30/87 (34%), Positives = 44/87 (50%)
 Frame = +1

Query: 250 TYVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKT 429
           T     F G  L  D +R +V++  + I+  IDV T DGY +RV  + FT         T
Sbjct: 69  TTAYSKFEGHRLMRDYVRSLVRRGTSRIDGVIDVVTKDGYKVRVAGLAFT---------T 119

Query: 430 CYAQHTQVRAIRKKMCEIITRDVTNSD 510
             A+ +Q RAIRK+M ++I  +    D
Sbjct: 120 RRAKTSQQRAIRKEMFKVIEENAKECD 146


>UniRef50_Q0W2K9 Cluster: 30S ribosomal protein S3AE; n=2;
           Euryarchaeota|Rep: 30S ribosomal protein S3AE -
           Uncultured methanogenic archaeon RC-I
          Length = 225

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 25/70 (35%), Positives = 35/70 (50%)
 Frame = +2

Query: 20  KIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLADLQADTD 199
           K VD F  K+WY V AP+ F++  +G TL +   G  I      GRV E +L D+  D  
Sbjct: 7   KKVDAFRAKNWYQVIAPAEFNRANIGETLAD-DPGKMI------GRVMESTLGDVTGDWT 59

Query: 200 AERSFRKFRL 229
            +     FR+
Sbjct: 60  KQNIKMIFRI 69



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 25/76 (32%), Positives = 43/76 (56%)
 Frame = +1

Query: 265 NFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQH 444
           +F G +LT D +R +VK+  + I+AN+ V T DG+ +RV  I  T K          A+ 
Sbjct: 80  SFLGHELTRDYMRSLVKRRTSKIDANVVVTTKDGFKVRVKPIVLTVK---------RART 130

Query: 445 TQVRAIRKKMCEIITR 492
           +Q+ +IR+ M  ++ +
Sbjct: 131 SQIESIRQIMINVVNK 146


>UniRef50_Q3SAA8 Cluster: SSU ribosomal protein S3AE; n=2;
           environmental samples|Rep: SSU ribosomal protein S3AE -
           uncultured euryarchaeote Alv-FOS1
          Length = 227

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 20/60 (33%), Positives = 35/60 (58%)
 Frame = +1

Query: 250 TYVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKT 429
           T     F G D+TTD +R M+++ ++ I+   +V+T+DGY +RV  +   ++   S  KT
Sbjct: 80  TNAYTRFIGHDMTTDYIRRMIRRRRSRIDMIFNVETSDGYRMRVKVLTVPDRRIKSSIKT 139


>UniRef50_A7D401 Cluster: Ribosomal protein S3Ae; n=2;
           Halorubrum|Rep: Ribosomal protein S3Ae - Halorubrum
           lacusprofundi ATCC 49239
          Length = 215

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +1

Query: 280 DLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDS-LSQRK 426
           +LT D LR +V++  + +EA+I V TTD Y +RV  +  T K +  SQ K
Sbjct: 83  ELTRDYLRSLVRRGASKVEASITVLTTDDYRIRVQPVALTTKKADRSQEK 132


>UniRef50_Q9YCV8 Cluster: 30S ribosomal protein S3Ae; n=12;
           Archaea|Rep: 30S ribosomal protein S3Ae - Aeropyrum
           pernix
          Length = 214

 Score = 36.3 bits (80), Expect = 0.72
 Identities = 26/80 (32%), Positives = 40/80 (50%)
 Frame = +1

Query: 268 FHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHT 447
           F G +L  D +R + ++  + +    +V T DGY LRV  + FT       R+ C  + +
Sbjct: 79  FKGHELLRDYIRGLTRRKSSKVTGIFNVWTKDGYGLRVTAMAFT-------RQRC--KTS 129

Query: 448 QVRAIRKKMCEIITRDVTNS 507
           Q  AIRK M EI+ +    S
Sbjct: 130 QKSAIRKVMQEIVEQKARES 149


>UniRef50_Q87BL9 Cluster: DNA helicase; n=5; Xylella fastidiosa|Rep:
           DNA helicase - Xylella fastidiosa (strain Temecula1 /
           ATCC 700964)
          Length = 1190

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 31/131 (23%), Positives = 47/131 (35%)
 Frame = +2

Query: 8   GVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLADLQ 187
           G++++  D      W   +   +  + Q   T        + A  GL     +VSLAD  
Sbjct: 548 GMQRQCDDRLQEHSWAVTRGEKVLHEEQCHITTWQAALAKESALTGLMEAAGQVSLADCD 607

Query: 188 ADTDAERSFRKFRLIAEYVQGRMCSATSTAWTSQPISSGGWLKNGRLSSKPTLM*RQPMD 367
           A  D    FR F L   Y +GR  S       +     G   K G  + +P    R  + 
Sbjct: 608 ALADTSIRFRIFLLTTHYWEGRWLSEMQAQLPAD--LDGEKKKTGGTAVEPRWRRRMKLT 665

Query: 368 TFYVSSALVSP 400
              VS+  + P
Sbjct: 666 PCIVSTLFMLP 676


>UniRef50_Q30XF1 Cluster: Putative uncharacterized protein; n=1;
           Desulfovibrio desulfuricans G20|Rep: Putative
           uncharacterized protein - Desulfovibrio desulfuricans
           (strain G20)
          Length = 351

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = -2

Query: 566 FSMSLAMESGNQLVHHLPESELVTSRVMISHIFFLIALT*VCWA*HVLRWLKESLLVKPM 387
           F +S   +S  +L+H     +   +  +  + FF+  LT +  A H +RWL+E+  ++ +
Sbjct: 106 FILSAMRDSNGRLLHRWRNGKASVTACLDDYAFFIAGLTALYEATHEVRWLREAAALQQV 165

Query: 386 QKT 378
           Q T
Sbjct: 166 QDT 168


>UniRef50_A4F9H9 Cluster: Putative uncharacterized protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Putative
           uncharacterized protein - Saccharopolyspora erythraea
           (strain NRRL 23338)
          Length = 414

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 20/61 (32%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query: 173 LADLQADTDAERSFRK-FRLIAEYVQGRMCSATSTAWTSQ-PISSGGWLKNGRLSSKPTL 346
           + D++AD    R++ + FR+ AE + G + + T    TS  P++S G+ K+GR  ++PT+
Sbjct: 87  IGDMEADPVKARAWAEVFRMSAEEIPGFVSALTPEQLTSDTPVTSHGY-KDGRFDARPTV 145

Query: 347 M 349
           +
Sbjct: 146 L 146


>UniRef50_Q5V296 Cluster: 30S ribosomal protein S3Ae; n=4;
           Halobacteriaceae|Rep: 30S ribosomal protein S3Ae -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 213

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = +1

Query: 280 DLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRA 459
           +LT D LR +V++  + +EA I V TTD Y +++  +  T K          A  +Q +A
Sbjct: 83  ELTRDYLRSLVRRGSSKVEAYITVLTTDDYRVQIQPVAVTTKK---------ADASQEKA 133

Query: 460 IRKKMCEII 486
           IR+ M +++
Sbjct: 134 IRRTMIDLV 142


>UniRef50_O27964 Cluster: 30S ribosomal protein S3Ae; n=1;
           Archaeoglobus fulgidus|Rep: 30S ribosomal protein S3Ae -
           Archaeoglobus fulgidus
          Length = 211

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +1

Query: 268 FHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFT-NKDSLSQRKTCYAQH 444
           F   +LT + L  + ++  + IE  +DV T DGY LRV  + FT  +   SQ++   A  
Sbjct: 85  FWRFELTREYLNSLTRRRTSKIEDIVDVTTADGYKLRVKSVVFTVRRCKTSQKRAIRAIM 144

Query: 445 TQV 453
            Q+
Sbjct: 145 RQI 147


>UniRef50_Q3LW71 Cluster: Ribosomal protein S3a; n=1; Bigelowiella
           natans|Rep: Ribosomal protein S3a - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 215

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 20/86 (23%), Positives = 42/86 (48%)
 Frame = +1

Query: 247 RTYVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRK 426
           + ++   F+G  L+ D +  MV K   L+E +I + T    V+ +F + +T   +L    
Sbjct: 91  KMFIRTTFNGFRLSYDFIFSMVLKPTKLVEFSIKINTLKKKVVEIFVL-YTITKNLHSNS 149

Query: 427 TCYAQHTQVRAIRKKMCEIITRDVTN 504
             Y + +++R I ++    I + + N
Sbjct: 150 ITYGKRSRIRKINRESILCIKKMLEN 175


>UniRef50_A5UKY8 Cluster: Small subunit ribosomal protein S3Ae; n=2;
           Methanobacteriaceae|Rep: Small subunit ribosomal protein
           S3Ae - Methanobrevibacter smithii (strain PS / ATCC
           35061 / DSM 861)
          Length = 193

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 22/91 (24%), Positives = 40/91 (43%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           K   ++++ D +  K WY +K P  F  +++G T            + L GR  EV++ +
Sbjct: 3   KAKARRRVRDTWKEKSWYTIKTPVNFEDKEIGETPAR-------DPDYLIGRGVEVTMRE 55

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMCSATST 274
           L    D  + + K R   + V G + +   T
Sbjct: 56  LSG--DFSKQYIKLRFEIDNVAGDVANTKFT 84


>UniRef50_A4YCU2 Cluster: Ribosomal protein S3Ae; n=1;
           Metallosphaera sedula DSM 5348|Rep: Ribosomal protein
           S3Ae - Metallosphaera sedula DSM 5348
          Length = 216

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +1

Query: 268 FHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFT 399
           F G +L+ D +R +V++  + I   +D+ T DG+ LRV  +  T
Sbjct: 87  FAGHELSRDYVRSLVRRKSSKINKVVDITTKDGFTLRVKTLALT 130


>UniRef50_Q119K9 Cluster: Putative uncharacterized protein precursor;
            n=1; Trichodesmium erythraeum IMS101|Rep: Putative
            uncharacterized protein precursor - Trichodesmium
            erythraeum (strain IMS101)
          Length = 2322

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = -1

Query: 498  DVACNDFTHFLSDCSDLSVLGVARLALAQGVLIGET 391
            +V  NDF   LSD  ++S LG+A   +A G+LI  T
Sbjct: 2048 EVGLNDFQLMLSDRLEMSFLGIANFQVAGGLLINGT 2083


>UniRef50_Q9SZU4 Cluster: Putative uncharacterized protein F6G17.90;
           n=2; Arabidopsis thaliana|Rep: Putative uncharacterized
           protein F6G17.90 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 471

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +2

Query: 461 SERKCVKSLHATSLTLTQGGGEQVDFL-TPLPRTSRRACHGILPSARCLASESESVEEGP 637
           SE K VKS   +S  ++    E  D L + +  + RR    I+P    + +E  S+EEGP
Sbjct: 349 SEEKPVKSASVSSHHVSPEDDETTDILLSEILASKRREGKSIIPDKNLVKTEQASIEEGP 408


>UniRef50_A7S0H0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 652

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 7/58 (12%)
 Frame = +3

Query: 180 IYKLTLTR-KGLSANSD*SPNMCKDVCALQLPRHGPH------NR*AQVDG*KMADSH 332
           ++KLT+T  KGL+ +   + N+ KDV    + R GP       NR A++DG K +D H
Sbjct: 361 VFKLTVTDDKGLTGSGTVAVNVKKDVNQAPVARAGPDVVVHLPNRAAELDGSKSSDDH 418


>UniRef50_Q55JL4 Cluster: Putative uncharacterized protein; n=2;
            Filobasidiella neoformans|Rep: Putative uncharacterized
            protein - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 1281

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 16/77 (20%), Positives = 41/77 (53%)
 Frame = +2

Query: 365  DTFYVSSALVSPIRTP*ANARRATPSTLRSEQSERKCVKSLHATSLTLTQGGGEQVDFLT 544
            D  ++S +  + I++P +++    P T R   S+++ + +  +T+++ +   G+Q   LT
Sbjct: 1178 DYDHLSFSTTASIKSPPSHSAALLPETKRHPHSQQQRIATPSSTNISTSDQDGKQEGSLT 1237

Query: 545  PLPRTSRRACHGILPSA 595
            P+  T+ +      P++
Sbjct: 1238 PVGPTTSKGSQSFQPTS 1254


>UniRef50_Q2TZP1 Cluster: Predicted RNA-binding protein homologous
           to eukaryotic snRNP; n=13; Pezizomycotina|Rep: Predicted
           RNA-binding protein homologous to eukaryotic snRNP -
           Aspergillus oryzae
          Length = 1103

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 248 GRMCSATSTAWTSQPISSGGWLKNGRLSSKPTLM*RQPMDTFYV 379
           G +C ATS+AW S+ + S  W++  +++    +    PM  F V
Sbjct: 615 GNLCVATSSAWDSKAVMSAWWVQASQITKTAEVGGLLPMGDFLV 658


>UniRef50_Q1DMY3 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 569

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 5/89 (5%)
 Frame = +2

Query: 377 VSSALVSPIRTP*ANARRATPSTLRSEQSERKCVKSLHATSLTLTQGGGEQVDFLTP--- 547
           V++ L +P   P  NA  ATP+   + Q+       LHAT      G G++V    P   
Sbjct: 140 VTTHLSAPSTAP--NAASATPTATNAAQTTAITSCHLHATKTFCIAGDGKEVQVTGPAGP 197

Query: 548 --LPRTSRRACHGILPSARCLASESESVE 628
              P T    CH       C+   +E VE
Sbjct: 198 NTTPPTQYTDCHRHGSKLYCVGPNNEEVE 226


>UniRef50_A7F286 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 280

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 31/87 (35%), Positives = 43/87 (49%), Gaps = 5/87 (5%)
 Frame = +2

Query: 386 ALVSPIRTP*ANARRATPSTLRS---EQSERKCVKSLHATS--LTLTQGGGEQVDFLTPL 550
           ALV+ IR P     R TP  LRS   E+SE+     LH       LT G    +   + +
Sbjct: 181 ALVTAIRNP---GPRLTPDLLRSVSQEKSEKNAQTILHLCGHHWCLTPG---HLAVGSKV 234

Query: 551 PRTSRRACHGILPSARCLASESESVEE 631
               + ACHGIL SA+ L  E +S+++
Sbjct: 235 LNDEQTACHGILQSAKSL-EEHDSIQK 260


>UniRef50_A0RTS7 Cluster: Ribosomal protein S3AE; n=2;
           Thermoprotei|Rep: Ribosomal protein S3AE - Cenarchaeum
           symbiosum
          Length = 203

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 15/53 (28%), Positives = 30/53 (56%)
 Frame = +1

Query: 268 FHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRK 426
           F   + + + LR +V++  + +   +DVKT+DGYV R+  +  T +   + +K
Sbjct: 82  FKRYEYSKEYLRSLVRRGSSKVNYIVDVKTSDGYVFRLKVLALTYRHLNTSKK 134


>UniRef50_Q0KDB8 Cluster: L-Amino-acid oxidase; n=3; cellular
           organisms|Rep: L-Amino-acid oxidase - Ralstonia eutropha
           (strain ATCC 17699 / H16 / DSM 428 / Stanier
           337)(Cupriavidus necator (strain ATCC 17699 / H16 / DSM
           428 / Stanier337))
          Length = 434

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = +2

Query: 278 WTSQPISSGGWL--KNGRLSSKPTLM*RQPMDTFYVSSALVSPI 403
           W + P S GGW+  + G L+    LM RQP    + + A ++PI
Sbjct: 363 WANDPFSKGGWMHHRPGNLTQAAPLM-RQPHGRIHFAGADIAPI 405


>UniRef50_A6R232 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 1177

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +2

Query: 248 GRMCSATSTAWTSQPISSGGWLKNGRLSSKPT 343
           G +C ATSTAW S+ +  G W  N    SK T
Sbjct: 635 GNLCVATSTAWDSKAV-MGAWWANANQVSKTT 665


>UniRef50_A2SQ57 Cluster: Ribosomal protein S3Ae; n=1;
           Methanocorpusculum labreanum Z|Rep: Ribosomal protein
           S3Ae - Methanocorpusculum labreanum (strain ATCC 43576 /
           DSM 4855 / Z)
          Length = 206

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 21/77 (27%), Positives = 35/77 (45%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KK    + V+ +  K+WY V AP    K+ +G  + +         E + GRV  VSL +
Sbjct: 4   KKQSGGRKVEGWKAKNWYKVHAPEFLGKQFIGEIISSNP-------ENVPGRVLTVSLGE 56

Query: 182 LQADTDAERSFRKFRLI 232
           L  D   +     F+++
Sbjct: 57  LIQDYSKQNVRASFKIM 73


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 736,171,959
Number of Sequences: 1657284
Number of extensions: 15487704
Number of successful extensions: 48411
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 46397
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48390
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).