SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30029
         (530 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015A487B Cluster: UPI00015A487B related cluster; n...    35   1.3  
UniRef50_Q5AL49 Cluster: Putative uncharacterized protein SEC2; ...    34   1.8  
UniRef50_Q2NH07 Cluster: Predicted glycosyltransferase; n=1; Met...    34   1.8  
UniRef50_Q4UFK6 Cluster: Putative uncharacterized protein; n=1; ...    33   4.1  
UniRef50_Q03X60 Cluster: Type IV secretory pathway, VirD4 compon...    33   5.4  
UniRef50_A7PE42 Cluster: Chromosome chr11 scaffold_13, whole gen...    33   5.4  
UniRef50_A5BQ02 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  

>UniRef50_UPI00015A487B Cluster: UPI00015A487B related cluster; n=2;
           Danio rerio|Rep: UPI00015A487B UniRef100 entry - Danio
           rerio
          Length = 451

 Score = 34.7 bits (76), Expect = 1.3
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +3

Query: 99  TKRTVYGQPGPSTCAYIAGSKQR--DIKLYFTSLIYR*IILWSRVFFLQSINTHYVAYCT 272
           TK T+Y  P       + G   R  ++ LY T+L+     L++    LQ +N H  +  T
Sbjct: 270 TKLTLYKNPLIFLPDQLIGHMPRLQELYLYETNLVTVPSNLFANTTNLQYLNVHLNSNLT 329

Query: 273 LYPKYLYACIPFLKE 317
           L PK ++ C+P L++
Sbjct: 330 LLPKDVFCCLPKLRK 344


>UniRef50_Q5AL49 Cluster: Putative uncharacterized protein SEC2;
           n=2; Candida albicans|Rep: Putative uncharacterized
           protein SEC2 - Candida albicans (Yeast)
          Length = 751

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 35/113 (30%), Positives = 49/113 (43%), Gaps = 20/113 (17%)
 Frame = +3

Query: 6   ISAPGG-KRSKRSNSIQNRVNFYANESVKKTRTKR-------TVYGQPGPSTCAYIAGSK 161
           I  PG   + KRSN+I NR   Y++ S   + T         T  G+   ST   I   +
Sbjct: 452 IVVPGSFGQFKRSNTISNRNGTYSSSSTSSSSTSSVSSSSATTANGESLNSTTHNIQLER 511

Query: 162 QRD---IKLYFTSLIYR*IILWSRVFFLQSIN---------THYVAYCTLYPK 284
             +   IKLY   L+ R  I WS++ F  +I+          HY A+  L PK
Sbjct: 512 TEESKLIKLYIMMLLIRSKIFWSKLGFWDTIDQINEINLDEIHYEAFSYLIPK 564


>UniRef50_Q2NH07 Cluster: Predicted glycosyltransferase; n=1;
           Methanosphaera stadtmanae DSM 3091|Rep: Predicted
           glycosyltransferase - Methanosphaera stadtmanae (strain
           DSM 3091)
          Length = 817

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = -2

Query: 496 ETTNLPFLLFKLTNRINLTELLYKVLIFA*RSVGNFY-KLWPIDSCTCTKVYRI 338
           E  NL  LLFKL N  N+T+LLYK   ++   +  +Y +++  D  +   +++I
Sbjct: 126 EENNLDLLLFKLINMNNITKLLYKTETYSMNFLEKYYNRVFNHDDISANILFKI 179


>UniRef50_Q4UFK6 Cluster: Putative uncharacterized protein; n=1;
           Theileria annulata|Rep: Putative uncharacterized protein
           - Theileria annulata
          Length = 1642

 Score = 33.1 bits (72), Expect = 4.1
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = -3

Query: 429 TKCSSLLKGASETFTNYGQLIVAHAQKCTELKNT-VIKILLKTG 301
           TK +++ KGA++TFT  G+     A +CT  KN+  I ++ KTG
Sbjct: 172 TKDTTMGKGANDTFTTLGKGANFTAMECTSEKNSNEIAVVTKTG 215


>UniRef50_Q03X60 Cluster: Type IV secretory pathway, VirD4
           component; n=1; Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293|Rep: Type IV secretory pathway,
           VirD4 component - Leuconostoc mesenteroides subsp.
           mesenteroides (strain ATCC 8293 /NCDO 523)
          Length = 1006

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 6   ISAPGGKRSKRSNSIQNRVNFYANESVKKTRTKRTV 113
           +SA G  +S  S S+ NR+N +A+ES+ +  T  T+
Sbjct: 437 LSATGDTKSSISFSVMNRLNLFASESITRLTTFNTI 472


>UniRef50_A7PE42 Cluster: Chromosome chr11 scaffold_13, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_13, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 728

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 22/61 (36%), Positives = 29/61 (47%)
 Frame = +2

Query: 194 NLSLNNIMVEGVLPPVN*HALCRLLYAISEIPLRLYPVFKRIFMTVFFNSVHFCACATIN 373
           NLS    MV   LPPV  H L   + + SE+P RL P  KR +  +      F   + +N
Sbjct: 59  NLSSLVTMVPLPLPPV--HGLPDSVESTSELPFRLVPYLKRAYDQLQPPLTEFLQNSDVN 116

Query: 374 W 376
           W
Sbjct: 117 W 117


>UniRef50_A5BQ02 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 401

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 22/61 (36%), Positives = 29/61 (47%)
 Frame = +2

Query: 194 NLSLNNIMVEGVLPPVN*HALCRLLYAISEIPLRLYPVFKRIFMTVFFNSVHFCACATIN 373
           NLS    MV   LPPV  H L   + + SE+P RL P  KR +  +      F   + +N
Sbjct: 59  NLSSLVTMVPLPLPPV--HGLPDSVESTSELPFRLVPYLKRAYDQLQPPLTEFLQNSDVN 116

Query: 374 W 376
           W
Sbjct: 117 W 117


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 506,352,188
Number of Sequences: 1657284
Number of extensions: 9790222
Number of successful extensions: 22567
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 22022
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22561
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 33873797511
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).