SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9BPR2 Cluster: Cuticle protein; n=3; Endopterygota|Rep...   109   6e-23
UniRef50_A0NBC0 Cluster: ENSANGP00000005744; n=2; Endopterygota|...   103   3e-21
UniRef50_Q5TWI4 Cluster: ENSANGP00000027390; n=42; Culicidae|Rep...    95   1e-18
UniRef50_A0NBM4 Cluster: ENSANGP00000029828; n=9; Culicidae|Rep:...    95   1e-18
UniRef50_UPI0000D5600D Cluster: PREDICTED: similar to CG7076-PA;...    93   3e-18
UniRef50_UPI0000D5600C Cluster: PREDICTED: similar to CG7076-PA;...    92   7e-18
UniRef50_Q9BPR5 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    92   7e-18
UniRef50_Q9W077 Cluster: CG1919-PA; n=3; Diptera|Rep: CG1919-PA ...    91   2e-17
UniRef50_UPI0000D5600A Cluster: PREDICTED: similar to CG9290-PA;...    91   2e-17
UniRef50_Q9VSH7 Cluster: CG7076-PA; n=4; Diptera|Rep: CG7076-PA ...    91   2e-17
UniRef50_UPI0000D5771F Cluster: PREDICTED: similar to CG7076-PA;...    90   3e-17
UniRef50_Q16EY2 Cluster: Adult cuticle protein, putative; n=3; C...    90   3e-17
UniRef50_Q9W078 Cluster: CG13935-PA; n=3; Diptera|Rep: CG13935-P...    89   7e-17
UniRef50_UPI0000D56012 Cluster: PREDICTED: similar to CG13935-PA...    88   1e-16
UniRef50_Q9BPR4 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    87   2e-16
UniRef50_Q16X77 Cluster: Adult cuticle protein, putative; n=4; C...    87   3e-16
UniRef50_Q9VW05 Cluster: CG9299-PA; n=1; Drosophila melanogaster...    87   4e-16
UniRef50_Q9VSH6 Cluster: CG7072-PA; n=3; Diptera|Rep: CG7072-PA ...    86   5e-16
UniRef50_A0NBM6 Cluster: ENSANGP00000029829; n=1; Anopheles gamb...    86   6e-16
UniRef50_Q16X30 Cluster: Adult cuticle protein, putative; n=1; A...    85   8e-16
UniRef50_Q16X29 Cluster: Adult cuticle protein, putative; n=2; C...    85   8e-16
UniRef50_Q1DH39 Cluster: Adult cuticle protein, putative; n=13; ...    84   2e-15
UniRef50_UPI00015B5626 Cluster: PREDICTED: similar to Dbuz\Ccp7-...    84   3e-15
UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;...    84   3e-15
UniRef50_P27780 Cluster: Pupal cuticle protein Edg-84A precursor...    83   3e-15
UniRef50_UPI0000D56006 Cluster: PREDICTED: similar to CG1919-PA;...    83   4e-15
UniRef50_Q9BPR7 Cluster: Cuticle protein; n=4; Bombyx mori|Rep: ...    83   4e-15
UniRef50_Q5TR98 Cluster: ENSANGP00000027257; n=1; Anopheles gamb...    83   4e-15
UniRef50_Q9VW03 Cluster: CG9290-PA; n=3; Diptera|Rep: CG9290-PA ...    82   8e-15
UniRef50_Q9BPR3 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    81   1e-14
UniRef50_Q7QIG5 Cluster: ENSANGP00000013250; n=2; Culicidae|Rep:...    81   1e-14
UniRef50_Q4V480 Cluster: IP08764p; n=4; Endopterygota|Rep: IP087...    80   3e-14
UniRef50_UPI00015B5682 Cluster: PREDICTED: similar to ENSANGP000...    80   4e-14
UniRef50_UPI00015B5628 Cluster: PREDICTED: similar to RE69226p; ...    80   4e-14
UniRef50_UPI0000D5592F Cluster: PREDICTED: hypothetical protein;...    80   4e-14
UniRef50_P82121 Cluster: Cuticle protein 8; n=1; Blaberus cranii...    80   4e-14
UniRef50_Q9VZG2 Cluster: CG15006-PA; n=1; Drosophila melanogaste...    79   5e-14
UniRef50_Q16I16 Cluster: Cuticle protein, putative; n=2; Culicid...    79   5e-14
UniRef50_UPI00015B5625 Cluster: PREDICTED: similar to Cuticle pr...    78   1e-13
UniRef50_Q9VZG1 Cluster: CG15007-PA; n=2; Drosophila melanogaste...    78   2e-13
UniRef50_UPI0000DB79E3 Cluster: PREDICTED: similar to CG15006-PA...    77   2e-13
UniRef50_Q9VW02 Cluster: CG9283-PA; n=8; Sophophora|Rep: CG9283-...    77   2e-13
UniRef50_Q9VKE2 Cluster: CG16963-PA; n=2; Drosophila melanogaste...    77   3e-13
UniRef50_Q5TWJ2 Cluster: ENSANGP00000026095; n=2; Anopheles gamb...    77   3e-13
UniRef50_Q8MRD2 Cluster: RE04513p; n=2; Drosophila melanogaster|...    77   4e-13
UniRef50_Q16X31 Cluster: Pupal cuticle protein, putative; n=2; A...    77   4e-13
UniRef50_Q9VZF9 Cluster: CG1259-PB; n=3; Diptera|Rep: CG1259-PB ...    76   5e-13
UniRef50_Q4V6L8 Cluster: IP11372p; n=3; Sophophora|Rep: IP11372p...    76   5e-13
UniRef50_Q5TWJ1 Cluster: ENSANGP00000029011; n=1; Anopheles gamb...    76   7e-13
UniRef50_Q17BZ5 Cluster: Pupal cuticle protein, putative; n=36; ...    76   7e-13
UniRef50_Q16X28 Cluster: Putative uncharacterized protein; n=1; ...    75   1e-12
UniRef50_Q16T42 Cluster: Putative uncharacterized protein; n=2; ...    75   1e-12
UniRef50_UPI0000D56015 Cluster: PREDICTED: similar to CG1919-PA;...    74   2e-12
UniRef50_UPI00015B6125 Cluster: PREDICTED: similar to ENSANGP000...    74   3e-12
UniRef50_UPI00015B5629 Cluster: PREDICTED: similar to Cuticle pr...    74   3e-12
UniRef50_Q17J77 Cluster: Cuticle protein, putative; n=1; Aedes a...    74   3e-12
UniRef50_Q16X70 Cluster: Adult cuticle protein, putative; n=5; A...    74   3e-12
UniRef50_Q16X39 Cluster: Adult cuticle protein, putative; n=2; A...    73   4e-12
UniRef50_UPI000051ACBA Cluster: PREDICTED: similar to CG1259-PB;...    73   5e-12
UniRef50_O97060 Cluster: CG1327-PA; n=3; Drosophila|Rep: CG1327-...    73   5e-12
UniRef50_Q17015 Cluster: Cuticle protein; n=82; Neoptera|Rep: Cu...    73   5e-12
UniRef50_Q7PRE1 Cluster: ENSANGP00000015068; n=4; Endopterygota|...    73   6e-12
UniRef50_A0NCX3 Cluster: ENSANGP00000031409; n=1; Anopheles gamb...    73   6e-12
UniRef50_UPI00003C00E7 Cluster: PREDICTED: similar to CG7072-PA;...    72   8e-12
UniRef50_Q16UU5 Cluster: Cuticle protein, putative; n=1; Aedes a...    72   1e-11
UniRef50_Q7QDL7 Cluster: ENSANGP00000026489; n=3; Endopterygota|...    71   3e-11
UniRef50_O77057 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    71   3e-11
UniRef50_UPI0000D5727F Cluster: PREDICTED: similar to CG9290-PA;...    70   3e-11
UniRef50_Q9V3P9 Cluster: CG3474-PA; n=6; Diptera|Rep: CG3474-PA ...    70   3e-11
UniRef50_P80681 Cluster: Larval cuticle protein A1A; n=6; Endopt...    70   4e-11
UniRef50_Q45V98 Cluster: RR2 cuticle protein 2; n=1; Myzus persi...    69   6e-11
UniRef50_Q4V5H9 Cluster: IP07124p; n=3; Sophophora|Rep: IP07124p...    68   1e-10
UniRef50_A0NCX5 Cluster: ENSANGP00000000739; n=1; Anopheles gamb...    68   1e-10
UniRef50_UPI00015B59E6 Cluster: PREDICTED: similar to LP12967p; ...    68   2e-10
UniRef50_UPI0000D555C5 Cluster: PREDICTED: similar to CG2342-PA;...    68   2e-10
UniRef50_UPI00015B60F5 Cluster: PREDICTED: similar to pupal cuti...    67   3e-10
UniRef50_Q45V97 Cluster: RR2 cuticle protein 3; n=1; Myzus persi...    67   3e-10
UniRef50_Q16IY2 Cluster: Putative uncharacterized protein; n=2; ...    67   3e-10
UniRef50_UPI0000D57280 Cluster: PREDICTED: similar to CG9290-PA;...    66   4e-10
UniRef50_Q9VSH5 Cluster: CG13670-PA; n=2; Sophophora|Rep: CG1367...    66   4e-10
UniRef50_UPI00015B6123 Cluster: PREDICTED: similar to GA20083-PA...    66   5e-10
UniRef50_Q17C20 Cluster: Pupal cuticle protein, putative; n=8; C...    66   5e-10
UniRef50_O97062 Cluster: CG1330-PA; n=9; Endopterygota|Rep: CG13...    66   5e-10
UniRef50_A0NG24 Cluster: ENSANGP00000030674; n=1; Anopheles gamb...    66   7e-10
UniRef50_P26967 Cluster: Adult-specific cuticular protein ACP-20...    65   9e-10
UniRef50_UPI0000DB73EB Cluster: PREDICTED: similar to CG7076-PA;...    65   1e-09
UniRef50_Q16R84 Cluster: Putative uncharacterized protein; n=2; ...    65   1e-09
UniRef50_UPI00015B43DE Cluster: PREDICTED: similar to ENSANGP000...    64   2e-09
UniRef50_UPI0000D55C02 Cluster: PREDICTED: similar to CG1919-PA;...    64   2e-09
UniRef50_Q7QD80 Cluster: ENSANGP00000018253; n=1; Anopheles gamb...    64   3e-09
UniRef50_Q8IPD8 Cluster: CG31876-PA; n=2; Sophophora|Rep: CG3187...    63   4e-09
UniRef50_Q5TWH8 Cluster: ENSANGP00000029291; n=1; Anopheles gamb...    63   4e-09
UniRef50_Q5TWH9 Cluster: ENSANGP00000027540; n=1; Anopheles gamb...    62   7e-09
UniRef50_Q16UT8 Cluster: Cuticle protein, putative; n=6; Endopte...    62   7e-09
UniRef50_Q9VQH5 Cluster: CG2973-PA; n=1; Drosophila melanogaster...    61   2e-08
UniRef50_Q9VLB1 Cluster: CG3818-PA; n=1; Drosophila melanogaster...    61   2e-08
UniRef50_Q29KF3 Cluster: GA15548-PA; n=1; Drosophila pseudoobscu...    61   2e-08
UniRef50_UPI0000D5763B Cluster: PREDICTED: similar to CG9299-PA;...    60   3e-08
UniRef50_A0NBM7 Cluster: ENSANGP00000029830; n=1; Anopheles gamb...    60   3e-08
UniRef50_Q8IPD5 Cluster: CG33302-PA; n=1; Drosophila melanogaste...    60   4e-08
UniRef50_Q7Q0W7 Cluster: ENSANGP00000019229; n=1; Anopheles gamb...    58   1e-07
UniRef50_P26968 Cluster: Adult-specific cuticular protein ACP-22...    58   1e-07
UniRef50_Q17C05 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q16JC2 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_UPI00015B5FE9 Cluster: PREDICTED: hypothetical protein;...    57   3e-07
UniRef50_P45590 Cluster: Larval/pupal rigid cuticle protein 66 p...    57   3e-07
UniRef50_Q29NE6 Cluster: GA16544-PA; n=1; Drosophila pseudoobscu...    56   4e-07
UniRef50_Q8IPE0 Cluster: CG31878-PB, isoform B; n=1; Drosophila ...    56   8e-07
UniRef50_Q8IPD9 Cluster: CG31878-PA, isoform A; n=1; Drosophila ...    56   8e-07
UniRef50_Q175B1 Cluster: Adult cuticle protein, putative; n=2; A...    54   2e-06
UniRef50_Q170Z6 Cluster: Pupal cuticle protein, putative; n=2; C...    54   3e-06
UniRef50_Q9VSN3 Cluster: CG32029-PA; n=4; Diptera|Rep: CG32029-P...    53   5e-06
UniRef50_Q9NDT7 Cluster: BCS-1; n=2; Balanus amphitrite|Rep: BCS...    52   7e-06
UniRef50_A0NG23 Cluster: ENSANGP00000030675; n=1; Anopheles gamb...    52   7e-06
UniRef50_A0NG12 Cluster: ENSANGP00000029772; n=13; Culicidae|Rep...    51   2e-05
UniRef50_UPI00015B5FE7 Cluster: PREDICTED: hypothetical protein;...    50   3e-05
UniRef50_Q16X55 Cluster: Putative uncharacterized protein; n=2; ...    50   3e-05
UniRef50_A1YLE4 Cluster: Cuticle protein CB6; n=1; Portunus pela...    50   3e-05
UniRef50_UPI0000D55A42 Cluster: PREDICTED: similar to CG32029-PA...    50   4e-05
UniRef50_Q175B0 Cluster: Putative uncharacterized protein; n=2; ...    50   4e-05
UniRef50_Q7PSL5 Cluster: ENSANGP00000017262; n=2; Culicidae|Rep:...    50   5e-05
UniRef50_UPI00015B5FE4 Cluster: PREDICTED: similar to CG6305-PA;...    49   7e-05
UniRef50_Q29D07 Cluster: GA16621-PA; n=1; Drosophila pseudoobscu...    49   9e-05
UniRef50_Q9V7U0 Cluster: Pro-resilin precursor; n=2; Drosophila ...    49   9e-05
UniRef50_Q7QGL7 Cluster: ENSANGP00000018947; n=2; Culicidae|Rep:...    48   1e-04
UniRef50_Q16XU9 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_UPI0000DB728C Cluster: PREDICTED: similar to CG6305-PA;...    47   3e-04
UniRef50_Q7K2P1 Cluster: GH20904p; n=3; Diptera|Rep: GH20904p - ...    46   5e-04
UniRef50_UPI00015B5FE6 Cluster: PREDICTED: similar to CG15920-PA...    46   8e-04
UniRef50_UPI0000D55C1A Cluster: PREDICTED: similar to CG6305-PA;...    45   0.001
UniRef50_Q7JZJ3 Cluster: RE26879p; n=5; Endopterygota|Rep: RE268...    45   0.001
UniRef50_UPI000051AB43 Cluster: PREDICTED: similar to CG15920-PA...    44   0.002
UniRef50_A0NEQ9 Cluster: ENSANGP00000029837; n=1; Anopheles gamb...    44   0.002
UniRef50_UPI0000D5780C Cluster: PREDICTED: similar to CG6305-PA;...    44   0.002
UniRef50_A7TZ21 Cluster: BCS-1-like protein; n=1; Lepeophtheirus...    44   0.002
UniRef50_UPI00015B5FE8 Cluster: PREDICTED: similar to RE26879p; ...    44   0.003
UniRef50_Q16X58 Cluster: Putative uncharacterized protein; n=2; ...    43   0.004
UniRef50_Q16PW7 Cluster: Putative uncharacterized protein; n=1; ...    41   0.018
UniRef50_UPI0000DB7324 Cluster: PREDICTED: similar to CG6305-PA;...    39   0.071
UniRef50_A7TZ97 Cluster: BCS-1 protein; n=4; Lepeophtheirus salm...    39   0.094
UniRef50_A7TZC7 Cluster: BCS-1-like protein; n=4; Lepeophtheirus...    38   0.12 
UniRef50_A7L487 Cluster: Putative cuticle protein; n=1; Artemia ...    38   0.16 
UniRef50_Q9VV45 Cluster: CG12255-PA; n=2; Sophophora|Rep: CG1225...    38   0.22 
UniRef50_Q16XY8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.38 
UniRef50_Q16EK6 Cluster: Cuticle protein, putative; n=2; Culicid...    37   0.38 
UniRef50_Q9VV46 Cluster: CG4784-PA; n=1; Drosophila melanogaster...    36   0.50 
UniRef50_Q29EJ3 Cluster: GA18429-PA; n=1; Drosophila pseudoobscu...    36   0.50 
UniRef50_P83355 Cluster: Cuticle protein 14 isoform b; n=3; Limu...    36   0.50 
UniRef50_UPI0000D56610 Cluster: PREDICTED: similar to CG10112-PA...    36   0.66 
UniRef50_Q7JZ94 Cluster: RE53044p; n=2; Sophophora|Rep: RE53044p...    36   0.66 
UniRef50_Q3V6S5 Cluster: Cuticular protein; n=5; Tachypleus trid...    36   0.66 
UniRef50_A1Z8Z2 Cluster: CG8510-PA; n=2; Sophophora|Rep: CG8510-...    36   0.66 
UniRef50_P83356 Cluster: Cuticle protein 16 isoform b; n=2; Limu...    36   0.87 
UniRef50_Q7JZW0 Cluster: RE08808p; n=2; Sophophora|Rep: RE08808p...    35   1.2  
UniRef50_Q3V6T1 Cluster: Cuticular protein; n=1; Tachypleus trid...    35   1.2  
UniRef50_UPI0000DB7EC4 Cluster: PREDICTED: similar to CG15920-PA...    35   1.5  
UniRef50_Q29PL1 Cluster: GA21482-PA; n=1; Drosophila pseudoobscu...    34   2.0  
UniRef50_Q17BZ7 Cluster: Putative uncharacterized protein; n=1; ...    34   2.0  
UniRef50_Q5PAQ3 Cluster: Putative uncharacterized protein; n=1; ...    34   2.7  
UniRef50_Q8I6Y0 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    33   4.7  
UniRef50_A1UB34 Cluster: UvrD/REP helicase; n=4; Actinomycetales...    33   6.2  
UniRef50_A1I8X0 Cluster: Putative uncharacterized protein; n=1; ...    32   8.1  
UniRef50_O96680 Cluster: Dissatisfaction; n=2; Drosophila melano...    32   8.1  
UniRef50_A7SNU7 Cluster: Predicted protein; n=1; Nematostella ve...    32   8.1  
UniRef50_Q6C4S5 Cluster: Similarity; n=1; Yarrowia lipolytica|Re...    32   8.1  

>UniRef50_Q9BPR2 Cluster: Cuticle protein; n=3; Endopterygota|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 238

 Score =  109 bits (261), Expect = 6e-23
 Identities = 48/68 (70%), Positives = 56/68 (82%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H D+  +ED+ A+PKYAFEYKIEDPHTGD K QHE RDGDVVKG YSLHEADGSIR V+Y
Sbjct: 148 HHDESHHEDHYAYPKYAFEYKIEDPHTGDNKYQHEIRDGDVVKGEYSLHEADGSIRTVKY 207

Query: 449 SAEQAQWF 472
           +A++   F
Sbjct: 208 TADKKSGF 215



 Score = 41.1 bits (92), Expect = 0.018
 Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 6/52 (11%)
 Frame = +3

Query: 111 AVSSQSIIRHDV----THGHGNEGQSYHVVPVAAHHGAPTIHAAPVL--VHH 248
           AVSSQSI+RHD     TH      Q ++ VPV  HH AP +H A +   +HH
Sbjct: 78  AVSSQSIVRHDTHHEQTHHEQPHEQPHYFVPV--HHHAPIVHEAVIAAPIHH 127


>UniRef50_A0NBC0 Cluster: ENSANGP00000005744; n=2;
           Endopterygota|Rep: ENSANGP00000005744 - Anopheles
           gambiae str. PEST
          Length = 117

 Score =  103 bits (247), Expect = 3e-21
 Identities = 43/71 (60%), Positives = 57/71 (80%)
 Frame = +2

Query: 245 SP*NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEAD 424
           +P +APVH+   P+++DY  HPKY FEY ++DPHTGD K+Q E RDGDVVKG Y+LHEAD
Sbjct: 19  APAHAPVHYHGVPEHKDYHDHPKYKFEYGVKDPHTGDHKTQWEVRDGDVVKGQYTLHEAD 78

Query: 425 GSIRVVEYSAE 457
           G+ RVV+Y ++
Sbjct: 79  GTERVVDYKSD 89


>UniRef50_Q5TWI4 Cluster: ENSANGP00000027390; n=42; Culicidae|Rep:
           ENSANGP00000027390 - Anopheles gambiae str. PEST
          Length = 199

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 44/72 (61%), Positives = 53/72 (73%), Gaps = 2/72 (2%)
 Frame = +2

Query: 263 VHHG--DQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           VHHG      +EDY +HP Y FEY ++DPHTGD KSQ E RDGDVVKG Y+L EADG+ R
Sbjct: 34  VHHGYSGASYHEDYHSHPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGQYTLDEADGTKR 93

Query: 437 VVEYSAEQAQWF 472
           VVEYS+++   F
Sbjct: 94  VVEYSSDKHNGF 105


>UniRef50_A0NBM4 Cluster: ENSANGP00000029828; n=9; Culicidae|Rep:
           ENSANGP00000029828 - Anopheles gambiae str. PEST
          Length = 147

 Score = 94.7 bits (225), Expect = 1e-18
 Identities = 40/64 (62%), Positives = 52/64 (81%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVE 445
           +HG  P+++DY  HPKY FEY ++DPHTGD K+Q E RDGDVVKG Y+LHEADG+ RVV+
Sbjct: 23  YHG-VPEHKDYHDHPKYKFEYGVKDPHTGDHKTQWEVRDGDVVKGQYTLHEADGTERVVD 81

Query: 446 YSAE 457
           Y ++
Sbjct: 82  YKSD 85


>UniRef50_UPI0000D5600D Cluster: PREDICTED: similar to CG7076-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG7076-PA - Tribolium castaneum
          Length = 140

 Score = 93.5 bits (222), Expect = 3e-18
 Identities = 40/65 (61%), Positives = 51/65 (78%)
 Frame = +2

Query: 278 QPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           QPQ E++  HPKY F+Y ++D HTGD+KSQ ETRDGDVVKG YSLHE DG+I  V+Y+A+
Sbjct: 57  QPQEEEHYDHPKYEFKYGVQDHHTGDIKSQEETRDGDVVKGQYSLHEPDGTILTVKYTAD 116

Query: 458 QAQWF 472
           +   F
Sbjct: 117 KHSGF 121


>UniRef50_UPI0000D5600C Cluster: PREDICTED: similar to CG7076-PA;
           n=3; Tribolium castaneum|Rep: PREDICTED: similar to
           CG7076-PA - Tribolium castaneum
          Length = 558

 Score = 92.3 bits (219), Expect = 7e-18
 Identities = 37/69 (53%), Positives = 52/69 (75%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVE 445
           HH ++  ++++  HPKY ++Y +ED HTGD+KSQ ETRDGD+VKG YSLHE DG+I  V 
Sbjct: 45  HHAEKEHHQEHYHHPKYQYKYGVEDHHTGDIKSQEETRDGDLVKGSYSLHEPDGTILTVH 104

Query: 446 YSAEQAQWF 472
           Y+A++   F
Sbjct: 105 YTADKHSGF 113



 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 34/62 (54%), Positives = 45/62 (72%)
 Frame = +2

Query: 287 YEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQ 466
           +E++  HPKY F+Y +ED HTGD+K   E+RDGDVVKG YSLHE DG+I  V Y+ ++  
Sbjct: 478 HEEHHTHPKYHFKYGVEDKHTGDIKQHEESRDGDVVKGQYSLHEPDGTILTVHYTVDKKS 537

Query: 467 WF 472
            F
Sbjct: 538 GF 539


>UniRef50_Q9BPR5 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 243

 Score = 92.3 bits (219), Expect = 7e-18
 Identities = 41/67 (61%), Positives = 47/67 (70%)
 Frame = +2

Query: 272 GDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYS 451
           G +  Y D  AHPKY + Y +EDPHTGD KSQHETRDGDVVKG YSL + DGS R V Y+
Sbjct: 163 GHEDHYVDEYAHPKYGYSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSFRKVTYT 222

Query: 452 AEQAQWF 472
           A+    F
Sbjct: 223 ADHHNGF 229



 Score = 38.3 bits (85), Expect = 0.12
 Identities = 24/54 (44%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +3

Query: 111 AVSSQSIIRHDVTHGHGN--EGQSYHVVPVAAHHGAPTIHAAPVLVHHHETRQY 266
           AVSSQ+I+RHD T  H       + H  PVA    AP IHAAP +    E   Y
Sbjct: 25  AVSSQNIVRHDQTIHHETPIHYTALHTAPVA--QAAPEIHAAPAIHTIQEAPTY 76


>UniRef50_Q9W077 Cluster: CG1919-PA; n=3; Diptera|Rep: CG1919-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 180

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 40/68 (58%), Positives = 48/68 (70%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           HG   +  DY A+PKY + Y + D HTGD+KSQHE RDGDVVKG YSL E DGS+R VEY
Sbjct: 39  HGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEY 98

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 99  TADDHNGF 106


>UniRef50_UPI0000D5600A Cluster: PREDICTED: similar to CG9290-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9290-PA - Tribolium castaneum
          Length = 169

 Score = 90.6 bits (215), Expect = 2e-17
 Identities = 41/70 (58%), Positives = 48/70 (68%)
 Frame = +2

Query: 263 VHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           VH       E + AHPKY F+Y +ED HTGD+KS  ETRDGDVVKG YSLHE DG+I VV
Sbjct: 81  VHSAPSHHEEHHYAHPKYQFKYGVEDKHTGDIKSHEETRDGDVVKGSYSLHEPDGTILVV 140

Query: 443 EYSAEQAQWF 472
            Y+A +   F
Sbjct: 141 HYTASKKTGF 150


>UniRef50_Q9VSH7 Cluster: CG7076-PA; n=4; Diptera|Rep: CG7076-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 162

 Score = 90.6 bits (215), Expect = 2e-17
 Identities = 42/68 (61%), Positives = 51/68 (75%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           HG   ++ DY A PKYAF+Y + D HTGD+KSQHETRDGD VKG YSL E DGSIR V+Y
Sbjct: 75  HGHD-EHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDY 133

Query: 449 SAEQAQWF 472
           +A++   F
Sbjct: 134 TADKHNGF 141


>UniRef50_UPI0000D5771F Cluster: PREDICTED: similar to CG7076-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG7076-PA - Tribolium castaneum
          Length = 132

 Score = 90.2 bits (214), Expect = 3e-17
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 5/84 (5%)
 Frame = +2

Query: 236 ARASP*NAPVHHGDQPQYE-----DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKG 400
           A A     P HH  Q ++E     DY A PKY F+Y + D HTGD+KSQ E+RDGDVVKG
Sbjct: 22  ANALQYETPQHHHQQEEHEEDHIIDYYAPPKYTFKYGVSDYHTGDIKSQQESRDGDVVKG 81

Query: 401 YYSLHEADGSIRVVEYSAEQAQWF 472
            YS+ E DGS+R VEY+A++   F
Sbjct: 82  QYSVVEPDGSVRTVEYTADKHSGF 105


>UniRef50_Q16EY2 Cluster: Adult cuticle protein, putative; n=3;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 244

 Score = 90.2 bits (214), Expect = 3e-17
 Identities = 40/63 (63%), Positives = 47/63 (74%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           +Y DY A+PKY FEY ++DPHTGD K Q E RDGDVVKG Y L EADG+ RVVEY+A+  
Sbjct: 125 KYNDYYAYPKYKFEYGVDDPHTGDHKKQWEVRDGDVVKGGYMLKEADGTTRVVEYTADDH 184

Query: 464 QWF 472
             F
Sbjct: 185 NGF 187


>UniRef50_Q9W078 Cluster: CG13935-PA; n=3; Diptera|Rep: CG13935-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 194

 Score = 89.0 bits (211), Expect = 7e-17
 Identities = 42/66 (63%), Positives = 48/66 (72%), Gaps = 1/66 (1%)
 Frame = +2

Query: 278 QPQYE-DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           +P Y  DY  HPKYAF Y + D  TGD+KSQHETRDGDVVKG YSL E DGSIR V+Y+A
Sbjct: 22  RPGYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTA 81

Query: 455 EQAQWF 472
           +    F
Sbjct: 82  DSIHGF 87


>UniRef50_UPI0000D56012 Cluster: PREDICTED: similar to CG13935-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG13935-PA - Tribolium castaneum
          Length = 143

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 39/60 (65%), Positives = 45/60 (75%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY +HPKYAF+Y + DPHTGD K+Q E RDGDVVKG YSL E DGSIR V+Y A+    F
Sbjct: 27  DYYSHPKYAFKYGVSDPHTGDQKAQTEVRDGDVVKGQYSLVEPDGSIRTVDYVADPVNGF 86


>UniRef50_Q9BPR4 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 291

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 44/70 (62%), Positives = 49/70 (70%)
 Frame = +2

Query: 263 VHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           V H D    ED+ A  KY F Y +EDPHTGD KSQHETRDGDVVKG YSL + DGSIR V
Sbjct: 110 VEHSDH--VEDH-APAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKV 166

Query: 443 EYSAEQAQWF 472
           EY+A+    F
Sbjct: 167 EYTADHHNGF 176



 Score = 36.3 bits (80), Expect = 0.50
 Identities = 19/45 (42%), Positives = 25/45 (55%)
 Frame = +3

Query: 111 AVSSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVH 245
           AVSSQSI+RHD      +   + H  PV +H      HAAP++ H
Sbjct: 27  AVSSQSIVRHD----EPSHQATAHYTPVLSHAAPVLTHAAPLIQH 67


>UniRef50_Q16X77 Cluster: Adult cuticle protein, putative; n=4;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 146

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 39/67 (58%), Positives = 48/67 (71%)
 Frame = +2

Query: 272 GDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYS 451
           G + ++ DY AHPKY FEY ++D  TGD KS  E RDGDVVKG YSLHE DG+ RVVEY 
Sbjct: 35  GGEEEHGDYYAHPKYKFEYGVQDHKTGDHKSHWEIRDGDVVKGQYSLHEPDGTERVVEYK 94

Query: 452 AEQAQWF 472
           +++   F
Sbjct: 95  SDKHSGF 101


>UniRef50_Q9VW05 Cluster: CG9299-PA; n=1; Drosophila melanogaster|Rep:
            CG9299-PA - Drosophila melanogaster (Fruit fly)
          Length = 1242

 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 37/56 (66%), Positives = 44/56 (78%)
 Frame = +2

Query: 290  EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
            E +DAHP+YAFEY + DPHTGD K Q E RDGDVVKG YSL E DG++R V+Y A+
Sbjct: 1159 EHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYAD 1214


>UniRef50_Q9VSH6 Cluster: CG7072-PA; n=3; Diptera|Rep: CG7072-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 407

 Score = 86.2 bits (204), Expect = 5e-16
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query: 254 NAPV-HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGS 430
           +APV  H     + +  A+PKY+F Y I+DPHTGD+KSQ E RDGDVVKG YSL E DGS
Sbjct: 70  HAPVLSHAVHAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGS 129

Query: 431 IRVVEYSAEQAQWF 472
           +R V+Y+A+    F
Sbjct: 130 VRTVDYTADDHNGF 143



 Score = 34.3 bits (75), Expect = 2.0
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETR-DGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           Y+F Y+I DP T + + + E R     ++G Y     DG I V +Y A++
Sbjct: 157 YSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKE 206


>UniRef50_A0NBM6 Cluster: ENSANGP00000029829; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029829 - Anopheles gambiae
           str. PEST
          Length = 152

 Score = 85.8 bits (203), Expect = 6e-16
 Identities = 39/60 (65%), Positives = 45/60 (75%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY A+PKY FEY ++DPHTGD KS  E RDGDVVKG YSL+E DGS RVV Y A++   F
Sbjct: 51  DYYAYPKYKFEYGVKDPHTGDQKSHWEERDGDVVKGVYSLYEPDGSERVVVYRADKLHGF 110


>UniRef50_Q16X30 Cluster: Adult cuticle protein, putative; n=1;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 149

 Score = 85.4 bits (202), Expect = 8e-16
 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 1/70 (1%)
 Frame = +2

Query: 266 HHGDQPQY-EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           HH D      DY AH KY F+Y ++DPHTGD K+  E RDGDVVKG Y+L +ADGS R+V
Sbjct: 51  HHEDHIDVPHDYFAHAKYKFDYGVKDPHTGDHKTHWEERDGDVVKGAYTLFDADGSTRIV 110

Query: 443 EYSAEQAQWF 472
           EY+A+    F
Sbjct: 111 EYTADPLHGF 120


>UniRef50_Q16X29 Cluster: Adult cuticle protein, putative; n=2;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 188

 Score = 85.4 bits (202), Expect = 8e-16
 Identities = 38/66 (57%), Positives = 49/66 (74%)
 Frame = +2

Query: 275 DQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           DQ  ++DY A+PKY F Y ++D HTGD KSQ E RDGDVVKG YS +E DG+ RVVEY++
Sbjct: 82  DQYDHKDYYAYPKYKFNYGVQDSHTGDHKSQWEIRDGDVVKGGYSFYEPDGTKRVVEYTS 141

Query: 455 EQAQWF 472
           ++   F
Sbjct: 142 DKHSGF 147


>UniRef50_Q1DH39 Cluster: Adult cuticle protein, putative; n=13;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 196

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 39/61 (63%), Positives = 46/61 (75%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           EDY ++PKY FEY ++D HTGD KSQ E RDGDVVKG Y+L EADGS R+VEY A+    
Sbjct: 86  EDYYSYPKYKFEYGVKDIHTGDHKSQWEMRDGDVVKGEYTLDEADGSKRIVEYYADGKNG 145

Query: 470 F 472
           F
Sbjct: 146 F 146


>UniRef50_UPI00015B5626 Cluster: PREDICTED: similar to Dbuz\Ccp7-PA;
           n=5; Nasonia vitripennis|Rep: PREDICTED: similar to
           Dbuz\Ccp7-PA - Nasonia vitripennis
          Length = 144

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 37/59 (62%), Positives = 43/59 (72%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           YD HPKY F Y + D HTGD+KSQHE RDGDVV G YSL +ADG  RVV Y+A++   F
Sbjct: 52  YDHHPKYKFAYDVHDSHTGDIKSQHEERDGDVVHGSYSLIDADGYKRVVHYTADKHSGF 110


>UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 145

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 38/60 (63%), Positives = 43/60 (71%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY A+PKY F Y + D HTGD KSQHE RDGDVVKG YSL E DG+IR V Y+A+    F
Sbjct: 62  DYYAYPKYEFNYGVADGHTGDHKSQHEVRDGDVVKGSYSLVEPDGTIRTVHYTADDHNGF 121


>UniRef50_P27780 Cluster: Pupal cuticle protein Edg-84A precursor;
           n=2; Sophophora|Rep: Pupal cuticle protein Edg-84A
           precursor - Drosophila melanogaster (Fruit fly)
          Length = 188

 Score = 83.4 bits (197), Expect = 3e-15
 Identities = 33/61 (54%), Positives = 48/61 (78%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           + YD+HP+Y+F Y ++DP TGD+KSQ E+RDGDVV G YS+++ADG  R V+Y+A+  + 
Sbjct: 29  DTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRG 88

Query: 470 F 472
           F
Sbjct: 89  F 89


>UniRef50_UPI0000D56006 Cluster: PREDICTED: similar to CG1919-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 193

 Score = 83.0 bits (196), Expect = 4e-15
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query: 260 PVH-HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           PV+   + P YE   A+PKY + Y + DPHTGD K+Q E R+GDVVKG YSL E DG+IR
Sbjct: 84  PVYGKAEVPIYEKPVAYPKYQYSYGVHDPHTGDHKAQEEIREGDVVKGSYSLAEPDGTIR 143

Query: 437 VVEYSAEQAQWF 472
           VV+Y+A+    F
Sbjct: 144 VVKYTADDLNGF 155


>UniRef50_Q9BPR7 Cluster: Cuticle protein; n=4; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 248

 Score = 83.0 bits (196), Expect = 4e-15
 Identities = 41/73 (56%), Positives = 49/73 (67%)
 Frame = +2

Query: 254 NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI 433
           +APV      Q E+  A+PKY + Y + D H+GD KSQ E RDGDVVKG YS HEADGSI
Sbjct: 150 SAPVAKIVAHQAEEI-AYPKYEYNYSVADGHSGDNKSQQEVRDGDVVKGSYSFHEADGSI 208

Query: 434 RVVEYSAEQAQWF 472
           R VEY+A+    F
Sbjct: 209 RTVEYTADDHSGF 221



 Score = 36.3 bits (80), Expect = 0.50
 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 12/75 (16%)
 Frame = +3

Query: 111 AVSSQSIIRHDVTHGHGNE-----GQSYHVVPVA------AHHGAPTIH-AAPVLVHHHE 254
           AVSSQSI+RHD    H  +       +YH  PVA      A+H AP  + AAPV  H   
Sbjct: 31  AVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQAAPVAYHAAPVAYQAAPVAYHTSP 90

Query: 255 TRQYIMETSLNMKIM 299
            R    E+  +  I+
Sbjct: 91  LRYSSAESVSSQNIV 105



 Score = 33.1 bits (72), Expect = 4.7
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 5/52 (9%)
 Frame = +3

Query: 111 AVSSQSIIRHD--VTHGHGNEGQSYHVVPVAAHHGAP---TIHAAPVLVHHH 251
           +VSSQ+I+RHD   T  +        V    A+H AP   T HAAP  V +H
Sbjct: 98  SVSSQNIVRHDQPQTIQYAAPVAKLAVAAPVAYHAAPAPVTYHAAPAAVSYH 149


>UniRef50_Q5TR98 Cluster: ENSANGP00000027257; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000027257 - Anopheles gambiae
           str. PEST
          Length = 141

 Score = 83.0 bits (196), Expect = 4e-15
 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 2/69 (2%)
 Frame = +2

Query: 272 GDQPQYE--DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVE 445
           G +  YE  DY A+PKY FEY ++D HTGD KSQ E RDGDVVKG Y++ E DGS+RVV+
Sbjct: 56  GSEGGYEGKDYYAYPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTVQEPDGSMRVVK 115

Query: 446 YSAEQAQWF 472
           Y A+    F
Sbjct: 116 YHADGKNGF 124


>UniRef50_Q9VW03 Cluster: CG9290-PA; n=3; Diptera|Rep: CG9290-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 198

 Score = 82.2 bits (194), Expect = 8e-15
 Identities = 39/71 (54%), Positives = 49/71 (69%), Gaps = 2/71 (2%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAH--PKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRV 439
           H G    Y+ ++ H  PKY F+Y ++D HTGD KSQ ETRDGD VKG YSL E+DG+ RV
Sbjct: 68  HSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRV 127

Query: 440 VEYSAEQAQWF 472
           VEY+A+    F
Sbjct: 128 VEYTADDHNGF 138


>UniRef50_Q9BPR3 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 203

 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 34/61 (55%), Positives = 47/61 (77%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YDAHP+Y+F Y ++D  TGD K+QHETRDGDVV+G YS+ + DG+ R V+Y+A+    
Sbjct: 72  EEYDAHPQYSFAYDVQDSLTGDSKTQHETRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 131

Query: 470 F 472
           F
Sbjct: 132 F 132


>UniRef50_Q7QIG5 Cluster: ENSANGP00000013250; n=2; Culicidae|Rep:
           ENSANGP00000013250 - Anopheles gambiae str. PEST
          Length = 152

 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 36/61 (59%), Positives = 45/61 (73%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           +DY A+PKY FEY ++DP TGD KSQ E RDGD+VKG Y+L E DG+ R+VEY A+    
Sbjct: 49  QDYYAYPKYQFEYGVKDPLTGDHKSQWEMRDGDIVKGSYTLDEPDGTQRIVEYRADDRNG 108

Query: 470 F 472
           F
Sbjct: 109 F 109


>UniRef50_Q4V480 Cluster: IP08764p; n=4; Endopterygota|Rep: IP08764p
           - Drosophila melanogaster (Fruit fly)
          Length = 245

 Score = 80.2 bits (189), Expect = 3e-14
 Identities = 36/61 (59%), Positives = 45/61 (73%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD  PKY+F Y I+D +TGDLKSQHETR GDVVKG YS+ + DG+ R V+Y+A+    
Sbjct: 60  EPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHG 119

Query: 470 F 472
           F
Sbjct: 120 F 120


>UniRef50_UPI00015B5682 Cluster: PREDICTED: similar to
           ENSANGP00000019367; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000019367 - Nasonia
           vitripennis
          Length = 265

 Score = 79.8 bits (188), Expect = 4e-14
 Identities = 35/61 (57%), Positives = 47/61 (77%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+ DA+P+Y+F Y + D  TGD K+Q+ETRDGDVV+G YSL EADGS R+V+Y+A+    
Sbjct: 36  EEVDAYPRYSFAYDVADSITGDSKAQYETRDGDVVQGSYSLIEADGSRRIVDYTADPING 95

Query: 470 F 472
           F
Sbjct: 96  F 96


>UniRef50_UPI00015B5628 Cluster: PREDICTED: similar to RE69226p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           RE69226p - Nasonia vitripennis
          Length = 257

 Score = 79.8 bits (188), Expect = 4e-14
 Identities = 36/72 (50%), Positives = 51/72 (70%), Gaps = 1/72 (1%)
 Frame = +2

Query: 260 PVHHGDQP-QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           P+  G +P ++ + DAHP+Y++ Y ++D  TGD KSQHE RDGDVV+G YS  E+DGS R
Sbjct: 21  PIAAGVKPLEHPNDDAHPQYSYVYDVQDAVTGDSKSQHEERDGDVVRGGYSFIESDGSRR 80

Query: 437 VVEYSAEQAQWF 472
           +V+Y A+    F
Sbjct: 81  IVDYVADSVNGF 92


>UniRef50_UPI0000D5592F Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 145

 Score = 79.8 bits (188), Expect = 4e-14
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +2

Query: 278 QPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           Q + E YD +P+Y + Y + D HTGD KSQHETR+GDVV G YSL + DGS R V+YSA
Sbjct: 55  QTRVEPYDPNPQYNYAYAVNDQHTGDSKSQHETRNGDVVHGQYSLTDPDGSRRTVDYSA 113


>UniRef50_P82121 Cluster: Cuticle protein 8; n=1; Blaberus
           craniifer|Rep: Cuticle protein 8 - Blaberus craniifer
           (Death's head cockroach)
          Length = 195

 Score = 79.8 bits (188), Expect = 4e-14
 Identities = 35/59 (59%), Positives = 44/59 (74%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           YD +P+Y F Y ++DP TGD KSQ ETR+GD V+G YS+ E+DGS RVVEYSA+    F
Sbjct: 45  YDPNPQYTFSYNVDDPETGDSKSQEETRNGDNVQGRYSVIESDGSRRVVEYSADAVSGF 103


>UniRef50_Q9VZG2 Cluster: CG15006-PA; n=1; Drosophila
           melanogaster|Rep: CG15006-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 192

 Score = 79.4 bits (187), Expect = 5e-14
 Identities = 35/61 (57%), Positives = 44/61 (72%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD +P+Y F Y + D  TGD+KSQ ETR GDVV+G YSL EADG+ R+VEY+A+    
Sbjct: 52  EPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHG 111

Query: 470 F 472
           F
Sbjct: 112 F 112


>UniRef50_Q16I16 Cluster: Cuticle protein, putative; n=2;
           Culicidae|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 225

 Score = 79.4 bits (187), Expect = 5e-14
 Identities = 34/61 (55%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y++ Y + D  TGD K QHETRDGDVV G YSL E DG+ R V+Y+A+    
Sbjct: 57  EEYDPHPQYSYSYGVHDAVTGDNKEQHETRDGDVVTGQYSLVEPDGTRRTVDYTADPVNG 116

Query: 470 F 472
           F
Sbjct: 117 F 117


>UniRef50_UPI00015B5625 Cluster: PREDICTED: similar to Cuticle
           protein 8 (LM-8) (LM-ACP 8); n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to Cuticle protein 8
           (LM-8) (LM-ACP 8) - Nasonia vitripennis
          Length = 752

 Score = 78.2 bits (184), Expect = 1e-13
 Identities = 35/61 (57%), Positives = 40/61 (65%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD HPKY F Y + D HT D+K Q E RDGD VKG YSL E DG  R V+YSA++   
Sbjct: 21  EHYDHHPKYKFRYNVHDTHTHDIKEQEEARDGDHVKGQYSLVEPDGGKRTVKYSADKHTG 80

Query: 470 F 472
           F
Sbjct: 81  F 81


>UniRef50_Q9VZG1 Cluster: CG15007-PA; n=2; Drosophila
           melanogaster|Rep: CG15007-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 147

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 35/64 (54%), Positives = 44/64 (68%)
 Frame = +2

Query: 281 PQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           P   + D HP+YAF Y ++D  TGD KSQ E RDGDVVKG YS+ +ADGS+R V Y+A+ 
Sbjct: 58  PLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADP 117

Query: 461 AQWF 472
              F
Sbjct: 118 INGF 121


>UniRef50_UPI0000DB79E3 Cluster: PREDICTED: similar to CG15006-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG15006-PA - Apis mellifera
          Length = 123

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 33/64 (51%), Positives = 46/64 (71%)
 Frame = +2

Query: 281 PQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           P++ +YD HP+Y + Y ++D  TGD KSQ ETR+GD+V G YS  EADG+ R+VEY+A+ 
Sbjct: 36  PEF-NYDPHPQYTYAYNVQDSLTGDSKSQQETRNGDIVSGSYSFIEADGTRRIVEYTADP 94

Query: 461 AQWF 472
              F
Sbjct: 95  VNGF 98


>UniRef50_Q9VW02 Cluster: CG9283-PA; n=8; Sophophora|Rep: CG9283-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 204

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>UniRef50_Q9VKE2 Cluster: CG16963-PA; n=2; Drosophila
           melanogaster|Rep: CG16963-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 477

 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 34/61 (55%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           EDYD  P+Y+F Y + D  TGD K Q E RDGD+VKG YSL E DG+ R+VEY+A+    
Sbjct: 69  EDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSG 128

Query: 470 F 472
           F
Sbjct: 129 F 129


>UniRef50_Q5TWJ2 Cluster: ENSANGP00000026095; n=2; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000026095 - Anopheles gambiae
           str. PEST
          Length = 808

 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 34/61 (55%), Positives = 44/61 (72%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E Y+ + +YAFEY + DP TGD+K Q E RDGDVV+G YSL E DG++R V+Y A+ A  
Sbjct: 723 EHYEDNARYAFEYGVNDPLTGDIKHQKEERDGDVVRGQYSLVEPDGNVRTVDYYADWATG 782

Query: 470 F 472
           F
Sbjct: 783 F 783


>UniRef50_Q8MRD2 Cluster: RE04513p; n=2; Drosophila
           melanogaster|Rep: RE04513p - Drosophila melanogaster
           (Fruit fly)
          Length = 206

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 32/63 (50%), Positives = 47/63 (74%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           Q E+YD HP+Y + Y ++D  +GD K+Q ETR+GDVV+G YSL++ADG  R+V+Y+A+  
Sbjct: 47  QVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPI 106

Query: 464 QWF 472
             F
Sbjct: 107 NGF 109


>UniRef50_Q16X31 Cluster: Pupal cuticle protein, putative; n=2;
           Aedes aegypti|Rep: Pupal cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 183

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 36/73 (49%), Positives = 48/73 (65%)
 Frame = +2

Query: 254 NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI 433
           NA   H D+  ++D   HP Y FEY + D HTGD K+  E RDGDVVKG Y+L ++DG+ 
Sbjct: 48  NAHDSHHDEDHHDD---HPMYKFEYGVRDDHTGDHKTHWEHRDGDVVKGQYTLLDSDGTE 104

Query: 434 RVVEYSAEQAQWF 472
           R+VEY+A+    F
Sbjct: 105 RIVEYTADPHHGF 117


>UniRef50_Q9VZF9 Cluster: CG1259-PB; n=3; Diptera|Rep: CG1259-PB -
           Drosophila melanogaster (Fruit fly)
          Length = 247

 Score = 76.2 bits (179), Expect = 5e-13
 Identities = 35/61 (57%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E  DAHP+Y F Y ++D  TGD K+Q ETRDGDVV+G YSL E DGS R+V Y A+    
Sbjct: 138 EIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSING 197

Query: 470 F 472
           F
Sbjct: 198 F 198


>UniRef50_Q4V6L8 Cluster: IP11372p; n=3; Sophophora|Rep: IP11372p -
           Drosophila melanogaster (Fruit fly)
          Length = 424

 Score = 76.2 bits (179), Expect = 5e-13
 Identities = 34/63 (53%), Positives = 45/63 (71%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           +Y  +  H  YAF Y ++D HTGD+KSQ E+RDGD VKG+YS+ E DGSIR V Y+A+  
Sbjct: 46  EYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105

Query: 464 QWF 472
           + F
Sbjct: 106 KGF 108


>UniRef50_Q5TWJ1 Cluster: ENSANGP00000029011; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029011 - Anopheles gambiae
           str. PEST
          Length = 384

 Score = 75.8 bits (178), Expect = 7e-13
 Identities = 35/68 (51%), Positives = 47/68 (69%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H   P+Y    AHP Y+F Y ++D H+GD+KSQ ETRD  +VKG+YS+ E DGSIR V+Y
Sbjct: 20  HAYAPEY----AHPAYSFSYGVKDLHSGDVKSQWETRDDGIVKGHYSVVEPDGSIREVDY 75

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 76  TADSKTGF 83


>UniRef50_Q17BZ5 Cluster: Pupal cuticle protein, putative; n=36;
           Culicidae|Rep: Pupal cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 242

 Score = 75.8 bits (178), Expect = 7e-13
 Identities = 36/72 (50%), Positives = 45/72 (62%)
 Frame = +2

Query: 257 APVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           APVHH    + E + A   Y F Y + D HTGD+KSQHETR GD V G YSL ++DG  R
Sbjct: 60  APVHHTLVKEVEHH-APANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLIDSDGHHR 118

Query: 437 VVEYSAEQAQWF 472
           +V+Y A+    F
Sbjct: 119 IVDYHADHHSGF 130


>UniRef50_Q16X28 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 362

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 32/57 (56%), Positives = 43/57 (75%)
 Frame = +2

Query: 302 AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           AHP Y+F Y ++D H+GD+KSQ ETRD  +VKG+YS+ E DGSIR V+Y+A+    F
Sbjct: 35  AHPSYSFSYGVKDLHSGDVKSQWETRDDGIVKGHYSVVEPDGSIREVDYTADSKTGF 91


>UniRef50_Q16T42 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 212

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 33/60 (55%), Positives = 43/60 (71%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +Y  +PKY FEY ++D HTGD KSQ E RDGD VKG Y+L +ADG+ R+V+Y A+    F
Sbjct: 111 EYYTYPKYKFEYGVQDFHTGDHKSQWEIRDGDFVKGEYTLADADGTHRIVKYRADDKNGF 170


>UniRef50_UPI0000D56015 Cluster: PREDICTED: similar to CG1919-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 115

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 32/49 (65%), Positives = 39/49 (79%)
 Frame = +2

Query: 302 AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           A+PKY FEY ++D HTGD+K Q E RDGDVVKG YSL E DG++R V+Y
Sbjct: 34  AYPKYHFEYGVKDGHTGDIKEQTEERDGDVVKGEYSLVEPDGTVRKVQY 82


>UniRef50_UPI00015B6125 Cluster: PREDICTED: similar to
           ENSANGP00000027390; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000027390 - Nasonia
           vitripennis
          Length = 216

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 1/66 (1%)
 Frame = +2

Query: 266 HHGDQPQY-EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           +H  + +Y  DY AHPKY + Y +ED HTGD  SQ ETRDG  V G YS+ E  G +R+V
Sbjct: 81  YHEPEIKYVHDYVAHPKYEYSYGVEDHHTGDFHSQKETRDGSSVTGEYSIAEPGGRLRIV 140

Query: 443 EYSAEQ 460
            Y A++
Sbjct: 141 SYRADK 146


>UniRef50_UPI00015B5629 Cluster: PREDICTED: similar to Cuticle
           protein 21 (LM-ACP 21); n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to Cuticle protein 21 (LM-ACP 21) -
           Nasonia vitripennis
          Length = 344

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 31/60 (51%), Positives = 42/60 (70%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +YD HP+Y++ Y ++D  TGD KSQ E RDGD V+G YSL E+DG+ R V Y+A+    F
Sbjct: 50  EYDPHPQYSYSYDVQDQLTGDSKSQEEQRDGDSVRGSYSLLESDGTRRTVHYTADDVNGF 109


>UniRef50_Q17J77 Cluster: Cuticle protein, putative; n=1; Aedes
           aegypti|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 148

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/60 (55%), Positives = 42/60 (70%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +YD  P+Y + Y ++D  TGD KSQ ETRDGDVVKG YSL E DG++R V Y+A+    F
Sbjct: 49  NYDPLPQYTYAYNVQDALTGDNKSQQETRDGDVVKGSYSLVEPDGTVRTVIYTADPINGF 108


>UniRef50_Q16X70 Cluster: Adult cuticle protein, putative; n=5;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 129

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 5/74 (6%)
 Frame = +2

Query: 266 HHGDQPQYE----DY-DAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGS 430
           HH    ++E    DY  +HPKY F+Y ++D +T D KS  E RDGDVVKG Y+L EADG+
Sbjct: 31  HHQSHSEFEYHHGDYLHSHPKYNFKYGVKDGYTHDHKSAWEHRDGDVVKGQYTLDEADGT 90

Query: 431 IRVVEYSAEQAQWF 472
            RVV+YS++    F
Sbjct: 91  HRVVDYSSDHKSGF 104


>UniRef50_Q16X39 Cluster: Adult cuticle protein, putative; n=2;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 189

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 33/62 (53%), Positives = 43/62 (69%)
 Frame = +2

Query: 287 YEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQ 466
           Y+D+D+  KY FEY ++DPHTGD KSQ E  DG  +KG Y+L E DG+ R VEY A++  
Sbjct: 19  YDDWDSGAKYKFEYGVKDPHTGDHKSQWEISDGHGLKGGYTLDEPDGTKRYVEYKADKWH 78

Query: 467 WF 472
            F
Sbjct: 79  GF 80


>UniRef50_UPI000051ACBA Cluster: PREDICTED: similar to CG1259-PB;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG1259-PB
           - Apis mellifera
          Length = 397

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 33/61 (54%), Positives = 44/61 (72%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E++D +P+Y+F Y + D  TGD K+Q ETR+GDVV+G YSL E DGS RVV Y+A+    
Sbjct: 216 ENFDPNPQYSFSYSVADGLTGDNKAQEETRNGDVVQGSYSLIEPDGSRRVVSYAADPING 275

Query: 470 F 472
           F
Sbjct: 276 F 276


>UniRef50_O97060 Cluster: CG1327-PA; n=3; Drosophila|Rep: CG1327-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 217

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 35/70 (50%), Positives = 45/70 (64%)
 Frame = +2

Query: 263 VHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           +H      Y D D HPKY F Y ++D  +GD KSQ E+RDGDVV+G YSL +ADG  R V
Sbjct: 49  IHPHGHEVYPD-DPHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTV 107

Query: 443 EYSAEQAQWF 472
           +Y+A+    F
Sbjct: 108 KYTADSVNGF 117


>UniRef50_Q17015 Cluster: Cuticle protein; n=82; Neoptera|Rep:
           Cuticle protein - Anopheles gambiae (African malaria
           mosquito)
          Length = 245

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 36/72 (50%), Positives = 48/72 (66%)
 Frame = +2

Query: 257 APVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           A V +  QP  E+YDA+P Y+F Y I D  TGD KSQ E+R GDVV+G YS+ + DG+ R
Sbjct: 49  AKVAYAAQP--EEYDANPHYSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKR 106

Query: 437 VVEYSAEQAQWF 472
            V+Y+A+    F
Sbjct: 107 TVDYTADPHNGF 118


>UniRef50_Q7PRE1 Cluster: ENSANGP00000015068; n=4;
           Endopterygota|Rep: ENSANGP00000015068 - Anopheles
           gambiae str. PEST
          Length = 132

 Score = 72.5 bits (170), Expect = 6e-12
 Identities = 31/60 (51%), Positives = 42/60 (70%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +YD  P+Y + Y ++D  TGD KSQ ETRDGD+V+G YSL E DG++R V Y+A+    F
Sbjct: 39  NYDPLPQYTYAYNVQDALTGDSKSQQETRDGDIVRGSYSLVEPDGTLRTVFYTADPVNGF 98


>UniRef50_A0NCX3 Cluster: ENSANGP00000031409; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031409 - Anopheles gambiae
           str. PEST
          Length = 215

 Score = 72.5 bits (170), Expect = 6e-12
 Identities = 32/62 (51%), Positives = 43/62 (69%)
 Frame = +2

Query: 287 YEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQ 466
           Y +YDA+P+Y++ Y + D  TGD K+Q E+R GDVV G YSL E DG+ R VEY+A+   
Sbjct: 75  YAEYDANPQYSYSYAVADAVTGDNKNQQESRSGDVVTGSYSLVEPDGTRRTVEYNADPIN 134

Query: 467 WF 472
            F
Sbjct: 135 GF 136


>UniRef50_UPI00003C00E7 Cluster: PREDICTED: similar to CG7072-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG7072-PA
           - Apis mellifera
          Length = 203

 Score = 72.1 bits (169), Expect = 8e-12
 Identities = 33/60 (55%), Positives = 42/60 (70%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +Y A+P+Y+F Y + D +TGD KS  E RDGD VKG YS+ EADGSIR V Y+A+    F
Sbjct: 111 EYMAYPRYSFNYGVLDGYTGDSKSAWEERDGDTVKGEYSVVEADGSIRTVTYTADDHNGF 170


>UniRef50_Q16UU5 Cluster: Cuticle protein, putative; n=1; Aedes
           aegypti|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 254

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 31/61 (50%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           ++YD +P+Y++ Y I D  TGD K QHE+R+GD V+G YSL +ADG  R VEY+A+    
Sbjct: 66  DEYDPNPQYSYSYGISDAVTGDQKEQHESRNGDAVQGSYSLVDADGFKRTVEYTADPIHG 125

Query: 470 F 472
           F
Sbjct: 126 F 126


>UniRef50_Q7QDL7 Cluster: ENSANGP00000026489; n=3;
           Endopterygota|Rep: ENSANGP00000026489 - Anopheles
           gambiae str. PEST
          Length = 148

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 32/64 (50%), Positives = 39/64 (60%)
 Frame = +2

Query: 281 PQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           P  E YD +P Y+F Y + DPHTGD K   ET    VV G YSL E DG+IR V Y+A++
Sbjct: 49  PHVEAYDPNPHYSFSYGVSDPHTGDSKHAEETLSNGVVHGSYSLTEPDGTIRKVTYTADK 108

Query: 461 AQWF 472
              F
Sbjct: 109 IHGF 112


>UniRef50_O77057 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 197

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +2

Query: 257 APVHHGDQPQY---EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADG 427
           AP+ H     Y    D  AHPK  + Y + DPHTG  KSQHE RDG  V G YSL E DG
Sbjct: 72  APIVHAASLGYAHGHDTYAHPKNDYAYSVADPHTGGHKSQHENRDGGAVHGSYSLVEPDG 131

Query: 428 SIRVVEYSAEQAQWF 472
           S+R V+ +A+    F
Sbjct: 132 SVRKVDNTADDHHGF 146



 Score = 39.5 bits (88), Expect = 0.054
 Identities = 23/45 (51%), Positives = 28/45 (62%)
 Frame = +3

Query: 111 AVSSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVH 245
           AVSSQSI+RHD    +     S H  P  AH+ AP +HAAP L+H
Sbjct: 27  AVSSQSIVRHDAPAHYA----SAHYAP--AHYAAPIVHAAP-LIH 64


>UniRef50_UPI0000D5727F Cluster: PREDICTED: similar to CG9290-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9290-PA - Tribolium castaneum
          Length = 127

 Score = 70.1 bits (164), Expect = 3e-11
 Identities = 31/47 (65%), Positives = 36/47 (76%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           Y FEY + DPHTGD KSQ+E RDG  VKG Y+L EADG+ R+VEY A
Sbjct: 30  YKFEYGVHDPHTGDKKSQYEHRDGKHVKGGYTLKEADGTTRIVEYHA 76


>UniRef50_Q9V3P9 Cluster: CG3474-PA; n=6; Diptera|Rep: CG3474-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 218

 Score = 70.1 bits (164), Expect = 3e-11
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query: 266 HHGDQPQYEDY-DAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           HH D   ++D+ D+H +Y F+Y ++D  TGD+KSQ E+R G  V G+Y L +ADG  R V
Sbjct: 55  HHHDHHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTV 114

Query: 443 EYSAEQAQWF 472
            Y+A++ + F
Sbjct: 115 HYTADKHKGF 124


>UniRef50_P80681 Cluster: Larval cuticle protein A1A; n=6;
           Endopterygota|Rep: Larval cuticle protein A1A - Tenebrio
           molitor (Yellow mealworm)
          Length = 174

 Score = 69.7 bits (163), Expect = 4e-11
 Identities = 33/72 (45%), Positives = 47/72 (65%)
 Frame = +2

Query: 257 APVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           APV        ++YD +P+Y+F Y ++D  TGD K+Q E+R GDVV+G YSL + DG+ R
Sbjct: 68  APVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRR 127

Query: 437 VVEYSAEQAQWF 472
            VEY+A+    F
Sbjct: 128 TVEYTADPINGF 139


>UniRef50_Q45V98 Cluster: RR2 cuticle protein 2; n=1; Myzus
           persicae|Rep: RR2 cuticle protein 2 - Myzus persicae
           (Peach-potato aphid)
          Length = 228

 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 31/59 (52%), Positives = 39/59 (66%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +   P Y F Y+++D  TGD KSQ ETR GDVVKG YSL E DG+ R V+Y+A+    F
Sbjct: 109 FQPDPSYTFAYQVQDQITGDSKSQEETRQGDVVKGRYSLIEPDGTRRTVDYTADPTNGF 167


>UniRef50_Q4V5H9 Cluster: IP07124p; n=3; Sophophora|Rep: IP07124p -
           Drosophila melanogaster (Fruit fly)
          Length = 202

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 34/72 (47%), Positives = 42/72 (58%)
 Frame = +2

Query: 257 APVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           APV        E YD +P+Y+F Y + D HTGD K Q ET    VV G YSL E DG+IR
Sbjct: 87  APVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIR 146

Query: 437 VVEYSAEQAQWF 472
            V Y+A++   F
Sbjct: 147 KVTYTADKVNGF 158


>UniRef50_A0NCX5 Cluster: ENSANGP00000000739; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000000739 - Anopheles gambiae
           str. PEST
          Length = 224

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 31/61 (50%), Positives = 38/61 (62%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD +P Y+F Y + DPHTGD K   ET    VV G YSL E DG+IR V Y+A++   
Sbjct: 53  EAYDPNPHYSFSYGVSDPHTGDSKHAEETLSNGVVHGSYSLTEPDGTIRKVTYTADKIHG 112

Query: 470 F 472
           F
Sbjct: 113 F 113


>UniRef50_UPI00015B59E6 Cluster: PREDICTED: similar to LP12967p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           LP12967p - Nasonia vitripennis
          Length = 204

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/60 (48%), Positives = 41/60 (68%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++  +PKY++ Y + D +TGD K+  E RDGD V+G YS+ EADGSIR V Y+A+    F
Sbjct: 107 EFAIYPKYSYNYGVVDGNTGDTKAAWEERDGDTVRGEYSVMEADGSIRTVTYTADDKNGF 166


>UniRef50_UPI0000D555C5 Cluster: PREDICTED: similar to CG2342-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2342-PA - Tribolium castaneum
          Length = 232

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/56 (51%), Positives = 42/56 (75%)
 Frame = +2

Query: 305 HPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +P+Y F Y + DP TGD+KSQ E+R GD+V+G YSL ++DG+ RVV+Y+A+    F
Sbjct: 19  NPQYTFGYGVSDPLTGDVKSQVESRSGDIVQGQYSLLDSDGTRRVVDYAADGINGF 74


>UniRef50_UPI00015B60F5 Cluster: PREDICTED: similar to pupal cuticle
           protein, putative; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to pupal cuticle protein, putative -
           Nasonia vitripennis
          Length = 147

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 29/55 (52%), Positives = 36/55 (65%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           DY AHPKY F Y +ED HTGD   Q E RDG  V G Y++ E  G++R V+Y A+
Sbjct: 54  DYVAHPKYEFAYGVEDHHTGDYHGQKEHRDGKHVTGEYTIKEPGGNVRTVKYHAD 108


>UniRef50_Q45V97 Cluster: RR2 cuticle protein 3; n=1; Myzus
           persicae|Rep: RR2 cuticle protein 3 - Myzus persicae
           (Peach-potato aphid)
          Length = 205

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 32/57 (56%), Positives = 38/57 (66%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           E Y   P Y FEY + D HT  +KSQ E  DG  VKGYY+L EADGS R VEY+A++
Sbjct: 69  ESYAPRP-YKFEYSVNDEHTYGIKSQKEESDGHQVKGYYTLLEADGSRRTVEYTADE 124


>UniRef50_Q16IY2 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 178

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 4/71 (5%)
 Frame = +2

Query: 272 GDQPQYEDYD----AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRV 439
           G + Q E+ D    A P Y++ Y + D  +GD KSQHE+R GD V+G Y + E+DG+ R+
Sbjct: 34  GWEQQREEVDDSQHAEPNYSYSYVVRDDKSGDRKSQHESRQGDQVRGQYRMMESDGTERI 93

Query: 440 VEYSAEQAQWF 472
           V+YSA+    F
Sbjct: 94  VDYSADDRNGF 104


>UniRef50_UPI0000D57280 Cluster: PREDICTED: similar to CG9290-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9290-PA - Tribolium castaneum
          Length = 422

 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 31/59 (52%), Positives = 39/59 (66%)
 Frame = +2

Query: 281 PQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           P Y++Y     Y F Y + DPHTGD KSQ E ++  VV+G YSL E DG+ RVVEY A+
Sbjct: 31  PTYDNYKPRD-YHFSYAVSDPHTGDHKSQWEVKENGVVRGAYSLLEPDGTTRVVEYVAD 88


>UniRef50_Q9VSH5 Cluster: CG13670-PA; n=2; Sophophora|Rep:
           CG13670-PA - Drosophila melanogaster (Fruit fly)
          Length = 266

 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 29/60 (48%), Positives = 44/60 (73%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY A P+Y+F Y +ED  T  L+++ ETR+GD V+G YS+ + DG++RVV+Y+A+ A  F
Sbjct: 96  DYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGF 155


>UniRef50_UPI00015B6123 Cluster: PREDICTED: similar to GA20083-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           GA20083-PA - Nasonia vitripennis
          Length = 161

 Score = 66.1 bits (154), Expect = 5e-10
 Identities = 29/59 (49%), Positives = 38/59 (64%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           Q++DY A   Y F Y +ED HTGD   Q E RDG  V G Y++ E DG+IR V+Y A++
Sbjct: 78  QHQDYAAPAHYEFAYGVEDHHTGDYHGQKEHRDGKAVAGEYTVKEPDGNIRTVKYHADE 136


>UniRef50_Q17C20 Cluster: Pupal cuticle protein, putative; n=8;
           Culicidae|Rep: Pupal cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 244

 Score = 66.1 bits (154), Expect = 5e-10
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +2

Query: 299 DAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           D   +Y F+Y + D  TGD+KSQ E R GD VKG Y+L +ADG  R+VEY+A++   F
Sbjct: 63  DTPAEYQFQYSVHDEQTGDIKSQQEERHGDNVKGVYTLIDADGFRRIVEYTADEHSGF 120


>UniRef50_O97062 Cluster: CG1330-PA; n=9; Endopterygota|Rep:
           CG1330-PA - Drosophila melanogaster (Fruit fly)
          Length = 208

 Score = 66.1 bits (154), Expect = 5e-10
 Identities = 29/63 (46%), Positives = 40/63 (63%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           + E+ D HP+Y + Y ++D  +GD K   E RDGDVV+G YSL +ADG  R V Y+A+  
Sbjct: 41  ELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSI 100

Query: 464 QWF 472
             F
Sbjct: 101 NGF 103


>UniRef50_A0NG24 Cluster: ENSANGP00000030674; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030674 - Anopheles gambiae
           str. PEST
          Length = 187

 Score = 65.7 bits (153), Expect = 7e-10
 Identities = 31/61 (50%), Positives = 40/61 (65%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           ED+DA  +Y F Y + D HTGD+K Q E+R GD V G YSL ++DG  R VEY+A+    
Sbjct: 68  EDHDA--QYDFSYGVHDDHTGDIKEQRESRHGDQVHGQYSLIDSDGHKRTVEYTADDHNG 125

Query: 470 F 472
           F
Sbjct: 126 F 126


>UniRef50_P26967 Cluster: Adult-specific cuticular protein ACP-20
           precursor; n=4; Tenebrionidae|Rep: Adult-specific
           cuticular protein ACP-20 precursor - Tenebrio molitor
           (Yellow mealworm)
          Length = 208

 Score = 65.3 bits (152), Expect = 9e-10
 Identities = 30/53 (56%), Positives = 37/53 (69%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           Y F+Y +ED  TGD K Q E R GDVVKG YSL E DG++RVV+Y+A+    F
Sbjct: 67  YQFKYGVEDHRTGDRKQQAEVRVGDVVKGEYSLAEPDGTVRVVKYTADDHNGF 119


>UniRef50_UPI0000DB73EB Cluster: PREDICTED: similar to CG7076-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG7076-PA
           - Apis mellifera
          Length = 117

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 30/60 (50%), Positives = 37/60 (61%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY AHP Y F Y +ED HTGD   Q E RDG  V G Y++ E  G+IR V+Y A +  +F
Sbjct: 41  DYVAHPHYEFSYGVEDHHTGDYHGQKEHRDGKDVVGEYTIKEPGGNIRTVKYRAGKNGFF 100


>UniRef50_Q16R84 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 158

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 30/57 (52%), Positives = 37/57 (64%)
 Frame = +2

Query: 302 AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           A+P+Y F Y   DP TGD K Q E R GD V+G Y L EADG+ R+VEY ++  Q F
Sbjct: 66  AYPEYEFAYGARDPKTGDHKDQWEKRVGDHVQGIYVLEEADGTKRIVEYESDDKQGF 122


>UniRef50_UPI00015B43DE Cluster: PREDICTED: similar to
           ENSANGP00000031410; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000031410 - Nasonia
           vitripennis
          Length = 133

 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 30/61 (49%), Positives = 39/61 (63%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E  D+ P Y+F Y ++D  TGD K+  ETR GDVV+G YSL E DG+ R V Y+A+    
Sbjct: 40  EPLDSQPNYSFNYHVDDGLTGDNKAHKETRYGDVVQGSYSLIEPDGTRRTVAYTADPING 99

Query: 470 F 472
           F
Sbjct: 100 F 100


>UniRef50_UPI0000D55C02 Cluster: PREDICTED: similar to CG1919-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 116

 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 30/62 (48%), Positives = 36/62 (58%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H    +Y DY A P+Y ++Y + D HT D   Q E RDG  VKG YSL + DG  R VEY
Sbjct: 27  HHHLEEYIDYRARPRYHYDYNVHDHHTHDFHHQWEHRDGKEVKGEYSLIQPDGRRRTVEY 86

Query: 449 SA 454
            A
Sbjct: 87  RA 88


>UniRef50_Q7QD80 Cluster: ENSANGP00000018253; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000018253 - Anopheles gambiae
           str. PEST
          Length = 200

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 28/68 (41%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H D+ +  DYD    Y++ Y + D  +GD+KSQ E R+GD V+G Y   E+DG+ R+V+Y
Sbjct: 77  HQDRRESSDYD-RDDYSYGYAVRDELSGDIKSQQEVRNGDRVRGQYRTLESDGTERIVDY 135

Query: 449 SAEQAQWF 472
           +A+  + F
Sbjct: 136 TADDVRGF 143


>UniRef50_Q8IPD8 Cluster: CG31876-PA; n=2; Sophophora|Rep:
           CG31876-PA - Drosophila melanogaster (Fruit fly)
          Length = 146

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 27/60 (45%), Positives = 40/60 (66%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           + +A   Y F Y + D HTGD+KSQ E+R GD V+G Y+L +ADG +R V+Y+++    F
Sbjct: 38  EVEAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGF 97


>UniRef50_Q5TWH8 Cluster: ENSANGP00000029291; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029291 - Anopheles gambiae
           str. PEST
          Length = 141

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +2

Query: 308 PKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           P+Y F Y ++DP TGD K + E RDGD V+G Y L E DG+ R+VEY A+    F
Sbjct: 56  PRYEFAYGVKDPITGDHKDRWEKRDGDRVQGVYMLEEPDGTQRIVEYEADGVHGF 110


>UniRef50_Q5TWH9 Cluster: ENSANGP00000027540; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000027540 - Anopheles gambiae
           str. PEST
          Length = 247

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 29/59 (49%), Positives = 37/59 (62%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           ++  P Y F Y + DP TGD K Q E R GD VKG Y+L + DG+ RVVEY+A+    F
Sbjct: 151 FNDFPLYEFSYGVHDPATGDKKEQWEKRVGDHVKGKYTLDQPDGTKRVVEYAADDRNGF 209


>UniRef50_Q16UT8 Cluster: Cuticle protein, putative; n=6;
           Endopterygota|Rep: Cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 298

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 28/55 (50%), Positives = 38/55 (69%)
 Frame = +2

Query: 308 PKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           P+Y+F Y + D  TGD KSQ E+R GDVV+G YSL ++DG  R V+Y+A+    F
Sbjct: 53  PQYSFSYGVSDGLTGDQKSQQESRSGDVVQGSYSLVDSDGLKRTVDYTADPINGF 107


>UniRef50_Q9VQH5 Cluster: CG2973-PA; n=1; Drosophila
           melanogaster|Rep: CG2973-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 302

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +2

Query: 284 QYEDYDAHP--KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Q+++ +  P   Y+F Y + D  TGD+K   ETRDG VV+G+YSL + DG  R V Y+A+
Sbjct: 145 QHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTAD 204

Query: 458 QAQWF 472
               F
Sbjct: 205 DVHGF 209


>UniRef50_Q9VLB1 Cluster: CG3818-PA; n=1; Drosophila
           melanogaster|Rep: CG3818-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 153

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 25/53 (47%), Positives = 36/53 (67%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           Y F++ + DPHTGD+KSQ E+R  D V+G Y L ++DG  R+V+Y A+    F
Sbjct: 33  YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGF 85


>UniRef50_Q29KF3 Cluster: GA15548-PA; n=1; Drosophila
           pseudoobscura|Rep: GA15548-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 260

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +2

Query: 284 QYEDYDAHP--KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Q+++ +  P   Y+F Y + D  TGD+K   ETRDG VV+G+YSL + DG  R V Y+A+
Sbjct: 113 QHQEPEVFPPASYSFNYAVNDESTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTAD 172

Query: 458 QAQWF 472
               F
Sbjct: 173 DVHGF 177


>UniRef50_UPI0000D5763B Cluster: PREDICTED: similar to CG9299-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9299-PA - Tribolium castaneum
          Length = 185

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 30/67 (44%), Positives = 38/67 (56%)
 Frame = +2

Query: 272 GDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYS 451
           G+ P  +   A   Y FEY + D  TGD+K Q E R GD V G YSL E DG++R V+Y 
Sbjct: 107 GEPPSVQT-GAPAHYKFEYSVNDHKTGDVKHQKEERKGDAVNGEYSLLEEDGNVRTVKYF 165

Query: 452 AEQAQWF 472
           A+    F
Sbjct: 166 ADWKSGF 172


>UniRef50_A0NBM7 Cluster: ENSANGP00000029830; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029830 - Anopheles gambiae
           str. PEST
          Length = 168

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 28/61 (45%), Positives = 37/61 (60%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+  + P Y F Y ++DP +GD K Q E R GD VKG Y   E+DG+ R+VEY A   + 
Sbjct: 67  EEKSSGPSYEFGYGVKDPISGDHKDQWEKRQGDHVKGAYRFDESDGTQRIVEYEASGKKG 126

Query: 470 F 472
           F
Sbjct: 127 F 127


>UniRef50_Q8IPD5 Cluster: CG33302-PA; n=1; Drosophila
           melanogaster|Rep: CG33302-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 340

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 28/60 (46%), Positives = 38/60 (63%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           + ++ P+Y F Y + D  TGD+KSQ ETRDG  V G YS+ +ADG  R V Y+A+    F
Sbjct: 128 ELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGF 187


>UniRef50_Q7Q0W7 Cluster: ENSANGP00000019229; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000019229 - Anopheles gambiae
           str. PEST
          Length = 180

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 25/54 (46%), Positives = 37/54 (68%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +Y F+Y + D  +GD+K Q E R GD V G YSL++ADG  RVV+Y++++   F
Sbjct: 35  EYHFKYSVHDDRSGDIKHQQEERHGDKVTGQYSLNDADGYRRVVDYTSDKDTGF 88


>UniRef50_P26968 Cluster: Adult-specific cuticular protein ACP-22
           precursor; n=2; Tenebrionidae|Rep: Adult-specific
           cuticular protein ACP-22 precursor - Tenebrio molitor
           (Yellow mealworm)
          Length = 199

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query: 263 VHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEAD-GSIRV 439
           VHH +    +   AHP+Y  +Y + D  T D KS+HE RDG  VKG YSL E D  ++RV
Sbjct: 122 VHHEEAIHLK---AHPEYHSDYHVADHKTKDFKSKHEVRDGYKVKGTYSLLEPDHKTVRV 178

Query: 440 VEYSAEQAQWF 472
           V+Y +++ + F
Sbjct: 179 VDYVSDKKRGF 189


>UniRef50_Q17C05 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 140

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 25/60 (41%), Positives = 35/60 (58%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H +Q   E++ A   Y + Y + D HTGD+  Q E+R+GD  +G Y L +ADG  R V Y
Sbjct: 69  HNNQHHEEEHHAPAHYQYHYGVHDEHTGDVHGQQESREGDKTEGEYYLIDADGHKRTVTY 128


>UniRef50_Q16JC2 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 122

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (1%)
 Frame = +2

Query: 305 HP-KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           HP +Y FEY ++D  TGD K+Q E R+G  VKG Y+L ++DG  R+VEY ++
Sbjct: 30  HPAQYKFEYGVKDELTGDHKTQWEQREGKHVKGQYTLEDSDGGHRLVEYESD 81


>UniRef50_UPI00015B5FE9 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 196

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 25/66 (37%), Positives = 41/66 (62%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVE 445
           HH  Q   E++    KY F Y+++D ++G+  S  E+RDG + +G YS+   DG  ++VE
Sbjct: 102 HHHYQRHQEEHHEPAKYNFAYQVKDSNSGNDYSHQESRDGSLTRGSYSVLLPDGRRQIVE 161

Query: 446 YSAEQA 463
           Y A++A
Sbjct: 162 YEADEA 167


>UniRef50_P45590 Cluster: Larval/pupal rigid cuticle protein 66
           precursor; n=1; Hyalophora cecropia|Rep: Larval/pupal
           rigid cuticle protein 66 precursor - Hyalophora cecropia
           (Cecropia moth)
          Length = 129

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 26/46 (56%), Positives = 34/46 (73%)
 Frame = +2

Query: 317 AFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           +F Y + DP TGD KSQ E+R GD V+G YSL E+DG+ R V+Y+A
Sbjct: 22  SFSYGVADPSTGDFKSQIESRLGDNVQGQYSLLESDGTQRTVDYAA 67


>UniRef50_Q29NE6 Cluster: GA16544-PA; n=1; Drosophila
           pseudoobscura|Rep: GA16544-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 89

 Score = 56.4 bits (130), Expect = 4e-07
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 308 PKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           P+Y F Y + D  TGD+K Q E R G+ V G YSL E DG  R+V+Y+++
Sbjct: 20  PQYEFHYAVHDSETGDVKDQFEHRRGEYVTGRYSLIEPDGHRRIVDYTSD 69


>UniRef50_Q8IPE0 Cluster: CG31878-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG31878-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 106

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           +Y F Y + D H+GD+K Q E R G+ V G YSL + DG  R+V+Y+A+
Sbjct: 41  QYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTAD 89


>UniRef50_Q8IPD9 Cluster: CG31878-PA, isoform A; n=1; Drosophila
           melanogaster|Rep: CG31878-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 146

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           +Y F Y + D H+GD+K Q E R G+ V G YSL + DG  R+V+Y+A+
Sbjct: 81  QYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTAD 129


>UniRef50_Q175B1 Cluster: Adult cuticle protein, putative; n=2;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 181

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 24/53 (45%), Positives = 33/53 (62%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           Y F Y ++DP TGD K Q E      VKG Y + E+DG++R+VEY A+  + F
Sbjct: 93  YEFGYGVKDPKTGDSKDQWEKSVEGKVKGVYKVAESDGTLRIVEYEADDKKGF 145


>UniRef50_Q170Z6 Cluster: Pupal cuticle protein, putative; n=2;
           Culicidae|Rep: Pupal cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 248

 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY A P Y FEY +EDP +   +++ E R  D + G Y++ + DG +RVV+Y+A +   F
Sbjct: 122 DYVAKPDYQFEYGVEDPKSKVSQNRKEHRHEDELHGEYTVQQPDGKLRVVKYTANKHSGF 181


>UniRef50_Q9VSN3 Cluster: CG32029-PA; n=4; Diptera|Rep: CG32029-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 270

 Score = 52.8 bits (121), Expect = 5e-06
 Identities = 24/66 (36%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +2

Query: 278 QPQYEDYD-AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           Q + E+YD  +  Y F + ++D    + +++ E RDG V+KG YS+ ++DG IR V+Y+A
Sbjct: 145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTA 204

Query: 455 EQAQWF 472
           +  + F
Sbjct: 205 DPKEGF 210


>UniRef50_Q9NDT7 Cluster: BCS-1; n=2; Balanus amphitrite|Rep: BCS-1
           - Balanus amphitrite (Barnacle)
          Length = 156

 Score = 52.4 bits (120), Expect = 7e-06
 Identities = 22/48 (45%), Positives = 30/48 (62%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Y FEY ++D  +G+   Q ETRDGD   G Y +  ADG +++V YS E
Sbjct: 72  YNFEYAVQDDESGNNFGQQETRDGDATSGSYYVQMADGRMQIVNYSVE 119


>UniRef50_A0NG23 Cluster: ENSANGP00000030675; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030675 - Anopheles gambiae
           str. PEST
          Length = 357

 Score = 52.4 bits (120), Expect = 7e-06
 Identities = 25/62 (40%), Positives = 34/62 (54%)
 Frame = +2

Query: 287 YEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQ 466
           ++  D    Y F Y + DP TGD KSQ E+R    V+G YS  +ADG  ++V Y A+   
Sbjct: 79  HDQSDEQVGYDFSYSVHDPVTGDQKSQEESRRNGHVRGQYSWVDADGIRQIVNYRADDRT 138

Query: 467 WF 472
            F
Sbjct: 139 GF 140


>UniRef50_A0NG12 Cluster: ENSANGP00000029772; n=13; Culicidae|Rep:
           ENSANGP00000029772 - Anopheles gambiae str. PEST
          Length = 161

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 8/81 (9%)
 Frame = +2

Query: 254 NAPVHHGDQPQYEDYDAHPK--------YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYS 409
           +A  H+G Q  Y+    H +        Y + Y + D HTGD+  Q E R  D  +G Y 
Sbjct: 45  SAQSHYGHQQHYQPQHYHHEEEHHGPVHYEYNYDVHDDHTGDVHGQKEARKDDSTQGEYY 104

Query: 410 LHEADGSIRVVEYSAEQAQWF 472
           L +ADG  R V Y  E    F
Sbjct: 105 LIDADGHKRTVTYHVEGKSGF 125


>UniRef50_UPI00015B5FE7 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 199

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           KY FEY + DP +G+     E+RDGD+ +G Y +   DG  ++VEY A+Q
Sbjct: 88  KYEFEYTVNDPPSGNDFGHKESRDGDLTRGVYFVLLPDGRRQMVEYEADQ 137


>UniRef50_Q16X55 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 119

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 24/59 (40%), Positives = 32/59 (54%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +   P+Y F Y++    TGD K   E RDGD V G Y L E DG+ R V+Y + +   F
Sbjct: 35  HGVRPRYKFNYRVVSTKTGDNKGYWEHRDGDRVVGAYMLREPDGTHREVKYRSAKGIGF 93


>UniRef50_A1YLE4 Cluster: Cuticle protein CB6; n=1; Portunus
           pelagicus|Rep: Cuticle protein CB6 - Portunus pelagicus
           (Blue swimmer crab)
          Length = 220

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 4/65 (6%)
 Frame = +2

Query: 275 DQPQYEDYDAHP----KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           D   YE Y+++     KY FE+ +ED  TG+     E RDGD  +G YS+  +DG  + V
Sbjct: 83  DSDSYESYESYESSEAKYEFEWSVEDASTGNDFDHKEARDGDHTQGVYSVQLSDGRKQTV 142

Query: 443 EYSAE 457
            Y  E
Sbjct: 143 NYVVE 147


>UniRef50_UPI0000D55A42 Cluster: PREDICTED: similar to CG32029-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG32029-PA - Tribolium castaneum
          Length = 323

 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +2

Query: 272 GDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYS 451
           G+Q   E+YD +P Y F + + D    + +++ E R+G  + G YS+ + DG +R V Y 
Sbjct: 202 GEQQNPEEYDPNPSYQFGFDVNDDLYTNYQNRKEQREGGKITGSYSVVDPDGFVRTVTYH 261

Query: 452 AEQAQWF 472
            +  + F
Sbjct: 262 TDPKEGF 268


>UniRef50_Q175B0 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 334

 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 25/67 (37%), Positives = 33/67 (49%)
 Frame = +2

Query: 254 NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI 433
           N     GD  +  +      Y + Y + DP TGD K   E R GD V+G Y L + DG  
Sbjct: 227 NQEAPRGDSQENTESKGIADYEYTYGVNDPATGDHKDHWEKRVGDHVEGGYILEQPDGKR 286

Query: 434 RVVEYSA 454
           RVV+Y +
Sbjct: 287 RVVKYES 293


>UniRef50_Q7PSL5 Cluster: ENSANGP00000017262; n=2; Culicidae|Rep:
           ENSANGP00000017262 - Anopheles gambiae str. PEST
          Length = 193

 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQH-ETRDGDVVKGYYSLHEADGSIRVVE 445
           H D   + D     KY F Y++++ HT DL   H E RDGD   G Y++   DG  ++VE
Sbjct: 29  HEDHHDHHDNHDETKYEFSYEVDEEHT-DLSFGHEEMRDGDYTTGKYNVLLPDGRRQIVE 87

Query: 446 YSAE 457
           Y A+
Sbjct: 88  YEAD 91


>UniRef50_UPI00015B5FE4 Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG6305-PA - Nasonia vitripennis
          Length = 250

 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 4/68 (5%)
 Frame = +2

Query: 266 HHGD--QPQYEDY-DAHPK-YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI 433
           HHG     +++DY D  PK Y F Y ++D  +G+   + ET DG+ V+G Y +   DG  
Sbjct: 68  HHGGGGHDEHQDYIDNQPKSYEFGYAVKDAASGNDFGRRETSDGETVRGEYRVQLPDGRT 127

Query: 434 RVVEYSAE 457
           ++V Y+A+
Sbjct: 128 QIVTYTAD 135


>UniRef50_Q29D07 Cluster: GA16621-PA; n=1; Drosophila
           pseudoobscura|Rep: GA16621-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 216

 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           Y F + ++D    + +++ E RDG V+KG YS+ ++DG IR V+Y+A+  + F
Sbjct: 127 YQFGFDVKDDEFTNYQNRKEVRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGF 179


>UniRef50_Q9V7U0 Cluster: Pro-resilin precursor; n=2; Drosophila
           melanogaster|Rep: Pro-resilin precursor - Drosophila
           melanogaster (Fruit fly)
          Length = 620

 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = +2

Query: 272 GDQPQYEDYDAHP--KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVE 445
           G  P   DYD     KY F Y++ED  +G      E RDGD   G Y++   DG  ++VE
Sbjct: 329 GSGPGGADYDNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVE 388

Query: 446 YSAEQ 460
           Y A+Q
Sbjct: 389 YEADQ 393


>UniRef50_Q7QGL7 Cluster: ENSANGP00000018947; n=2; Culicidae|Rep:
           ENSANGP00000018947 - Anopheles gambiae str. PEST
          Length = 181

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +2

Query: 287 YEDYDAHP-KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           YED +  P KY+FEY ++D  +G+     E+RDGD   G Y +   DG  +VV Y A+Q
Sbjct: 88  YEDANVQPAKYSFEYNVQDFTSGNDFGHMESRDGDRTVGRYFVLLPDGRKQVVNYEADQ 146


>UniRef50_Q16XU9 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 887

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/65 (35%), Positives = 36/65 (55%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVE 445
           HH +    ED+D    YAF Y++ D HTG+     + RD  V +G Y +   DG ++ V 
Sbjct: 789 HHDEYS--EDHDDKEGYAFGYRVRDFHTGNDFGHIQNRDNGVTRGEYHILLPDGRVQNVR 846

Query: 446 YSAEQ 460
           Y+A++
Sbjct: 847 YTADE 851


>UniRef50_UPI0000DB728C Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG6305-PA
           - Apis mellifera
          Length = 299

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 19/53 (35%), Positives = 35/53 (66%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           Y+F+Y++ DP +G+  SQ E+ DG++V+G Y +   D   ++V+Y A+ A  +
Sbjct: 182 YSFQYEVYDPPSGNDYSQRESSDGNIVQGEYRVLLPDSRTQIVKYMADDANGY 234


>UniRef50_Q7K2P1 Cluster: GH20904p; n=3; Diptera|Rep: GH20904p -
           Drosophila melanogaster (Fruit fly)
          Length = 178

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 25/71 (35%), Positives = 37/71 (52%)
 Frame = +2

Query: 245 SP*NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEAD 424
           +P N P   GD   +      P Y FEY ++DP T +  +   + DGDVV G Y +   D
Sbjct: 70  TPRNIPGQPGDD--HVHVPGMP-YDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPD 126

Query: 425 GSIRVVEYSAE 457
           G  ++V Y+A+
Sbjct: 127 GRTQIVRYTAD 137


>UniRef50_UPI00015B5FE6 Cluster: PREDICTED: similar to CG15920-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG15920-PA - Nasonia vitripennis
          Length = 752

 Score = 45.6 bits (103), Expect = 8e-04
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           E  D   KY F Y+++D  +G      E RDGD  +G +++   DG  ++VEY A+Q
Sbjct: 523 EGNDEPAKYEFSYEVKDDQSGSNFGHTEMRDGDRAQGEFNVLLPDGRKQIVEYEADQ 579


>UniRef50_UPI0000D55C1A Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG6305-PA - Tribolium castaneum
          Length = 180

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/63 (30%), Positives = 35/63 (55%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           HG    + D+     Y F Y+++D ++G+  ++ E  DG+ V+G Y +   DG  ++V Y
Sbjct: 50  HGGHGDHGDHGEPKAYEFGYQVKDEYSGNNYNRKEASDGNQVRGEYRVQLPDGRTQIVTY 109

Query: 449 SAE 457
            A+
Sbjct: 110 YAD 112


>UniRef50_Q7JZJ3 Cluster: RE26879p; n=5; Endopterygota|Rep: RE26879p
           - Drosophila melanogaster (Fruit fly)
          Length = 217

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           KY F+Y ++D  +G+     E+RDGD+  G Y +   DG  ++VEY A+Q
Sbjct: 127 KYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ 176


>UniRef50_UPI000051AB43 Cluster: PREDICTED: similar to CG15920-PA,
           isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG15920-PA, isoform A - Apis mellifera
          Length = 492

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +2

Query: 290 EDYDAHP-KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           +D +  P KY F Y+++D  +G      E+RDGD  +G +++   DG  ++VEY A+Q
Sbjct: 336 QDENNEPAKYEFSYEVKDEQSGADYGHTESRDGDRAQGEFNVLLPDGRKQIVEYEADQ 393


>UniRef50_A0NEQ9 Cluster: ENSANGP00000029837; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029837 - Anopheles gambiae
           str. PEST
          Length = 493

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%)
 Frame = +2

Query: 275 DQPQYEDYDAHPK--YAFEYKIEDPHTGDLKSQHETR-DGDVVKGYYSLHEADGSIRVVE 445
           D P Y   D +    YAF Y+IEDP TG+++ + E +     V+G Y   + DGS+ +  
Sbjct: 80  DSPMYNFIDPYGPGTYAFGYEIEDPQTGNVQFRDEEKLKNGTVRGSYGYMQPDGSVIITS 139

Query: 446 YSAEQ 460
           + A++
Sbjct: 140 FVADE 144


>UniRef50_UPI0000D5780C Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG6305-PA - Tribolium castaneum
          Length = 232

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 20/53 (37%), Positives = 30/53 (56%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           + F Y ++D H G+  S +   DGD  KG Y +   DG  +VV+Y+A+ A  F
Sbjct: 6   FDFSYAVKDDHYGNDYSHNAISDGDQTKGEYRIQLPDGRTQVVKYTADWATGF 58


>UniRef50_A7TZ21 Cluster: BCS-1-like protein; n=1; Lepeophtheirus
           salmonis|Rep: BCS-1-like protein - Lepeophtheirus
           salmonis (salmon louse)
          Length = 149

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 20/50 (40%), Positives = 27/50 (54%)
 Frame = +2

Query: 308 PKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           P YAF Y + D  +G+  S  E  +G +V G Y +  ADG I  V Y+ E
Sbjct: 59  PPYAFNYAVLDAESGNDFSAEEQAEGGIVSGEYKVKLADGKIMTVSYTVE 108


>UniRef50_UPI00015B5FE8 Cluster: PREDICTED: similar to RE26879p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           RE26879p - Nasonia vitripennis
          Length = 421

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 23/69 (33%), Positives = 33/69 (47%)
 Frame = +2

Query: 254 NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI 433
           NA   +G   + E      KY FEY++ D    D     E+RDG    G YS+   DG  
Sbjct: 309 NAGYQYGAAARSEQTTEPAKYEFEYRVSDEFGNDF-GHKESRDGAQTSGVYSVLLPDGRK 367

Query: 434 RVVEYSAEQ 460
           ++V Y A++
Sbjct: 368 QIVHYEADE 376


>UniRef50_Q16X58 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 131

 Score = 43.2 bits (97), Expect = 0.004
 Identities = 21/48 (43%), Positives = 24/48 (50%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           YAF Y I+ P TG      E R GD V G Y + E  G +R V Y  E
Sbjct: 37  YAFRYYIDHPQTGVSLDHWENRRGDYVHGGYGVLEPGGYVRTVHYEVE 84


>UniRef50_Q16PW7 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 405

 Score = 41.1 bits (92), Expect = 0.018
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETR-DGDVVKGYYSLHEADGSIRVVEYSAE 457
           YAF Y+IEDP TG+++ + E +     V+G Y   + DGS+ +  + A+
Sbjct: 103 YAFGYEIEDPQTGNVQFRDEEKLQNGTVRGSYGYMQPDGSVIITRFLAD 151


>UniRef50_UPI0000DB7324 Cluster: PREDICTED: similar to CG6305-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG6305-PA -
           Apis mellifera
          Length = 194

 Score = 39.1 bits (87), Expect = 0.071
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           + F Y +++   G+  S +   DGD+V+G Y +   DG +++V Y+A+    F
Sbjct: 125 FDFNYAVKEDAFGNDYSHNAISDGDIVRGEYRVQLPDGRLQIVRYTADWKHGF 177


>UniRef50_A7TZ97 Cluster: BCS-1 protein; n=4; Lepeophtheirus
           salmonis|Rep: BCS-1 protein - Lepeophtheirus salmonis
           (salmon louse)
          Length = 134

 Score = 38.7 bits (86), Expect = 0.094
 Identities = 23/69 (33%), Positives = 32/69 (46%)
 Frame = +2

Query: 257 APVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           AP H    P Y++  A   Y ++Y + D + G      E RDG   +G YS+   DG I+
Sbjct: 17  APYHAA--PSYKEEPA--AYQYQYAVSDEYAGLNFGADEARDGYSTQGKYSVALPDGRIQ 72

Query: 437 VVEYSAEQA 463
            V Y    A
Sbjct: 73  TVNYDVADA 81


>UniRef50_A7TZC7 Cluster: BCS-1-like protein; n=4; Lepeophtheirus
           salmonis|Rep: BCS-1-like protein - Lepeophtheirus
           salmonis (salmon louse)
          Length = 124

 Score = 38.3 bits (85), Expect = 0.12
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 308 PKYAFEYKIEDPHTG-DLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           P YA+ Y + D  +G D  ++ E + G  V G Y +  ADG I  V Y+ E
Sbjct: 43  PPYAYNYAVLDAESGNDFSAEEEAKYG-AVSGQYKVLRADGKIMTVSYTVE 92


>UniRef50_A7L487 Cluster: Putative cuticle protein; n=1; Artemia
           franciscana|Rep: Putative cuticle protein - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 171

 Score = 37.9 bits (84), Expect = 0.16
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 5/71 (7%)
 Frame = +2

Query: 260 PVHHGDQPQYE-DY-DAHPK--YAFEYKIEDPHTGDLKSQHETRDGD-VVKGYYSLHEAD 424
           P + G +P Y+  Y + HP   Y F + ++D +T +  +  ET DG+  VKG Y     D
Sbjct: 42  PSYSGYKPDYKPSYKNDHPPMPYDFAWAVKDDYTYNDYNHQETSDGNGYVKGSYQTLLPD 101

Query: 425 GSIRVVEYSAE 457
           G ++ V Y+A+
Sbjct: 102 GRVQTVTYTAD 112


>UniRef50_Q9VV45 Cluster: CG12255-PA; n=2; Sophophora|Rep:
           CG12255-PA - Drosophila melanogaster (Fruit fly)
          Length = 217

 Score = 37.5 bits (83), Expect = 0.22
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGD-VVKGYYSLHEADGSIRVVEYSAE 457
           QY   D H +YA+ Y         L S+HETR  D V++G +S  +A+G  + V+Y A+
Sbjct: 35  QYHHQDEHGQYAYGY------MAPLYSKHETRTVDGVIRGTFSHIDANGETQTVDYVAD 87


>UniRef50_Q16XY8 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 462

 Score = 36.7 bits (81), Expect = 0.38
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGD-VVKGYYSLHEADGSIRVVEYSAE 457
           YAF Y ++D  +GD  S  + +  D  VKG Y +   DG +++V+Y A+
Sbjct: 160 YAFSYTVKDSASGDDFSHTQQQQVDGAVKGSYKVQLPDGRMQIVKYIAD 208


>UniRef50_Q16EK6 Cluster: Cuticle protein, putative; n=2;
           Culicidae|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 322

 Score = 36.7 bits (81), Expect = 0.38
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGD-VVKGYYSLHEADGSIRVVE 445
           H    QY+ +D    Y++ Y   DP++     +HET+D   V  G YS  + DG ++ V+
Sbjct: 30  HEVSSQYQAHDGIGGYSYGYA--DPNS----QKHETKDAHGVTHGGYSYVDGDGHVQTVK 83

Query: 446 YSAEQAQWF 472
           Y+A+    F
Sbjct: 84  YTADPIHGF 92


>UniRef50_Q9VV46 Cluster: CG4784-PA; n=1; Drosophila
           melanogaster|Rep: CG4784-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 429

 Score = 36.3 bits (80), Expect = 0.50
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 287 YEDYD-AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           Y++ D A   Y++ Y+ E+      ++++ +RDG   +G+YS  +ADG ++ V Y A   
Sbjct: 29  YQEQDTARAFYSYGYRDENA----ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGV 83

Query: 464 QWF 472
           Q F
Sbjct: 84  QGF 86


>UniRef50_Q29EJ3 Cluster: GA18429-PA; n=1; Drosophila
           pseudoobscura|Rep: GA18429-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 336

 Score = 36.3 bits (80), Expect = 0.50
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = +2

Query: 278 QPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Q +Y++ D    + + Y   D      ++++ +RDG   +G+YS  +ADG ++ V Y A 
Sbjct: 37  QRRYQEQDTARAF-YSYGYSDDTAA--RAEYSSRDGSS-RGFYSYVDADGKLQTVRYEAS 92

Query: 458 QAQWF 472
           + Q F
Sbjct: 93  RGQGF 97


>UniRef50_P83355 Cluster: Cuticle protein 14 isoform b; n=3;
           Limulidae|Rep: Cuticle protein 14 isoform b - Limulus
           polyphemus (Atlantic horseshoe crab)
          Length = 130

 Score = 36.3 bits (80), Expect = 0.50
 Identities = 20/62 (32%), Positives = 29/62 (46%)
 Frame = +2

Query: 272 GDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYS 451
           G   Q+++ DA   Y F Y       G  + +     G+V  G Y L +ADG  R+V Y 
Sbjct: 13  GASTQFKNQDAIGNYNFGYNEGHATGGTFRREFGDAFGNVKVGSYGLTDADGRRRIVTYK 72

Query: 452 AE 457
           A+
Sbjct: 73  AD 74


>UniRef50_UPI0000D56610 Cluster: PREDICTED: similar to CG10112-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG10112-PA - Tribolium castaneum
          Length = 142

 Score = 35.9 bits (79), Expect = 0.66
 Identities = 27/61 (44%), Positives = 33/61 (54%), Gaps = 3/61 (4%)
 Frame = +2

Query: 284 QYE-DYDAHPKYAFEYKIEDPHTGDLKSQH-ETRDGDVVKGYYSLHEADGSI-RVVEYSA 454
           QYE + +   +Y F   IED H  DL  Q  E RDG  VKG YS   +DG + R V Y A
Sbjct: 31  QYELEQNRAARYKFSSNIED-HISDLMHQRDEVRDGLNVKGSYSY--SDGYVKRTVHYEA 87

Query: 455 E 457
           +
Sbjct: 88  D 88


>UniRef50_Q7JZ94 Cluster: RE53044p; n=2; Sophophora|Rep: RE53044p -
           Drosophila melanogaster (Fruit fly)
          Length = 815

 Score = 35.9 bits (79), Expect = 0.66
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRD-GDVVKGYYSLHEADGSIRVVEYSAE 457
           KY F Y+I D HTG+     + RD   V +G Y +   DG I+ V Y A+
Sbjct: 750 KYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHAD 799


>UniRef50_Q3V6S5 Cluster: Cuticular protein; n=5; Tachypleus
           tridentatus|Rep: Cuticular protein - Tachypleus
           tridentatus (Japanese horseshoe crab)
          Length = 212

 Score = 35.9 bits (79), Expect = 0.66
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDG-DVVKGYYSLHEADGSIRVV 442
           ++G QP Y        Y+F Y    P  G   ++ E+ DG   V G Y L +ADG  R V
Sbjct: 88  YYGQQPVYPSVPT--PYSFSYVA--PAIGGASARQESGDGYGSVSGSYQLSDADGRQRNV 143

Query: 443 EYSA 454
           +Y+A
Sbjct: 144 QYTA 147


>UniRef50_A1Z8Z2 Cluster: CG8510-PA; n=2; Sophophora|Rep: CG8510-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 126

 Score = 35.9 bits (79), Expect = 0.66
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIED----PHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYS 451
           Q  + + + KY + Y+++D       G LKS +   +G+ V G YS    DG   VV Y+
Sbjct: 25  QESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYT 84

Query: 452 AEQ 460
           A++
Sbjct: 85  ADE 87


>UniRef50_P83356 Cluster: Cuticle protein 16 isoform b; n=2;
           Limulidae|Rep: Cuticle protein 16 isoform b - Limulus
           polyphemus (Atlantic horseshoe crab)
          Length = 70

 Score = 35.5 bits (78), Expect = 0.87
 Identities = 18/52 (34%), Positives = 25/52 (48%)
 Frame = +2

Query: 272 GDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADG 427
           G   QY + D    Y F+Y  +    G  + +H T  G+V  G Y L +ADG
Sbjct: 18  GMSTQYRNGDTIQNYNFQYDEDHLAGGSYRREHGTGYGNVKVGSYGLRDADG 69


>UniRef50_Q7JZW0 Cluster: RE08808p; n=2; Sophophora|Rep: RE08808p -
           Drosophila melanogaster (Fruit fly)
          Length = 144

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
 Frame = +2

Query: 275 DQPQYEDY-DAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI-RVVEY 448
           ++ +YE Y + + +Y+F   ++D       S++E R+G  V+G YS    DG + R VEY
Sbjct: 30  EREEYEKYQNENAQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEY 87

Query: 449 SAEQ 460
            A++
Sbjct: 88  IADK 91


>UniRef50_Q3V6T1 Cluster: Cuticular protein; n=1; Tachypleus
           tridentatus|Rep: Cuticular protein - Tachypleus
           tridentatus (Japanese horseshoe crab)
          Length = 625

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 29/77 (37%), Positives = 36/77 (46%), Gaps = 1/77 (1%)
 Frame = +2

Query: 236 ARASP*NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDV-VKGYYSL 412
           A A+P  AP      PQ  D      ++F Y   D   G   S+ ET D  + VKG YSL
Sbjct: 473 APAAPAAAPAPAATLPQIGDISP---FSFMYTA-DAGKGS-SSRSETGDAGIKVKGSYSL 527

Query: 413 HEADGSIRVVEYSAEQA 463
               G  R+V+YSA  A
Sbjct: 528 KHPSGHQRIVDYSANGA 544


>UniRef50_UPI0000DB7EC4 Cluster: PREDICTED: similar to CG15920-PA,
           isoform A, partial; n=1; Apis mellifera|Rep: PREDICTED:
           similar to CG15920-PA, isoform A, partial - Apis
           mellifera
          Length = 213

 Score = 34.7 bits (76), Expect = 1.5
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Y F Y++ED   G     HE+R  +   G Y +   DG  ++V+Y A+
Sbjct: 132 YEFSYEVEDAVAGLNFGHHESRKDNEATGAYHVLLPDGRTQIVDYIAD 179


>UniRef50_Q29PL1 Cluster: GA21482-PA; n=1; Drosophila
           pseudoobscura|Rep: GA21482-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 658

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 16/47 (34%), Positives = 20/47 (42%)
 Frame = +3

Query: 111 AVSSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHH 251
           A ++ +   H   H H +     H    AAHH A    AA  L HHH
Sbjct: 107 AAAAAAAAHHAAAHHHHHHHHHAHAHAAAAHHAAAAAAAAAGLHHHH 153


>UniRef50_Q17BZ7 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 188

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIEDPHTGD---LKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           Y   P YA E   +  + G+   +K QHE    D+ +G Y L + DG +R++ Y   Q
Sbjct: 33  YSGRP-YAVEESGKPIYIGNDEIIKHQHEAHRLDMTRGQYRLVDPDGKLRLINYHGAQ 89


>UniRef50_Q5PAQ3 Cluster: Putative uncharacterized protein; n=1;
            Anaplasma marginale str. St. Maries|Rep: Putative
            uncharacterized protein - Anaplasma marginale (strain St.
            Maries)
          Length = 3194

 Score = 33.9 bits (74), Expect = 2.7
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +1

Query: 172  NPTMLYQ*QRIMELRLYTLHPCSCITMKRASTSWR 276
            NP +L Q +R  E+    L  CSCIT  R+ TS R
Sbjct: 1597 NPDILQQDRRFAEMYTNLLEQCSCITQSRSQTSVR 1631


>UniRef50_Q8I6Y0 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 311

 Score = 33.1 bits (72), Expect = 4.7
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 4/59 (6%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIED-PHTGD--LKSQHETRDGDVVK-GYYSLHEADGSIRVVEYSAEQ 460
           Y  +  Y +EY+I D  H G+    +   T +  +VK G+YS   ADG +  V Y A++
Sbjct: 135 YGDNGSYKYEYQIADGTHVGEEGYFTNPNTEEASLVKKGWYSYTGADGKVYTVHYWADK 193


>UniRef50_A1UB34 Cluster: UvrD/REP helicase; n=4;
           Actinomycetales|Rep: UvrD/REP helicase - Mycobacterium
           sp. (strain KMS)
          Length = 703

 Score = 32.7 bits (71), Expect = 6.2
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 3/69 (4%)
 Frame = -2

Query: 344 EGLRFCIQMHIWDEHHNLHIEAGLHDVLARFMVMHEHGCSVYSRSSMMRCYWYNM---VG 174
           E LR  + M I D+  +  IE    D LA  +  HEHG      S   R  W  +   +G
Sbjct: 297 ESLRSGLDMLIADKEVDSRIEVSHVDRLAHRVFRHEHGAPRMLGSEDERALWGGLATELG 356

Query: 173 LTFIPMTMS 147
           L F P+ +S
Sbjct: 357 LAFTPVFLS 365


>UniRef50_A1I8X0 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Desulfococcus oleovorans Hxd3|Rep: Putative
           uncharacterized protein - Candidatus Desulfococcus
           oleovorans Hxd3
          Length = 131

 Score = 32.3 bits (70), Expect = 8.1
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = +1

Query: 214 RLYTLHPCSCITMKRASTSWRPA 282
           R+Y LHPC C+++ + + S RP+
Sbjct: 75  RVYPLHPCQCLSINKKTASGRPS 97


>UniRef50_O96680 Cluster: Dissatisfaction; n=2; Drosophila
           melanogaster|Rep: Dissatisfaction - Drosophila
           melanogaster (Fruit fly)
          Length = 693

 Score = 32.3 bits (70), Expect = 8.1
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHHETRQYIMETSLN 287
           H     H +    +H    AAHH A    AA  L HHH      + T+++
Sbjct: 117 HHAAAAHHHHHHHHHAHAAAAHHAAVAAAAASGLHHHHHAMPVSLVTNVS 166


>UniRef50_A7SNU7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 786

 Score = 32.3 bits (70), Expect = 8.1
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +3

Query: 282 LNMKIMMLIPNMHLNTKSKTLTLGT*RANT--RLATVMS*RATTLCMK-LMDLSVLWNTP 452
           LN+    L P + ++  S +L   T  A     L T  S   T L ++ L+D S+L   P
Sbjct: 343 LNISFCRLSPELQIDLISLSLYPTTFVAADVYYLLTDHSELTTQLHLQDLVDNSLLQFDP 402

Query: 453 PSKHNGFNAVVQAHCSDKA-AEPVQQYYHH*KRFY 554
            SK    + V+QA C DKA ++  +  Y H K+ +
Sbjct: 403 VSKQYAMHGVIQAFCMDKARSKDFELSYQHAKKVF 437


>UniRef50_Q6C4S5 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep:
           Similarity - Yarrowia lipolytica (Candida lipolytica)
          Length = 1456

 Score = 32.3 bits (70), Expect = 8.1
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +3

Query: 156 HGNEGQSYHVVPVAAHHGAPTIHAAP 233
           HG+ G  +H  P   +HG+P +H++P
Sbjct: 387 HGSPGPGFHGSPGPGYHGSPAMHSSP 412


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 547,714,018
Number of Sequences: 1657284
Number of extensions: 10905667
Number of successful extensions: 29185
Number of sequences better than 10.0: 165
Number of HSP's better than 10.0 without gapping: 27938
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29120
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 38321472724
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).