SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P38919 Cluster: Eukaryotic initiation factor 4A-III; n=...   176   6e-43
UniRef50_Q14240 Cluster: Eukaryotic initiation factor 4A-II; n=3...   170   4e-41
UniRef50_A2AAP7 Cluster: DEAD (Asp-Glu-Ala-Asp) box polypeptide ...   122   1e-26
UniRef50_UPI000065E01D Cluster: Homolog of Brachydanio rerio "Eu...   115   1e-24
UniRef50_A0BEU9 Cluster: Chromosome undetermined scaffold_102, w...   113   3e-24
UniRef50_Q23U16 Cluster: DEAD/DEAH box helicase family protein; ...   107   4e-22
UniRef50_A0D232 Cluster: Chromosome undetermined scaffold_35, wh...   104   3e-21
UniRef50_Q0E2Q3 Cluster: Putative eukaryotic initiation factor 4...   101   2e-20
UniRef50_P39517 Cluster: ATP-dependent RNA helicase DHH1; n=103;...   101   2e-20
UniRef50_A2DVG1 Cluster: DEAD/DEAH box helicase family protein; ...    91   2e-17
UniRef50_Q4SP80 Cluster: Chromosome 15 SCAF14542, whole genome s...    89   1e-16
UniRef50_Q5KJI2 Cluster: ATP-dependent RNA helicase DHH1; n=4; D...    87   5e-16
UniRef50_A2SQE1 Cluster: DEAD/DEAH box helicase domain protein; ...    86   1e-15
UniRef50_Q4T821 Cluster: Chromosome undetermined SCAF7914, whole...    83   7e-15
UniRef50_Q3LWE1 Cluster: Translation initiation factor 4A2; n=1;...    82   2e-14
UniRef50_Q3AFI3 Cluster: ATP-dependent RNA helicase, DEAD box fa...    81   3e-14
UniRef50_Q11UP8 Cluster: ATP-dependent RNA helicase; n=1; Cytoph...    81   3e-14
UniRef50_O26305 Cluster: ATP-dependent RNA helicase, eIF-4A fami...    81   3e-14
UniRef50_A7HDE9 Cluster: DEAD/DEAH box helicase domain protein; ...    81   4e-14
UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein; ...    80   5e-14
UniRef50_UPI0000566899 Cluster: UPI0000566899 related cluster; n...    80   7e-14
UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    79   9e-14
UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    79   1e-13
UniRef50_Q11QF9 Cluster: Inducible ATP-independent RNA helicase;...    79   1e-13
UniRef50_A0Z0M4 Cluster: ATP-dependent RNA helicase; n=1; marine...    79   2e-13
UniRef50_Q9KLE2 Cluster: ATP-dependent RNA helicase DeaD; n=35; ...    78   2e-13
UniRef50_Q8YXJ0 Cluster: ATP-dependent RNA helicase; n=11; Cyano...    78   3e-13
UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2; Planct...    78   3e-13
UniRef50_Q6MN50 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    78   3e-13
UniRef50_Q26CN9 Cluster: ATP-dependent RNA helicase; n=1; Flavob...    77   5e-13
UniRef50_A5BNE7 Cluster: Putative uncharacterized protein; n=1; ...    77   5e-13
UniRef50_Q98RE0 Cluster: ATP-DEPENDENT RNA HELICASE; n=1; Mycopl...    77   6e-13
UniRef50_Q81VG0 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    76   8e-13
UniRef50_A2TP65 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    76   1e-12
UniRef50_Q2FKY7 Cluster: DEAD/DEAH box helicase-like; n=1; Metha...    76   1e-12
UniRef50_Q484Q1 Cluster: RNA helicase DeaD; n=1; Colwellia psych...    75   1e-12
UniRef50_Q9S531 Cluster: DEAD-box protein; n=4; Cystobacterineae...    75   1e-12
UniRef50_Q185X0 Cluster: ATP-dependent RNA helicase; n=3; Clostr...    75   1e-12
UniRef50_Q2WF63 Cluster: Putative uncharacterized protein; n=4; ...    75   1e-12
UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12; Clost...    75   2e-12
UniRef50_Q725W5 Cluster: ATP-dependent RNA helicase, DEAD/DEAH f...    75   2e-12
UniRef50_Q1VPX9 Cluster: ATP-independent RNA helicase; n=9; Bact...    75   2e-12
UniRef50_A5E6W6 Cluster: ATP-dependent rRNA helicase RRP3; n=4; ...    75   2e-12
UniRef50_Q1MY97 Cluster: DEAD/DEAH box helicase-like protein; n=...    75   3e-12
UniRef50_A4C0F9 Cluster: ATP-dependent RNA helicase; n=6; Bacter...    75   3e-12
UniRef50_Q8SQK9 Cluster: ATP-dependent RNA helicase DHH1; n=1; E...    75   3e-12
UniRef50_Q6MN67 Cluster: ATP-dependent RNA helicase; n=3; Deltap...    74   3e-12
UniRef50_P96614 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    74   3e-12
UniRef50_A2EPG4 Cluster: DEAD/DEAH box helicase family protein; ...    74   4e-12
UniRef50_Q893G8 Cluster: ATP-dependent RNA helicase; n=4; Clostr...    73   6e-12
UniRef50_Q3AX69 Cluster: DEAD/DEAH box helicase-like; n=15; Cyan...    73   6e-12
UniRef50_Q5CIF9 Cluster: DEAD-box RNA helicase; n=2; Cryptospori...    73   6e-12
UniRef50_Q5ZT20 Cluster: ATP-dependent RNA helicase; n=4; Legion...    73   1e-11
UniRef50_Q1QYG3 Cluster: DEAD/DEAH box helicase-like protein; n=...    73   1e-11
UniRef50_Q8A2K2 Cluster: ATP-dependent RNA helicase; n=10; cellu...    72   1e-11
UniRef50_Q14NT1 Cluster: Putative atp-dependent rna helicase pro...    72   2e-11
UniRef50_Q82T78 Cluster: RhlE; ATP-dependent RNA helicase RhlE; ...    71   2e-11
UniRef50_Q6F0U0 Cluster: ATP-dependent RNA helicase; n=1; Mesopl...    71   2e-11
UniRef50_Q5L3G9 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    71   2e-11
UniRef50_O34750 Cluster: YfmL protein; n=5; Bacillus|Rep: YfmL p...    71   3e-11
UniRef50_Q8EZ11 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    71   4e-11
UniRef50_Q0FAJ4 Cluster: Dead-box ATP-dependent RNA helicase; n=...    71   4e-11
UniRef50_UPI00015B4D43 Cluster: PREDICTED: hypothetical protein;...    70   6e-11
UniRef50_UPI0000E23613 Cluster: PREDICTED: similar to eukaryotic...    70   6e-11
UniRef50_UPI0000585111 Cluster: PREDICTED: hypothetical protein;...    70   6e-11
UniRef50_Q89IS2 Cluster: Cold-shock dead-box protein A; n=28; Al...    70   6e-11
UniRef50_Q6MR64 Cluster: ATP-dependent RNA helicase; n=5; cellul...    70   6e-11
UniRef50_Q5NZY2 Cluster: ATP-dependent RNA helicase DeaD; n=18; ...    70   6e-11
UniRef50_A2U1Q9 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    70   6e-11
UniRef50_P0A9P8 Cluster: Cold-shock DEAD box protein A; n=54; Ga...    70   6e-11
UniRef50_Q6AMK6 Cluster: Probable ATP-dependent RNA helicase; n=...    70   7e-11
UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2; Trepon...    70   7e-11
UniRef50_Q0C4R1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    70   7e-11
UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein; ...    70   7e-11
UniRef50_A4J5M3 Cluster: DEAD/DEAH box helicase domain protein; ...    70   7e-11
UniRef50_Q01PH0 Cluster: DEAD/DEAH box helicase domain protein; ...    69   1e-10
UniRef50_Q014T4 Cluster: Chromosome 07 contig 1, DNA sequence; n...    69   1e-10
UniRef50_Q22MC1 Cluster: Type III restriction enzyme, res subuni...    69   1e-10
UniRef50_P38712 Cluster: ATP-dependent rRNA helicase RRP3; n=6; ...    69   1e-10
UniRef50_Q1VL45 Cluster: DEAD/DEAH box helicase-like protein; n=...    69   1e-10
UniRef50_Q5GZA1 Cluster: ATP-dependent RNA helicase; n=6; Xantho...    69   2e-10
UniRef50_Q2LY23 Cluster: Superfamily II DNA and RNA helicases; n...    69   2e-10
UniRef50_Q188H5 Cluster: Putative ATP-dependent RNA helicase; n=...    69   2e-10
UniRef50_A6TTG0 Cluster: DEAD/DEAH box helicase domain protein; ...    69   2e-10
UniRef50_A6H0L1 Cluster: Probable ATP-dependent RNA helicase, DE...    69   2e-10
UniRef50_A4M6V6 Cluster: DEAD/DEAH box helicase domain protein; ...    69   2e-10
UniRef50_Q4N4B1 Cluster: ATP-dependent RNA helicase, putative; n...    69   2e-10
UniRef50_Q2NEZ7 Cluster: Predicted helicase; n=6; cellular organ...    69   2e-10
UniRef50_Q81QF0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    68   2e-10
UniRef50_Q4PNH7 Cluster: Putative cold-shock dead-box protein A;...    68   2e-10
UniRef50_P75172 Cluster: Probable ATP-dependent RNA helicase MG4...    68   2e-10
UniRef50_UPI0000D55AB0 Cluster: PREDICTED: similar to Probable A...    68   3e-10
UniRef50_Q8R4Z5 Cluster: DEAD-box corepressor DP103 beta; n=5; T...    68   3e-10
UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellu...    68   3e-10
UniRef50_Q6MBR0 Cluster: Putative ATP-dependent RNA helicase; n=...    68   3e-10
UniRef50_Q5QWG1 Cluster: ATP-dependent RNA helicase; n=1; Idioma...    68   3e-10
UniRef50_Q15T34 Cluster: DEAD/DEAH box helicase-like; n=1; Pseud...    68   3e-10
UniRef50_Q03YT1 Cluster: Superfamily II DNA and RNA helicase; n=...    68   3e-10
UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein; ...    68   3e-10
UniRef50_A4BET4 Cluster: DEAD/DEAH box helicase-like protein; n=...    68   3e-10
UniRef50_A3ZWP8 Cluster: ATP-dependent RNA helicase; n=1; Blasto...    68   3e-10
UniRef50_A0V009 Cluster: DEAD/DEAH box helicase-like; n=1; Clost...    68   3e-10
UniRef50_Q978T9 Cluster: ATP-dependent RNA helicase; n=3; Thermo...    68   3e-10
UniRef50_Q8SQM5 Cluster: ATP-dependent RNA helicase eIF4A; n=1; ...    68   3e-10
UniRef50_Q9UHI6 Cluster: Probable ATP-dependent RNA helicase DDX...    68   3e-10
UniRef50_Q5NML9 Cluster: DNA and RNA helicase; n=28; Alphaproteo...    67   4e-10
UniRef50_O66866 Cluster: ATP-dependent RNA helicase DeaD; n=1; A...    67   4e-10
UniRef50_A6NQG8 Cluster: Putative uncharacterized protein; n=2; ...    67   4e-10
UniRef50_A1U3D6 Cluster: DEAD/DEAH box helicase domain protein; ...    67   4e-10
UniRef50_Q9LKL6 Cluster: DEAD box protein P68; n=5; Viridiplanta...    67   4e-10
UniRef50_Q49K88 Cluster: DEAD box RNA helicase; n=1; Toxoplasma ...    67   4e-10
UniRef50_Q18W60 Cluster: DEAD/DEAH box helicase-like; n=2; Desul...    67   5e-10
UniRef50_Q0BUS0 Cluster: ATP-dependent RNA helicase; n=3; Rhodos...    67   5e-10
UniRef50_A3I1F5 Cluster: DEAD/DEAH box helicase-like protein; n=...    67   5e-10
UniRef50_A1VA48 Cluster: DEAD/DEAH box helicase domain protein; ...    67   5e-10
UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=19...    67   5e-10
UniRef50_Q8D6Y8 Cluster: Superfamily II DNA and RNA helicase; n=...    66   7e-10
UniRef50_A5FST0 Cluster: DEAD/DEAH box helicase domain protein; ...    66   7e-10
UniRef50_A5BYF4 Cluster: Putative uncharacterized protein; n=1; ...    66   7e-10
UniRef50_P0C218 Cluster: Probable ATP-dependent RNA helicase DDX...    66   7e-10
UniRef50_Q81LV0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    66   9e-10
UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1; Syntro...    66   9e-10
UniRef50_Q4P3U9 Cluster: ATP-dependent rRNA helicase RRP3; n=20;...    66   9e-10
UniRef50_UPI00015BD198 Cluster: UPI00015BD198 related cluster; n...    66   1e-09
UniRef50_Q81JK1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    66   1e-09
UniRef50_Q1Q4V2 Cluster: Similar to ATP-independent RNA helicase...    66   1e-09
UniRef50_A5CVQ6 Cluster: ATP-dependent RNA helicase DeaD; n=2; s...    66   1e-09
UniRef50_A3J7I3 Cluster: ATP-independent RNA helicase; n=5; Bact...    66   1e-09
UniRef50_Q8L4E9 Cluster: DEAD-box ATP-dependent RNA helicase 36;...    66   1e-09
UniRef50_A5E058 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    66   1e-09
UniRef50_Q92GV2 Cluster: ATP-dependent RNA helicase RhlE; n=10; ...    65   2e-09
UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellu...    65   2e-09
UniRef50_Q39MK8 Cluster: DEAD/DEAH box helicase; n=10; Proteobac...    65   2e-09
UniRef50_Q11TW3 Cluster: Possible ATP-dependent RNA helicase; n=...    65   2e-09
UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellu...    65   2e-09
UniRef50_A5UZK3 Cluster: DEAD/DEAH box helicase domain protein; ...    65   2e-09
UniRef50_A3ZXX1 Cluster: ATP-dependent RNA helicase; n=2; Planct...    65   2e-09
UniRef50_A3WD13 Cluster: DNA and RNA helicase; n=2; Alphaproteob...    65   2e-09
UniRef50_UPI0000498D8E Cluster: ATP-dependent RNA helicase; n=1;...    65   2e-09
UniRef50_Q64VR8 Cluster: ATP-dependent RNA helicase DeaD; n=14; ...    65   2e-09
UniRef50_Q5QY63 Cluster: ATP-dependent RNA helicase; n=3; Altero...    65   2e-09
UniRef50_Q2BMZ1 Cluster: ATP-dependent RNA helicase; n=1; Neptun...    65   2e-09
UniRef50_Q0HKH0 Cluster: DEAD/DEAH box helicase domain protein; ...    65   2e-09
UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=...    65   2e-09
UniRef50_A6N5Z1 Cluster: Helicase; n=7; Plasmodium|Rep: Helicase...    65   2e-09
UniRef50_Q0W8H7 Cluster: ATP-dependent RNA helicase; n=1; uncult...    65   2e-09
UniRef50_P54475 Cluster: Probable ATP-dependent RNA helicase yqf...    65   2e-09
UniRef50_Q13838 Cluster: Spliceosome RNA helicase BAT1; n=55; Eu...    65   2e-09
UniRef50_P44586 Cluster: Cold-shock DEAD box protein A homolog; ...    65   2e-09
UniRef50_Q88XN5 Cluster: ATP-dependent RNA helicase; n=2; Lactob...    64   3e-09
UniRef50_Q6D2K3 Cluster: ATP-independent RNA helicase; n=6; Prot...    64   3e-09
UniRef50_Q08Q14 Cluster: HeliCase, c-terminal:dead/deah box heli...    64   3e-09
UniRef50_A7JLA3 Cluster: ATP-dependent RNA helicase; n=20; Franc...    64   3e-09
UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein; ...    64   3e-09
UniRef50_A4LYS0 Cluster: DEAD/DEAH box helicase domain protein; ...    64   3e-09
UniRef50_A0RP33 Cluster: Putative ATP-dependent RNA helicase Rhl...    64   3e-09
UniRef50_Q8MZI3 Cluster: GH10652p; n=2; Drosophila melanogaster|...    64   3e-09
UniRef50_P42305 Cluster: ATP-dependent RNA helicase dbpA; n=9; F...    64   3e-09
UniRef50_Q7VQL9 Cluster: Cold-shock DEAD-box protein A, inducibl...    64   4e-09
UniRef50_Q3AZR1 Cluster: DEAD/DEAH box helicase-like; n=2; Synec...    64   4e-09
UniRef50_Q2BP56 Cluster: Putative ATP-dependent RNA helicase; n=...    64   4e-09
UniRef50_Q0AR94 Cluster: DEAD/DEAH box helicase domain protein; ...    64   4e-09
UniRef50_Q6BLU9 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    64   4e-09
UniRef50_O00148 Cluster: ATP-dependent RNA helicase DDX39; n=27;...    64   4e-09
UniRef50_Q5KBP5 Cluster: ATP-dependent RNA helicase DBP5; n=3; F...    64   4e-09
UniRef50_Q480Z7 Cluster: ATP-dependent RNA helicase, DEAD box fa...    64   5e-09
UniRef50_Q1GJ43 Cluster: DEAD/DEAH box helicase-like protein; n=...    64   5e-09
UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA h...    64   5e-09
UniRef50_Q0HYG8 Cluster: DEAD/DEAH box helicase domain protein; ...    64   5e-09
UniRef50_A6DK15 Cluster: ATP-dependent RNA helicase, specific fo...    64   5e-09
UniRef50_A4B5L7 Cluster: ATP-dependent RNA helicase DbpA; n=3; P...    64   5e-09
UniRef50_A4RIF1 Cluster: ATP-dependent RNA helicase DBP5; n=7; A...    64   5e-09
UniRef50_UPI00006CBDDC Cluster: DEAD/DEAH box helicase family pr...    63   6e-09
UniRef50_UPI0000499A01 Cluster: DEAD/DEAH box helicase; n=1; Ent...    63   6e-09
UniRef50_Q8D7D0 Cluster: Superfamily II DNA and RNA helicase; n=...    63   6e-09
UniRef50_Q31AC4 Cluster: DEAD/DEAH box helicase-like protein; n=...    63   6e-09
UniRef50_Q0TQ86 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    63   6e-09
UniRef50_A6DIU5 Cluster: Probable ATP dependent RNA helicase; n=...    63   6e-09
UniRef50_A6CFZ8 Cluster: ATP-dependent RNA helicase; n=1; Planct...    63   6e-09
UniRef50_Q7QP86 Cluster: GLP_397_1016_18; n=1; Giardia lamblia A...    63   6e-09
UniRef50_Q58HG3 Cluster: DEAD-box RNA helicase; n=4; Eukaryota|R...    63   6e-09
UniRef50_Q55BR9 Cluster: Putative uncharacterized protein; n=1; ...    63   6e-09
UniRef50_A2DFG9 Cluster: DEAD/DEAH box helicase family protein; ...    63   6e-09
UniRef50_A0EA02 Cluster: Chromosome undetermined scaffold_85, wh...    63   6e-09
UniRef50_Q6BML1 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    63   6e-09
UniRef50_Q11039 Cluster: Cold-shock DEAD box protein A homolog; ...    63   6e-09
UniRef50_UPI0000499D6F Cluster: DEAD/DEAH box helicase; n=1; Ent...    63   8e-09
UniRef50_A6QHA1 Cluster: ATP-dependent RNA helicase DEAD/DEAH bo...    63   8e-09
UniRef50_A1G315 Cluster: DEAD/DEAH box helicase-like; n=2; Salin...    63   8e-09
UniRef50_A0KZD5 Cluster: DEAD/DEAH box helicase domain protein; ...    63   8e-09
UniRef50_A0T1H5 Cluster: SF2-family helicase; n=6; Plasmodium|Re...    63   8e-09
UniRef50_Q5KPU1 Cluster: ATP-dependent RNA helicase DBP8; n=2; F...    63   8e-09
UniRef50_Q9RKJ0 Cluster: ATP-dependent RNA helicase; n=2; Strept...    62   1e-08
UniRef50_Q87HW1 Cluster: ATP-dependent RNA helicase, DEAD box fa...    62   1e-08
UniRef50_Q2YZZ9 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_A7BCL2 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_Q9V3C4 Cluster: CG6539-PA; n=1; Drosophila melanogaster...    62   1e-08
UniRef50_P25888 Cluster: Putative ATP-dependent RNA helicase rhl...    62   1e-08
UniRef50_Q4T4A9 Cluster: Chromosome undetermined SCAF9757, whole...    62   1e-08
UniRef50_Q89UH0 Cluster: Dead-box ATP-dependent RNA helicase; n=...    62   1e-08
UniRef50_Q5FNK0 Cluster: ATP-dependent RNA helicase; n=1; Glucon...    62   1e-08
UniRef50_Q12QV2 Cluster: DEAD/DEAH box helicase-like protein; n=...    62   1e-08
UniRef50_Q0G0P8 Cluster: Superfamily II DNA and RNA helicase; n=...    62   1e-08
UniRef50_A6TX49 Cluster: DEAD/DEAH box helicase domain protein; ...    62   1e-08
UniRef50_A6Q8Y9 Cluster: ATP-dependent RNA helicase, DEAD-box fa...    62   1e-08
UniRef50_A4C6L9 Cluster: ATP-dependent RNA helicase, DEAD box fa...    62   1e-08
UniRef50_A3PFY9 Cluster: DEAD/DEAH box helicase domain protein; ...    62   1e-08
UniRef50_A0KTC9 Cluster: DEAD/DEAH box helicase domain protein; ...    62   1e-08
UniRef50_Q9GV13 Cluster: Vasa-related protein CnVAS1; n=3; Eumet...    62   1e-08
UniRef50_Q54TF8 Cluster: DEAD-box RNA helicase; n=2; Dictyosteli...    62   1e-08
UniRef50_Q9UHL0 Cluster: ATP-dependent RNA helicase DDX25; n=111...    62   1e-08
UniRef50_Q81RE0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    62   2e-08
UniRef50_Q4IZ16 Cluster: DEAD/DEAH box helicase:Helicase, C-term...    62   2e-08
UniRef50_A6VTY7 Cluster: DEAD/DEAH box helicase domain protein; ...    62   2e-08
UniRef50_A4B385 Cluster: ATP-dependent RNA helicase, DEAD box fa...    62   2e-08
UniRef50_Q54T87 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_Q4N9Q9 Cluster: DEAD box RNA helicase, putative; n=3; P...    62   2e-08
UniRef50_Q4P7Y2 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3; Methanosarc...    62   2e-08
UniRef50_Q9LUW5 Cluster: DEAD-box ATP-dependent RNA helicase 53;...    62   2e-08
UniRef50_Q8YH70 Cluster: ATP-DEPENDENT RNA HELICASE RHLE; n=10; ...    61   3e-08
UniRef50_Q41F45 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    61   3e-08
UniRef50_Q1FMF9 Cluster: Helicase-like:DbpA, RNA-binding:DEAD/DE...    61   3e-08
UniRef50_A0VLH7 Cluster: DEAD/DEAH box helicase domain protein; ...    61   3e-08
UniRef50_A4RYJ1 Cluster: Predicted protein; n=3; Ostreococcus|Re...    61   3e-08
UniRef50_Q4QC38 Cluster: RNA helicase, putative; n=7; Trypanosom...    61   3e-08
UniRef50_A2EVI2 Cluster: DEAD/DEAH box helicase family protein; ...    61   3e-08
UniRef50_Q27268 Cluster: ATP-dependent RNA helicase WM6; n=82; E...    61   3e-08
UniRef50_Q5T1V6 Cluster: Probable ATP-dependent RNA helicase DDX...    61   3e-08
UniRef50_Q7RYZ7 Cluster: ATP-dependent RNA helicase dbp-8; n=15;...    61   3e-08
UniRef50_UPI0000DB7226 Cluster: PREDICTED: similar to Probable A...    61   3e-08
UniRef50_Q44NG9 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    61   3e-08
UniRef50_Q1IMK6 Cluster: DEAD/DEAH box helicase-like; n=1; Acido...    61   3e-08
UniRef50_A0UX17 Cluster: DEAD/DEAH box helicase-like; n=5; Clost...    61   3e-08
UniRef50_A3AD37 Cluster: Putative uncharacterized protein; n=2; ...    61   3e-08
UniRef50_Q22308 Cluster: Putative uncharacterized protein; n=7; ...    61   3e-08
UniRef50_Q56XG6 Cluster: DEAD-box ATP-dependent RNA helicase 15;...    61   3e-08
UniRef50_Q5KME7 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    61   3e-08
UniRef50_Q9K7L3 Cluster: RNA helicase; n=2; Bacillus|Rep: RNA he...    60   4e-08
UniRef50_Q7VFA9 Cluster: ATP-dependent RNA helicase DeaD; n=6; H...    60   4e-08
UniRef50_Q62IF8 Cluster: ATP-dependent RNA helicase RhlE; n=59; ...    60   4e-08
UniRef50_Q4AEL1 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    60   4e-08
UniRef50_Q41FS1 Cluster: IMP dehydrogenase/GMP reductase:Helicas...    60   4e-08
UniRef50_Q0M1B5 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    60   4e-08
UniRef50_A6NSW7 Cluster: Putative uncharacterized protein; n=1; ...    60   4e-08
UniRef50_A6GPV2 Cluster: Helicase; n=1; Limnobacter sp. MED105|R...    60   4e-08
UniRef50_Q4QJG6 Cluster: ATP-dependent RNA helicase, putative; n...    60   4e-08
UniRef50_Q2LZJ8 Cluster: GA19670-PA; n=1; Drosophila pseudoobscu...    60   4e-08
UniRef50_Q9ZRZ8 Cluster: DEAD-box ATP-dependent RNA helicase 28;...    60   4e-08
UniRef50_Q5KNF8 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    60   4e-08
UniRef50_Q9BUQ8 Cluster: Probable ATP-dependent RNA helicase DDX...    60   4e-08
UniRef50_Q1LSH5 Cluster: DEAD/DEAH box helicase-like protein pre...    60   6e-08
UniRef50_Q12B10 Cluster: DEAD/DEAH box helicase-like; n=13; Prot...    60   6e-08
UniRef50_Q7A4G0 Cluster: Probable DEAD-box ATP-dependent RNA hel...    60   6e-08
UniRef50_O49289 Cluster: Putative DEAD-box ATP-dependent RNA hel...    60   6e-08
UniRef50_UPI0001509D93 Cluster: DEAD/DEAH box helicase family pr...    60   8e-08
UniRef50_UPI0000E48294 Cluster: PREDICTED: similar to DEAD (Asp-...    60   8e-08
UniRef50_Q6YPL1 Cluster: Superfamily II DNA and RNA helicase; n=...    60   8e-08
UniRef50_Q6MQY6 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    60   8e-08
UniRef50_Q087U7 Cluster: DEAD/DEAH box helicase domain protein; ...    60   8e-08
UniRef50_Q7QQ49 Cluster: GLP_139_12217_14094; n=1; Giardia lambl...    60   8e-08
UniRef50_Q16XX4 Cluster: DEAD box ATP-dependent RNA helicase; n=...    60   8e-08
UniRef50_Q4WRP2 Cluster: ATP-dependent RNA helicase mss116, mito...    60   8e-08
UniRef50_Q9KKW0 Cluster: ATP-dependent RNA helicase, DEAD box fa...    59   1e-07
UniRef50_Q8EPZ1 Cluster: ATP-dependent RNA helicase; n=2; Bacill...    59   1e-07
UniRef50_Q835K0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    59   1e-07
UniRef50_Q4FSS4 Cluster: Possible ATP-dependent DEAD/DEAH box RN...    59   1e-07
UniRef50_Q2BGG8 Cluster: RNA helicase DbpA; n=1; Neptuniibacter ...    59   1e-07
UniRef50_A7HG33 Cluster: DEAD/DEAH box helicase domain protein; ...    59   1e-07
UniRef50_A7CUH7 Cluster: DEAD/DEAH box helicase domain protein; ...    59   1e-07
UniRef50_Q019E9 Cluster: ATP-dependent RNA helicase; n=2; Ostreo...    59   1e-07
UniRef50_Q688Z4 Cluster: Putative uncharacterized protein; n=3; ...    59   1e-07
UniRef50_Q389T9 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    59   1e-07
UniRef50_Q1JSQ3 Cluster: Dead-box helicase, putative; n=1; Toxop...    59   1e-07
UniRef50_Q17II7 Cluster: DEAD box ATP-dependent RNA helicase; n=...    59   1e-07
UniRef50_A0BPV0 Cluster: Chromosome undetermined scaffold_12, wh...    59   1e-07
UniRef50_A0RUV7 Cluster: Superfamily II helicase; n=3; Thermopro...    59   1e-07
UniRef50_Q58083 Cluster: Probable ATP-dependent RNA helicase MJ0...    59   1e-07
UniRef50_P20449 Cluster: ATP-dependent RNA helicase DBP5; n=23; ...    59   1e-07
UniRef50_Q1N6E2 Cluster: ATP-dependent RNA helicase; n=1; Oceano...    59   1e-07
UniRef50_Q0BSI7 Cluster: ATP-dependent RNA helicase; n=12; Alpha...    59   1e-07
UniRef50_A4V6K5 Cluster: DEAD box polypeptide 19 protein; n=3; P...    59   1e-07
UniRef50_A0CZH3 Cluster: Chromosome undetermined scaffold_32, wh...    59   1e-07
UniRef50_A4RHM4 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_Q9Y7T7 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    59   1e-07
UniRef50_Q9Y6V7 Cluster: Probable ATP-dependent RNA helicase DDX...    59   1e-07
UniRef50_P20448 Cluster: ATP-dependent RNA helicase DBP4; n=13; ...    59   1e-07
UniRef50_Q5GRS8 Cluster: Superfamily II DNA/RNA helicase; n=4; W...    58   2e-07
UniRef50_Q31EF0 Cluster: ATP-dependent RNA helicase; n=1; Thiomi...    58   2e-07
UniRef50_A6QC93 Cluster: ATP-independent RNA helicase DbpA; n=1;...    58   2e-07
UniRef50_Q9H0S4 Cluster: Probable ATP-dependent RNA helicase DDX...    58   2e-07
UniRef50_Q96GQ7 Cluster: Probable ATP-dependent RNA helicase DDX...    58   2e-07
UniRef50_UPI000155CE2F Cluster: PREDICTED: similar to R27090_2; ...    58   2e-07
UniRef50_Q836U7 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    58   2e-07
UniRef50_Q7MT81 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    58   2e-07
UniRef50_Q30P62 Cluster: DEAD/DEAH box helicase-like; n=1; Thiom...    58   2e-07
UniRef50_A6W6A7 Cluster: DEAD/DEAH box helicase domain protein; ...    58   2e-07
UniRef50_A6G4U7 Cluster: DEAD/DEAH box helicase; n=2; Plesiocyst...    58   2e-07
UniRef50_Q013X8 Cluster: DEAD/DEAH box RNA helicase; n=1; Ostreo...    58   2e-07
UniRef50_Q4UA43 Cluster: DEAD-family helicase, putative; n=3; Pi...    58   2e-07
UniRef50_A1IIT5 Cluster: RNA helicase; n=1; Neobenedenia girella...    58   2e-07
UniRef50_Q55RL6 Cluster: Putative uncharacterized protein; n=2; ...    58   2e-07
UniRef50_Q3EBD3 Cluster: DEAD-box ATP-dependent RNA helicase 41;...    58   2e-07
UniRef50_UPI0000DAE40A Cluster: hypothetical protein Rgryl_01000...    58   3e-07
UniRef50_Q6A841 Cluster: Putative ATP-dependent RNA helicase; n=...    58   3e-07
UniRef50_Q6A6U7 Cluster: ATP-dependent RNA helicase; n=3; Actino...    58   3e-07
UniRef50_Q30SZ2 Cluster: DEAD/DEAH box helicase-like; n=1; Thiom...    58   3e-07
UniRef50_A5EYB1 Cluster: ATP-dependent rna helicase Rhl; n=2; Ga...    58   3e-07
UniRef50_A0M3C7 Cluster: RhlE-like DEAD box family ATP-dependent...    58   3e-07
UniRef50_Q3LWF0 Cluster: ATP-dependent RNA helicase; n=1; Bigelo...    58   3e-07
UniRef50_Q95QN2 Cluster: Putative uncharacterized protein; n=2; ...    58   3e-07
UniRef50_Q5D9C4 Cluster: SJCHGC09528 protein; n=1; Schistosoma j...    58   3e-07
UniRef50_Q54TJ4 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_A2EQ41 Cluster: DEAD/DEAH box helicase family protein; ...    58   3e-07
UniRef50_A4UCU0 Cluster: DEAD box polypeptide 47 isoform 1 varia...    58   3e-07
UniRef50_O74393 Cluster: ATP-dependent RNA helicase mak5; n=1; S...    58   3e-07
UniRef50_Q5KIK3 Cluster: ATP-dependent RNA helicase DRS1; n=1; F...    58   3e-07
UniRef50_Q4V836 Cluster: MGC114699 protein; n=9; Deuterostomia|R...    57   4e-07
UniRef50_Q5FS73 Cluster: ATP-dependent RNA helicase; n=2; Glucon...    57   4e-07
UniRef50_Q1U8H0 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    57   4e-07
UniRef50_Q11U28 Cluster: ATP-dependent RNA helicase protein; n=4...    57   4e-07
UniRef50_Q7QQX6 Cluster: GLP_383_7421_6129; n=1; Giardia lamblia...    57   4e-07
UniRef50_Q7QA96 Cluster: ENSANGP00000013118; n=5; Eumetazoa|Rep:...    57   4e-07
UniRef50_Q54Y81 Cluster: Putative RNA helicase; n=2; Dictyosteli...    57   4e-07
UniRef50_Q4Q1N9 Cluster: DEAD box RNA helicase, putative; n=5; T...    57   4e-07
UniRef50_A7U5W7 Cluster: DEAD-box helicase 2; n=6; Plasmodium|Re...    57   4e-07
UniRef50_A2EAD4 Cluster: DEAD/DEAH box helicase family protein; ...    57   4e-07
UniRef50_Q9NR30 Cluster: Nucleolar RNA helicase 2; n=51; Euteleo...    57   4e-07
UniRef50_Q8F0Q7 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    57   6e-07
UniRef50_Q2S6I0 Cluster: ATP-dependent RNA helicase; n=1; Salini...    57   6e-07
UniRef50_Q1WSN6 Cluster: ATP-dependent RNA helicase; n=1; Lactob...    57   6e-07
UniRef50_Q0LVA0 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    57   6e-07
UniRef50_A3I404 Cluster: Putative uncharacterized protein; n=1; ...    57   6e-07
UniRef50_Q17BP5 Cluster: DEAD box ATP-dependent RNA helicase; n=...    57   6e-07
UniRef50_A5KB15 Cluster: ATP-dependent RNA helicase, putative; n...    57   6e-07
UniRef50_A5K9H3 Cluster: Pre-mRNA splicing factor RNA helicase P...    57   6e-07
UniRef50_A2DP01 Cluster: DEAD/DEAH box helicase family protein; ...    57   6e-07
UniRef50_Q5BF42 Cluster: Putative uncharacterized protein; n=1; ...    57   6e-07
UniRef50_A7ETZ1 Cluster: Putative uncharacterized protein; n=1; ...    57   6e-07
UniRef50_A7ECJ8 Cluster: Putative uncharacterized protein; n=1; ...    57   6e-07
UniRef50_P0C2N8 Cluster: ATP-dependent RNA helicase drs-1; n=16;...    57   6e-07
UniRef50_P20447 Cluster: ATP-dependent RNA helicase DBP3; n=20; ...    57   6e-07
UniRef50_Q8SRB2 Cluster: ATP-dependent RNA helicase DBP2; n=103;...    57   6e-07
UniRef50_UPI0001553738 Cluster: PREDICTED: hypothetical protein;...    56   7e-07
UniRef50_UPI00003C8469 Cluster: hypothetical protein Faci_030017...    56   7e-07
UniRef50_A4AFV6 Cluster: ATP-dependent RNA helicase; n=3; Actino...    56   7e-07
UniRef50_A3WBM2 Cluster: Cold-shock dead-box protein A; n=1; Ery...    56   7e-07
UniRef50_A2WLP5 Cluster: Putative uncharacterized protein; n=3; ...    56   7e-07
UniRef50_Q8I0W7 Cluster: Snrnp protein, putative; n=6; Plasmodiu...    56   7e-07
UniRef50_A6SDG8 Cluster: Putative uncharacterized protein; n=1; ...    56   7e-07
UniRef50_Q6FML5 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    56   7e-07
UniRef50_UPI00004994C0 Cluster: DEAD/DEAH box helicase; n=2; Ent...    56   1e-06
UniRef50_A5FH33 Cluster: DEAD/DEAH box helicase domain protein; ...    56   1e-06
UniRef50_Q95XM9 Cluster: Putative uncharacterized protein; n=2; ...    56   1e-06
UniRef50_Q7K4L8 Cluster: LD33749p; n=1; Drosophila melanogaster|...    56   1e-06
UniRef50_Q54CD6 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_Q4UG97 Cluster: ATP-dependent RNA helicase, putative; n...    56   1e-06
UniRef50_A2DB16 Cluster: DEAD/DEAH box helicase family protein; ...    56   1e-06
UniRef50_P19109 Cluster: ATP-dependent RNA helicase p62; n=9; Eu...    56   1e-06
UniRef50_Q9LYJ9 Cluster: DEAD-box ATP-dependent RNA helicase 46;...    56   1e-06
UniRef50_P93008 Cluster: DEAD-box ATP-dependent RNA helicase 21;...    56   1e-06
UniRef50_Q4P9P3 Cluster: ATP-dependent RNA helicase DRS1; n=1; U...    56   1e-06
UniRef50_Q09903 Cluster: ATP-dependent RNA helicase drs1; n=1; S...    56   1e-06
UniRef50_P0C2N7 Cluster: ATP-dependent RNA helicase DRS1; n=2; C...    56   1e-06
UniRef50_Q4SJI2 Cluster: Chromosome 4 SCAF14575, whole genome sh...    56   1e-06
UniRef50_Q2J919 Cluster: Helicase-like; n=3; Frankia|Rep: Helica...    56   1e-06
UniRef50_A6VWX2 Cluster: DEAD/DEAH box helicase domain protein; ...    56   1e-06
UniRef50_A2U4F0 Cluster: Putative ATP-dependent RNA helicase; n=...    56   1e-06
UniRef50_Q9VXW2 Cluster: CG6227-PA; n=11; Coelomata|Rep: CG6227-...    56   1e-06
UniRef50_Q5CWD0 Cluster: Prp5p C terminal KH. eIF4A-1-family RNA...    56   1e-06
UniRef50_Q17KA8 Cluster: DEAD box ATP-dependent RNA helicase; n=...    56   1e-06
UniRef50_A7AWS5 Cluster: DEAD/DEAH box helicase and helicase con...    56   1e-06
UniRef50_A2DGJ7 Cluster: DEAD/DEAH box helicase family protein; ...    56   1e-06
UniRef50_A6QYH1 Cluster: 2-isopropylmalate synthase; n=4; Ascomy...    56   1e-06
UniRef50_Q9M2F9 Cluster: DEAD-box ATP-dependent RNA helicase 52;...    56   1e-06
UniRef50_Q8H0U8 Cluster: DEAD-box ATP-dependent RNA helicase 42;...    56   1e-06
UniRef50_Q9SQV1 Cluster: Probable DEAD-box ATP-dependent RNA hel...    56   1e-06
UniRef50_A5DU73 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    56   1e-06
UniRef50_UPI00015B61D8 Cluster: PREDICTED: similar to vasa-like ...    55   2e-06
UniRef50_A6PQ62 Cluster: DEAD/DEAH box helicase domain protein; ...    55   2e-06
UniRef50_A6DL95 Cluster: Probable ATP-dependent RNA helicase; n=...    55   2e-06
UniRef50_A6DHU9 Cluster: DEAD/DEAH box helicase-like protein; n=...    55   2e-06
UniRef50_Q9SWV9 Cluster: Ethylene-responsive RNA helicase; n=5; ...    55   2e-06
UniRef50_Q9N5K1 Cluster: Putative uncharacterized protein; n=2; ...    55   2e-06
UniRef50_Q8I416 Cluster: ATP-dependent RNA helicase, putative; n...    55   2e-06
UniRef50_Q4Z5Q6 Cluster: ATP-dependent RNA helicase, putative; n...    55   2e-06
UniRef50_Q4QIG1 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    55   2e-06
UniRef50_A2DES1 Cluster: DEAD/DEAH box helicase family protein; ...    55   2e-06
UniRef50_Q53FI9 Cluster: Nucleolar protein GU2 variant; n=3; Eut...    55   2e-06
UniRef50_Q9HXE5 Cluster: ATP-dependent RNA helicase rhlB; n=22; ...    55   2e-06
UniRef50_Q9C551 Cluster: DEAD-box ATP-dependent RNA helicase 5; ...    55   2e-06
UniRef50_Q8L7S8 Cluster: DEAD-box ATP-dependent RNA helicase 3; ...    55   2e-06
UniRef50_Q754U8 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    55   2e-06
UniRef50_Q9VHP0 Cluster: ATP-dependent RNA helicase bel; n=4; Pr...    55   2e-06
UniRef50_Q8D563 Cluster: Superfamily II DNA and RNA helicase; n=...    55   2e-06
UniRef50_Q3SF48 Cluster: DEAD/DEAH box helicase; n=6; cellular o...    55   2e-06
UniRef50_Q28T45 Cluster: DEAD/DEAH box helicase-like protein; n=...    55   2e-06
UniRef50_Q11WD3 Cluster: Possible ATP-dependent RNA helicase; n=...    55   2e-06
UniRef50_Q9N478 Cluster: Putative uncharacterized protein; n=2; ...    55   2e-06
UniRef50_Q7R0K7 Cluster: GLP_154_39979_41331; n=1; Giardia lambl...    55   2e-06
UniRef50_Q4QIQ9 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    55   2e-06
UniRef50_Q4N5F8 Cluster: ATP-dependent RNA helicase, putative; n...    55   2e-06
UniRef50_Q234J0 Cluster: DEAD/DEAH box helicase family protein; ...    55   2e-06
UniRef50_A2ED04 Cluster: DEAD/DEAH box helicase family protein; ...    55   2e-06
UniRef50_Q1E273 Cluster: Putative uncharacterized protein; n=2; ...    55   2e-06
UniRef50_Q8SR63 Cluster: ATP-dependent rRNA helicase RRP3; n=1; ...    55   2e-06
UniRef50_Q5N7W4 Cluster: DEAD-box ATP-dependent RNA helicase 30;...    55   2e-06
UniRef50_A4RK80 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    55   2e-06
UniRef50_UPI0000F1F65D Cluster: PREDICTED: hypothetical protein;...    54   3e-06
UniRef50_Q92AT6 Cluster: Lin1833 protein; n=13; Listeria|Rep: Li...    54   3e-06
UniRef50_Q2J6D3 Cluster: DEAD/DEAH box helicase-like; n=2; Frank...    54   3e-06
UniRef50_O54116 Cluster: Probable DEAD-box RNA helicase; n=10; S...    54   3e-06
UniRef50_Q1J0S9 Cluster: DEAD/DEAH box helicase-like protein; n=...    54   3e-06
UniRef50_O07897 Cluster: Heat resistant RNA dependent ATPase; n=...    54   3e-06
UniRef50_A4BHZ9 Cluster: ATP-dependent RNA helicase; n=1; Reinek...    54   3e-06
UniRef50_Q01EH4 Cluster: Ddx49 Ddx49-related DEAD box helicase s...    54   3e-06
UniRef50_A7TJK8 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_Q8EJQ5 Cluster: ATP-dependent RNA helicase rhlB; n=62; ...    54   3e-06
UniRef50_Q88NB7 Cluster: ATP-dependent RNA helicase rhlB; n=18; ...    54   3e-06
UniRef50_P21372 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    54   3e-06
UniRef50_P32892 Cluster: ATP-dependent RNA helicase DRS1; n=13; ...    54   3e-06
UniRef50_UPI00006CDDA3 Cluster: CLN3 protein; n=1; Tetrahymena t...    54   4e-06
UniRef50_Q32LU9 Cluster: LOC562123 protein; n=3; Danio rerio|Rep...    54   4e-06
UniRef50_Q5NN72 Cluster: DNA and RNA helicase; n=3; Sphingomonad...    54   4e-06
UniRef50_A0KXT6 Cluster: DEAD/DEAH box helicase domain protein; ...    54   4e-06
UniRef50_A0JYP4 Cluster: DEAD/DEAH box helicase domain protein; ...    54   4e-06
UniRef50_A4S6F2 Cluster: Predicted protein; n=1; Ostreococcus lu...    54   4e-06
UniRef50_A4RW46 Cluster: Predicted protein; n=2; Ostreococcus|Re...    54   4e-06
UniRef50_Q7PMT7 Cluster: ENSANGP00000010668; n=1; Anopheles gamb...    54   4e-06
UniRef50_Q6BFH3 Cluster: Nucleolar RNA helicase II, putative; n=...    54   4e-06
UniRef50_Q4JF01 Cluster: Vasa homlogue; n=2; Eukaryota|Rep: Vasa...    54   4e-06
UniRef50_Q388E8 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    54   4e-06
UniRef50_Q2PZC2 Cluster: Vasa protein; n=3; Apidae|Rep: Vasa pro...    54   4e-06
UniRef50_Q22T03 Cluster: DEAD/DEAH box helicase family protein; ...    54   4e-06
UniRef50_Q1AG34 Cluster: Ded1-like DEAD-box RNA helicase; n=1; C...    54   4e-06
UniRef50_A0CUN8 Cluster: Chromosome undetermined scaffold_28, wh...    54   4e-06
UniRef50_O22907 Cluster: DEAD-box ATP-dependent RNA helicase 24;...    54   4e-06
UniRef50_Q6C024 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    54   4e-06
UniRef50_Q07886 Cluster: Probable ATP-dependent RNA helicase Dbp...    54   4e-06
UniRef50_Q03GJ4 Cluster: Superfamily II DNA and RNA helicase; n=...    54   5e-06
UniRef50_A1UCR5 Cluster: DEAD/DEAH box helicase domain protein; ...    54   5e-06
UniRef50_A7P8T9 Cluster: Chromosome chr3 scaffold_8, whole genom...    54   5e-06
UniRef50_A4S107 Cluster: Predicted protein; n=1; Ostreococcus lu...    54   5e-06
UniRef50_Q869K2 Cluster: Similar to Dictyostelium discoideum (Sl...    54   5e-06
UniRef50_Q7QTB2 Cluster: GLP_15_13424_14974; n=2; Giardia intest...    54   5e-06
UniRef50_Q7QNT5 Cluster: GLP_88_2286_3572; n=1; Giardia lamblia ...    54   5e-06
UniRef50_Q65XX1 Cluster: Vasa-and belle-like helicase protein 1,...    54   5e-06
UniRef50_Q4Q2Z6 Cluster: ATP-dependent RNA helicase, putative; n...    54   5e-06
UniRef50_A7RY08 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    54   5e-06
UniRef50_A7RMK9 Cluster: Predicted protein; n=1; Nematostella ve...    54   5e-06
UniRef50_A2G6R5 Cluster: DEAD/DEAH box helicase family protein; ...    54   5e-06
UniRef50_A4QQK0 Cluster: Putative uncharacterized protein; n=3; ...    54   5e-06
UniRef50_Q10RI7 Cluster: DEAD-box ATP-dependent RNA helicase 38;...    54   5e-06
UniRef50_Q8GY84 Cluster: DEAD-box ATP-dependent RNA helicase 10;...    54   5e-06
UniRef50_O00571 Cluster: ATP-dependent RNA helicase DDX3X; n=74;...    54   5e-06
UniRef50_P38719 Cluster: ATP-dependent RNA helicase DBP8; n=14; ...    54   5e-06
UniRef50_Q4PEX7 Cluster: ATP-dependent RNA helicase DBP8; n=1; U...    54   5e-06
UniRef50_Q5BFU7 Cluster: ATP-dependent RNA helicase dbp10; n=14;...    54   5e-06
UniRef50_UPI00015B5D7B Cluster: PREDICTED: similar to LD28101p; ...    53   7e-06
UniRef50_UPI0000F1E5FF Cluster: PREDICTED: similar to Pl10, part...    53   7e-06
UniRef50_UPI00005A557C Cluster: PREDICTED: similar to eukaryotic...    53   7e-06
UniRef50_Q8A8L3 Cluster: ATP-independent RNA helicase; n=7; Bact...    53   7e-06
UniRef50_Q0HLM7 Cluster: DEAD/DEAH box helicase domain protein; ...    53   7e-06
UniRef50_Q965K2 Cluster: Putative uncharacterized protein; n=2; ...    53   7e-06
UniRef50_Q5CKB1 Cluster: ATP-dependent RNA helicase; n=2; Crypto...    53   7e-06
UniRef50_Q4Y0X7 Cluster: DEAD-box RNA helicase, putative; n=2; P...    53   7e-06
UniRef50_A7TRT2 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_P25808 Cluster: ATP-dependent rRNA helicase SPB4; n=10;...    53   7e-06
UniRef50_Q4P9E5 Cluster: ATP-dependent rRNA helicase SPB4; n=2; ...    53   7e-06
UniRef50_Q9SF41 Cluster: DEAD-box ATP-dependent RNA helicase 45;...    53   7e-06
UniRef50_Q93ZG7 Cluster: DEAD-box ATP-dependent RNA helicase 38;...    53   7e-06
UniRef50_Q09719 Cluster: ATP-dependent RNA helicase dbp10; n=2; ...    53   7e-06
UniRef50_Q6NHC6 Cluster: Putative RNA helicase; n=2; Corynebacte...    53   9e-06
UniRef50_A1FEC3 Cluster: DEAD/DEAH box helicase-like; n=21; Gamm...    53   9e-06
UniRef50_A5BHG9 Cluster: Putative uncharacterized protein; n=1; ...    53   9e-06
UniRef50_A4S3A0 Cluster: Predicted protein; n=2; Ostreococcus|Re...    53   9e-06
UniRef50_Q9N341 Cluster: Putative uncharacterized protein; n=2; ...    53   9e-06
UniRef50_Q5BYH3 Cluster: SJCHGC05414 protein; n=1; Schistosoma j...    53   9e-06
UniRef50_Q4Q1P0 Cluster: DEAD box RNA helicase, putative; n=5; T...    53   9e-06
UniRef50_Q24I45 Cluster: DEAD/DEAH box helicase family protein; ...    53   9e-06
UniRef50_A4V6K8 Cluster: Putative RNA helicase protein; n=1; Dug...    53   9e-06
UniRef50_A3QMD4 Cluster: Putative uncharacterized protein mel-46...    53   9e-06
UniRef50_A2DH37 Cluster: DEAD/DEAH box helicase family protein; ...    53   9e-06
UniRef50_A1XCP2 Cluster: Vasa-like protein; n=2; Coelomata|Rep: ...    53   9e-06
UniRef50_Q66HG7 Cluster: Probable ATP-dependent RNA helicase DDX...    53   9e-06
UniRef50_P34640 Cluster: Probable ATP-dependent RNA helicase DDX...    53   9e-06
UniRef50_Q8TDD1 Cluster: ATP-dependent RNA helicase DDX54; n=45;...    53   9e-06
UniRef50_Q5KHB7 Cluster: ATP-dependent RNA helicase DBP3; n=2; F...    53   9e-06
UniRef50_UPI00006CA44F Cluster: DEAD/DEAH box helicase family pr...    52   1e-05
UniRef50_UPI00004988F8 Cluster: DEAD/DEAH box helicase; n=1; Ent...    52   1e-05
UniRef50_UPI00003937F7 Cluster: COG0513: Superfamily II DNA and ...    52   1e-05
UniRef50_Q8G5U3 Cluster: Possible ATP-dependent RNA helicase; n=...    52   1e-05
UniRef50_Q6APU7 Cluster: Related to ATP-dependent RNA helicase; ...    52   1e-05
UniRef50_Q30YG9 Cluster: DEAD/DEAH box helicase-like; n=3; Delta...    52   1e-05
UniRef50_Q2Z064 Cluster: Probable ATP-dependent RNA helicase; n=...    52   1e-05
UniRef50_A1USG3 Cluster: DEAD/DEAH box helicase domain/helicase ...    52   1e-05
UniRef50_Q54CB8 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q4UBP8 Cluster: RNA helicase, putative; n=4; Eukaryota|...    52   1e-05
UniRef50_O97032 Cluster: DjVLGB; n=2; Dugesia|Rep: DjVLGB - Duge...    52   1e-05
UniRef50_A7AV91 Cluster: DEAD/DEAH box helicase, putative; n=1; ...    52   1e-05

>UniRef50_P38919 Cluster: Eukaryotic initiation factor 4A-III;
           n=366; root|Rep: Eukaryotic initiation factor 4A-III -
           Homo sapiens (Human)
          Length = 411

 Score =  176 bits (428), Expect = 6e-43
 Identities = 104/214 (48%), Positives = 134/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV
Sbjct: 87  GKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV 146

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 147 GEDIRKLDYGQHVVAGTPGRVFDMIR-RRSLRTRA-----IKML----VLDEADEMLNKG 196

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 197 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV 256

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 257 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 290



 Score =  116 bits (280), Expect = 5e-25
 Identities = 68/169 (40%), Positives = 99/169 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 173 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF 232

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 233 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 292

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 293 LTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVL-ISTDVWARG 340



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 291 DWLTEKMREANFTVSSMHG 309


>UniRef50_Q14240 Cluster: Eukaryotic initiation factor 4A-II; n=37;
           Bilateria|Rep: Eukaryotic initiation factor 4A-II - Homo
           sapiens (Human)
          Length = 407

 Score =  170 bits (413), Expect = 4e-41
 Identities = 98/208 (47%), Positives = 137/208 (65%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQIQKV++ALGD++ A CHACIGGTNV
Sbjct: 82  GKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNV 141

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R ++++L++   H+VVGTPGRV+DM L  R++ +P  ++ +  L +    +SR       
Sbjct: 142 RNEMQKLQAEAPHIVVGTPGRVFDM-LNRRYL-SP-KWIKMFVLDEADEMLSRGFKDQIY 198

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEE 525
              Q +  S   +L    M    L+   + +      L +++ L  + +  F   +E EE
Sbjct: 199 EIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREE 258

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 259 WKLDTLCDLYETLTITQAVIFLNTRRKV 286



 Score =  135 bits (327), Expect = 1e-30
 Identities = 81/169 (47%), Positives = 105/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+++F+ L+  +QV+LLSATMP DVLEV++ F
Sbjct: 169 RRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKF 228

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 229 MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 288

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 289 LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 336



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 252 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 305


>UniRef50_A2AAP7 Cluster: DEAD (Asp-Glu-Ala-Asp) box polypeptide 48;
           n=5; Fungi/Metazoa group|Rep: DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 48 - Mus musculus (Mouse)
          Length = 299

 Score =  122 bits (294), Expect = 1e-26
 Identities = 87/214 (40%), Positives = 116/214 (54%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFS+S+LQ +D      Q L+                ALGD++N +CHACIGGTNV
Sbjct: 87  GKTATFSVSVLQCLDI-----QGLL----------------ALGDYMNVQCHACIGGTNV 125

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 126 GEDIRKLDYGQHVVAGTPGRVFDMIR-RRSLRTRA-----IKML----VLDEADEMLNKG 175

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 176 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV 235

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 236 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 269



 Score =  112 bits (269), Expect = 1e-23
 Identities = 49/84 (58%), Positives = 70/84 (83%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 152 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF 211

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           M DP+RILV+++ELTLEGIKQF++
Sbjct: 212 MTDPIRILVKRDELTLEGIKQFFV 235



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 270 DWLTEKMREANFTVSSMHG 288


>UniRef50_UPI000065E01D Cluster: Homolog of Brachydanio rerio
           "Eukaryotic translation initiation factor 4A, isoform
           1A.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio
           rerio "Eukaryotic translation initiation factor 4A,
           isoform 1A. - Takifugu rubripes
          Length = 357

 Score =  115 bits (276), Expect = 1e-24
 Identities = 53/84 (63%), Positives = 69/84 (82%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RRA+ A  I+L VLDEAD+ML  GFKDQIH++F  L  +VQ ILLSATMP  VLE ++ F
Sbjct: 119 RRAVSAKAIRLLVLDEADQMLGNGFKDQIHEIFCKLPTNVQAILLSATMPAHVLEATKMF 178

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           M+DPV+IL+++EELT+EGI+QFY+
Sbjct: 179 MQDPVKILIKREELTMEGIQQFYI 202



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 27/42 (64%), Positives = 34/42 (80%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIA 126
           GKTAT+ I+ LQ+ID    + QA+ILAPTRELA QIQKVV++
Sbjct: 70  GKTATYVIAALQRIDMMKEDTQAIILAPTRELANQIQKVVLS 111



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +1

Query: 460 LYRRKSLPWKVLNNFTC-IELEEWKLETLCDLYDTLSIAQAVIFCNTRRK 606
           L +R+ L  + +  F    E EE KLE+LC LY TL+I QAVIF NTR+K
Sbjct: 186 LIKREELTMEGIQQFYIKTETEEKKLESLCGLYSTLTITQAVIFVNTRKK 235


>UniRef50_A0BEU9 Cluster: Chromosome undetermined scaffold_102,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_102,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 395

 Score =  113 bits (273), Expect = 3e-24
 Identities = 63/205 (30%), Positives = 110/205 (53%), Gaps = 3/205 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT   S+S+L   D S+++ Q LIL  TR+L ++   +++ALG  LN   HAC  G ++
Sbjct: 71  GKTTVMSLSVLSIFDLSVKKIQVLILQKTRKLTEENAGLIMALGKFLNVSIHACSEGNSI 130

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           ++DI  ++ GV +V+GTP RV++++            + L +  +    +  ++S++   
Sbjct: 131 QDDISVVQQGVQIVLGTPDRVFELVQRKEISFAHLKMIILDEADEML--IDESKSLVYCI 188

Query: 361 FCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNFTC-IELEEWK 531
           F  L  K  Y L+   +      +++         + +R  L  + +  F   ++ E+WK
Sbjct: 189 FKYLPPKPQYVLVTATLSQDILDFIEKFFNNPLVIMDKRNELTLEGIQQFFIQVDKEDWK 248

Query: 532 LETLCDLYDTLSIAQAVIFCNTRRK 606
            ETLCDLY+  SI Q+VIFC T++K
Sbjct: 249 FETLCDLYEIASITQSVIFCQTKQK 273


>UniRef50_Q23U16 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Tetrahymena thermophila SB210|Rep: DEAD/DEAH box
           helicase family protein - Tetrahymena thermophila SB210
          Length = 475

 Score =  107 bits (256), Expect = 4e-22
 Identities = 48/84 (57%), Positives = 67/84 (79%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  + +KLF+LDEADEML RGFKDQI+ +F+ L  D+QV L SATM  ++LE+++ F
Sbjct: 236 KKTLVTDHLKLFILDEADEMLGRGFKDQINKIFQNLPHDIQVALFSATMAPEILEITKQF 295

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           MRDP  ILV+ ++LTL+GIKQFY+
Sbjct: 296 MRDPATILVKNDDLTLDGIKQFYI 319



 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 54/171 (31%), Positives = 89/171 (52%), Gaps = 4/171 (2%)
 Frame = +1

Query: 109 QKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSN 288
           +KV++ LG+ L    +AC GGT+ +ED ++L  GV VVVGTPGRV D+I     +   ++
Sbjct: 186 KKVIMYLGEFLKVSAYACTGGTDPKEDRKRLREGVQVVVGTPGRVLDLIQKKTLV---TD 242

Query: 289 FLFLMKLMKCCPEVSRTRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAY 459
            L L  L +    + R      ++  Q +       L    M  + L+   + +      
Sbjct: 243 HLKLFILDEADEMLGRGFKDQINKIFQNLPHDIQVALFSATMAPEILEITKQFMRDPATI 302

Query: 460 LYRRKSLPWKVLNNF-TCIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           L +   L    +  F   ++ EEWK +TL +LY+ + IAQA+I+CNT+++V
Sbjct: 303 LVKNDDLTLDGIKQFYIALDKEEWKFDTLVELYNNIEIAQAIIYCNTKKRV 353



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 32/48 (66%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQ-IQKVVIALGDHL 141
           GKTATFSI+ LQ IDTS    QALILAPTRELAQQ I ++   LG +L
Sbjct: 83  GKTATFSIATLQVIDTSSPHTQALILAPTRELAQQTITRIFFILGVNL 130


>UniRef50_A0D232 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 434

 Score =  104 bits (249), Expect = 3e-21
 Identities = 62/208 (29%), Positives = 114/208 (54%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT TF+I  LQ+ID + R+ Q +ILAP RELA+QI  VV  +G +LN +   CIGGT+ 
Sbjct: 105 GKTGTFTIGALQRIDPNQRKTQVIILAPVRELAKQIYDVVKGIGQYLNIEAFCCIGGTST 164

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           +E   + + GVH+++ TPGR+ DM   ++     + F+ L+ + +    + +  S   + 
Sbjct: 165 QETREKCKQGVHIIIATPGRLIDM---MKNKYLDATFMRLLVVDEADQMLDQGFSDNFAE 221

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----YAYLYRRKSLPWKVLNNF-TCIELEE 525
             +++       L       + ++   + L       L +++ L  + +  F   I+ E+
Sbjct: 222 ILKMVPGDIQIALFSATFPQEIIELSKQFLRDGTAKILVKKEQLTLEGIRQFYIAIQQED 281

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            K + L +LY  L+++Q+++FCN+++ V
Sbjct: 282 QKFKVLVELYKNLTVSQSILFCNSKKTV 309



 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 40/82 (48%), Positives = 62/82 (75%), Gaps = 1/82 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L A  ++L V+DEAD+ML +GF D   ++ K++  D+Q+ L SAT P +++E+S+ F+RD
Sbjct: 194 LDATFMRLLVVDEADQMLDQGFSDNFAEILKMVPGDIQIALFSATFPQEIIELSKQFLRD 253

Query: 447 -PVRILVQKEELTLEGIKQFYM 509
              +ILV+KE+LTLEGI+QFY+
Sbjct: 254 GTAKILVKKEQLTLEGIRQFYI 275


>UniRef50_Q0E2Q3 Cluster: Putative eukaryotic initiation factor
           4A-2; n=5; Oryza sativa|Rep: Putative eukaryotic
           initiation factor 4A-2 - Oryza sativa subsp. japonica
           (Rice)
          Length = 416

 Score =  101 bits (242), Expect = 2e-20
 Identities = 69/204 (33%), Positives = 101/204 (49%), Gaps = 4/204 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           G T T    ILQ++D +  ECQAL+L PT +LA + Q V+  LG  L+AK HA  GGT+ 
Sbjct: 95  GTTVTLCCGILQRLDYASTECQALVLVPTHDLAHETQNVIGVLGQFLSAKAHAFCGGTSA 154

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMK----LMKCCPEVSRTRSM 348
            ED + L +GV V VGTP  V  M+      P       L +    L     ++      
Sbjct: 155 HEDQQILSTGVQVAVGTPCHVLGMLQGRALCPDHIRMFVLDEADEVLRGFKDQIHGIIQF 214

Query: 349 MSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEEW 528
           + ++  Q  F S       L M  KY++   EI+       + +   V   +  +E E+ 
Sbjct: 215 LPTK-TQFGFFSASMSHEALEMCRKYMNKPVEIIVPRDEELEGI--NVKQFYVNVEKEDC 271

Query: 529 KLETLCDLYDTLSIAQAVIFCNTR 600
           KL+ LC L+DT+ I +++IF NTR
Sbjct: 272 KLDKLCGLFDTMEITRSIIFVNTR 295



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           RAL  + I++FVLDEADE+L RGFKDQIH + + L    Q    SA+M  + LE+ R +M
Sbjct: 182 RALCPDHIRMFVLDEADEVL-RGFKDQIHGIIQFLPTKTQFGFFSASMSHEALEMCRKYM 240

Query: 441 RDPVRILVQKEELTLEGI--KQFYMH 512
             PV I+V ++E  LEGI  KQFY++
Sbjct: 241 NKPVEIIVPRDE-ELEGINVKQFYVN 265


>UniRef50_P39517 Cluster: ATP-dependent RNA helicase DHH1; n=103;
           Eukaryota|Rep: ATP-dependent RNA helicase DHH1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 506

 Score =  101 bits (242), Expect = 2e-20
 Identities = 71/208 (34%), Positives = 105/208 (50%), Gaps = 3/208 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I  L+++   + + QALI+ PTRELA Q  +VV  LG H    C    GGTN+
Sbjct: 95  GKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNL 154

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSN-FLFLMKLMKCCPEVSRTRSMMSS 357
           R+DI +L   VH++VGTPGRV D  L  R +   S+  LF+M   +    +SR    +  
Sbjct: 155 RDDILRLNETVHILVGTPGRVLD--LASRKVADLSDCSLFIMD--EADKMLSRDFKTIIE 210

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYA--YLYRRKSLPWKVLNNFTCIELEEWK 531
           +    +  ++ SLL          + + + L+    +   + L  K +  +     E  K
Sbjct: 211 QILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQK 270

Query: 532 LETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           L  L  L+  L I QA+IFCN+  +V L
Sbjct: 271 LHCLNTLFSKLQINQAIIFCNSTNRVEL 298



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 34/84 (40%), Positives = 46/84 (54%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           +R+    +   LF++DEAD+MLSR FK  I  +   L    Q +L SAT P  V E    
Sbjct: 180 SRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVK 239

Query: 435 FMRDPVRILVQKEELTLEGIKQFY 506
            +  P  I +  EELTL+GI Q+Y
Sbjct: 240 HLHKPYEINLM-EELTLKGITQYY 262


>UniRef50_A2DVG1 Cluster: DEAD/DEAH box helicase family protein;
           n=3; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 478

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 40/81 (49%), Positives = 56/81 (69%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L     K+ VLDEAD+MLS  F +Q++D+ +    DVQ++L SAT+   +  +   FM D
Sbjct: 233 LRVQNFKMAVLDEADQMLSDNFIEQVNDIMEYFPEDVQILLFSATISQSIFHIMNTFMND 292

Query: 447 PVRILVQKEELTLEGIKQFYM 509
           P RIL++KE+LTLEGIKQFY+
Sbjct: 293 PFRILIKKEQLTLEGIKQFYV 313



 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 60/212 (28%), Positives = 98/212 (46%), Gaps = 9/212 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC-IGGTN 177
           GKT  FSI +L +ID S +  QAL+LAPTRELA QI  V   +G  +     A  IGG  
Sbjct: 142 GKTGAFSIGVLSKIDVSQKTTQALVLAPTRELATQIFNVFKEIGSRIPGLDIAIFIGGAQ 201

Query: 178 VREDIR-QLESGVHVVVGTPGRVYDMIL-----VVRFMPTPSNFLFLMKLMKCCPEVSRT 339
              D + +  S  H+ + TPGR  D+I+     V  F     +    M       +V+  
Sbjct: 202 RVVDAQARAASHPHICICTPGRALDLIVSGHLRVQNFKMAVLDEADQMLSDNFIEQVNDI 261

Query: 340 RSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIEL 519
                     L+F +  S        +  ++      +  L +++ L  + +  F  +++
Sbjct: 262 MEYFPEDVQILLFSATIS-----QSIFHIMNTFMNDPFRILIKKEQLTLEGIKQF-YVDV 315

Query: 520 EEW--KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           +E   K + L D+Y ++SI +A+IF N++  V
Sbjct: 316 QETSNKFDCLLDIYGSVSIQKAIIFANSKNAV 347


>UniRef50_Q4SP80 Cluster: Chromosome 15 SCAF14542, whole genome
           shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 15
           SCAF14542, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 366

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 59/137 (43%), Positives = 79/137 (57%)
 Frame = +3

Query: 354 FKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQFYMH*IRRMEA 533
           F+ LS ++QV+LLSATMP +VLEV++ FMRDPVRILV+KEELTLEGIKQFY++  R    
Sbjct: 160 FQKLSTNIQVVLLSATMPAEVLEVTKKFMRDPVRILVKKEELTLEGIKQFYINVEREEWK 219

Query: 534 GNSV*PV*YTVYCTSCNFLQHPSQGGIGSLNLCICVTLLYLLCMGDMDQREPEVIMKAVS 713
            +++  +  T+  T      +  +                    GDMDQ+E +VIM+   
Sbjct: 220 LDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFR 279

Query: 714 YWLLLVS*FTTDLWARG 764
                V   TTDL ARG
Sbjct: 280 SGSSRVL-ITTDLLARG 295



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 1/51 (1%)
 Frame = +1

Query: 460 LYRRKSLPWKVLNNFTC-IELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           L +++ L  + +  F   +E EEWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 195 LVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKV 245



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 26/35 (74%), Positives = 31/35 (88%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQ 105
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQ
Sbjct: 84  GKTATFAISILQQLEIDQKETQALVLAPTRELAQQ 118



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 211 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 264


>UniRef50_Q5KJI2 Cluster: ATP-dependent RNA helicase DHH1; n=4;
           Dikarya|Rep: ATP-dependent RNA helicase DHH1 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 625

 Score = 87.0 bits (206), Expect = 5e-16
 Identities = 68/212 (32%), Positives = 108/212 (50%), Gaps = 7/212 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA+F I  L +I+TS+   QALIL PTRELA Q  +V   LG H+ N +     GGT 
Sbjct: 85  GKTASFIIPTLNRINTSLSHIQALILVPTRELALQTSQVCKTLGAHIPNLQVMITTGGTT 144

Query: 178 VREDIRQLESGVHVVVGTPGRVYDM-ILVVRFMPTPSNFLF--LMKLMK--CCPEVSRTR 342
           +R+DI +L+  VH++VGTPGR+ D+    +  +     F+     KL+     P + +T 
Sbjct: 145 LRDDILRLQQPVHILVGTPGRILDLGSKGIASLNKCGVFVMDEADKLLSEDFMPVIEQTL 204

Query: 343 SMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAY-LYRRKSLPWKVLNNFTCIEL 519
           ++       ++F + +   P  +  +K  D    ++  Y +     L  K +  +     
Sbjct: 205 ALCPQERQVMLFSATF---PWTVKEFK--DQ--HMVQPYEINLMDELTLKGVTQYYAYVE 257

Query: 520 EEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           E  K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 258 ESQKVHCLNTLFSKLQINQSIIFCNSTNRVEL 289



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 30/79 (37%), Positives = 43/79 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N   +FV+DEAD++LS  F   I     +   + QV+L SAT P  V E     M  P  
Sbjct: 178 NKCGVFVMDEADKLLSEDFMPVIEQTLALCPQERQVMLFSATFPWTVKEFKDQHMVQPYE 237

Query: 456 ILVQKEELTLEGIKQFYMH 512
           I +  +ELTL+G+ Q+Y +
Sbjct: 238 INLM-DELTLKGVTQYYAY 255


>UniRef50_A2SQE1 Cluster: DEAD/DEAH box helicase domain protein;
           n=6; cellular organisms|Rep: DEAD/DEAH box helicase
           domain protein - Methanocorpusculum labreanum (strain
           ATCC 43576 / DSM 4855 / Z)
          Length = 656

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 37/84 (44%), Positives = 58/84 (69%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  LH +++ +F+LDEAD+ML  GF++ I D+F+    D Q IL SATMP  +L+++R F
Sbjct: 141 RGTLHLDSVTMFILDEADQMLDMGFREDIEDIFRDTPKDRQTILFSATMPQPILDITRRF 200

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
            RDP  + + ++ELT+  I+Q Y+
Sbjct: 201 QRDPQFVKITRKELTVPQIEQTYI 224



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 35/86 (40%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F I I++++D   +  QAL+L+PTRELA Q  +    L  +          GG  
Sbjct: 54  GKTAAFGIPIIERLDPDNKNVQALVLSPTRELAIQTAEEFSRLMKYKKGLNVVPIYGGQP 113

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   +R L+  V VV+GTPGRV D I
Sbjct: 114 IERQLRALKGTVQVVIGTPGRVIDHI 139


>UniRef50_Q4T821 Cluster: Chromosome undetermined SCAF7914, whole
           genome shotgun sequence; n=3; Tetraodontidae|Rep:
           Chromosome undetermined SCAF7914, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 502

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GK+  + I +L++ID      QAL+L PTRELA Q+ ++ I +  HL   K  A  GGTN
Sbjct: 138 GKSGAYLIPMLERIDLKKDHIQALVLVPTRELALQVSQISIQIAKHLGGVKVMATTGGTN 197

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +R+DI +L+  VHVV+ TPGR+ D++
Sbjct: 198 LRDDIMRLDETVHVVIATPGRILDLM 223



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 27/79 (34%), Positives = 45/79 (56%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           V  +AD++LS+ F   + D+   L+ + Q++L SAT P  V +     ++ P  I +  E
Sbjct: 264 VSPQADKLLSQDFVALVEDIISFLAKNRQILLYSATFPISVQKFMAKHLQKPYEINLM-E 322

Query: 474 ELTLEGIKQFYMH*IRRME 530
           ELTL+GI Q+Y +   R +
Sbjct: 323 ELTLKGITQYYAYVTERQK 341


>UniRef50_Q3LWE1 Cluster: Translation initiation factor 4A2; n=1;
           Bigelowiella natans|Rep: Translation initiation factor
           4A2 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 378

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 65/215 (30%), Positives = 104/215 (48%), Gaps = 8/215 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I    Q+  SI   Q LIL PTREL+ QI+ V   L  +      +C GG  +
Sbjct: 59  GKTTCYIIGTSNQLCQSINSPQCLILVPTRELSIQIRNVFNVLNIYTKNSITSCHGGRWL 118

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILV-------VRFMPTPSNFLFLMKLMKCCPEVSRT 339
            ED++ L+   H +VGTPGRV  ++ +       +R        + + K  K   ++   
Sbjct: 119 GEDLKNLKKNFHGIVGTPGRVLHLLQIGSLAITKIRTFVLDEADILMNKNFKI--DIFNI 176

Query: 340 RSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPW-KVLNNFTCIE 516
              ++S+  Q++  S    L  L    K+L  L  ++   L R++ +   K+   +  + 
Sbjct: 177 YRYLNSK-VQIIICSATIPLYTLQAASKFL--LDPVM--ILMRKEEINIDKIKQFYISVF 231

Query: 517 LEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGLAH 621
           +EE KL  L D+++TL + Q +IFCNT RK    H
Sbjct: 232 IEENKLLALLDIFETLLVGQVLIFCNTIRKANWIH 266



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 35/82 (42%), Positives = 59/82 (71%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +L    I+ FVLDEAD ++++ FK  I ++++ L++ VQ+I+ SAT+P   L+ +  F+ 
Sbjct: 147 SLAITKIRTFVLDEADILMNKNFKIDIFNIYRYLNSKVQIIICSATIPLYTLQAASKFLL 206

Query: 444 DPVRILVQKEELTLEGIKQFYM 509
           DPV IL++KEE+ ++ IKQFY+
Sbjct: 207 DPVMILMRKEEINIDKIKQFYI 228


>UniRef50_Q3AFI3 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=1; Carboxydothermus hydrogenoformans
           Z-2901|Rep: ATP-dependent RNA helicase, DEAD box family
           - Carboxydothermus hydrogenoformans (strain Z-2901 / DSM
           6008)
          Length = 430

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 62/208 (29%), Positives = 100/208 (48%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA + + +LQ+I    ++ Q LI+ PTRELA Q+   V  LG +L  +  A  GG  +
Sbjct: 51  GKTAAYLLPVLQRIQRG-KKAQVLIVTPTRELALQVADEVAKLGKYLKVRALAVYGGQAI 109

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSRTRS 345
              IR L  GV V+VGTPGR+ D I    F       + L     M  M    ++    +
Sbjct: 110 ERQIRGLRQGVEVIVGTPGRILDHIGRKTFPAAEIKIVILDEADEMLDMGFIDDIEAILN 169

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            +++R   L+F +     P   +  K+L     +    + R K++P      +   E E 
Sbjct: 170 TLTNRQQTLLFSATLP-APIKTIIKKFLGGYKTV--KLVGREKTVPAIRQVYYELPETE- 225

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            K+E L  + ++    QA++FC T+++V
Sbjct: 226 -KIEGLVSILNSELPIQAIVFCRTKKRV 252


>UniRef50_Q11UP8 Cluster: ATP-dependent RNA helicase; n=1; Cytophaga
           hutchinsonii ATCC 33406|Rep: ATP-dependent RNA helicase
           - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB
           9469)
          Length = 580

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 61/209 (29%), Positives = 98/209 (46%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F I  ++ +D SI + Q+LIL PTRELA Q+   +  L       +  A  GG +
Sbjct: 50  GKTAAFGIPAIEHVDISINQTQSLILCPTRELALQVCTELKKLSKFKKGLRVLAVYGGES 109

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSRTR 342
           +   IR L++G H+VVGTPGR+ D +       +  + + L     M  M    ++    
Sbjct: 110 IERQIRDLKAGAHIVVGTPGRIIDHLDRRTLNASHLSQIILDEADEMLNMGFREDIELIL 169

Query: 343 SMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELE 522
           + +      ++F +  +L P ++   K      EI+      RK L    +  F  +   
Sbjct: 170 TRLPEERQTVLFSA--TLAPPILALAKRFQNNPEII---KIERKELTISTVEQFYYLVKN 224

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
             K E +  + D  ++   +IFCNT+RKV
Sbjct: 225 SQKTEIVTQIIDLNNLQLMLIFCNTKRKV 253



 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 31/83 (37%), Positives = 54/83 (65%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L+A+ +   +LDEADEML+ GF++ I  +   L  + Q +L SAT+   +L +++ F
Sbjct: 137 RRTLNASHLSQIILDEADEMLNMGFREDIELILTRLPEERQTVLFSATLAPPILALAKRF 196

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
             +P  I ++++ELT+  ++QFY
Sbjct: 197 QNNPEIIKIERKELTISTVEQFY 219


>UniRef50_O26305 Cluster: ATP-dependent RNA helicase, eIF-4A family;
           n=1; Methanothermobacter thermautotrophicus str. Delta
           H|Rep: ATP-dependent RNA helicase, eIF-4A family -
           Methanobacterium thermoautotrophicum
          Length = 425

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 65/208 (31%), Positives = 101/208 (48%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I +L+ ++   R  QALI+ PTREL  Q+ + +  +G ++  K  A  GG ++
Sbjct: 53  GKTAAFAIPVLENLEAE-RVPQALIICPTRELCLQVSEEIKRIGKYMKVKVLAVYGGQSI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSRTRS 345
              I QL  GVHV+V TPGR+ D I          + + L     M  M    ++ R  S
Sbjct: 112 GNQIAQLRRGVHVIVATPGRLIDHIERGTVDLGGISTVVLDEADEMLNMGFIDDIERILS 171

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            +  R   ++F +  S  P L +  KY+             +K  P   ++ F     EE
Sbjct: 172 HVPERRQTMLFSATVS-KPILRIARKYM----RNPQVMRVEKKHSP--KIDEFYFKTREE 224

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            K+E L  +  + +I   +IFCNT+R+V
Sbjct: 225 DKVELLDWILSSNNIRMGLIFCNTKRRV 252



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/64 (40%), Positives = 39/64 (60%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           I   VLDEADEML+ GF D I  +   +    Q +L SAT+   +L ++R +MR+P  + 
Sbjct: 146 ISTVVLDEADEMLNMGFIDDIERILSHVPERRQTMLFSATVSKPILRIARKYMRNPQVMR 205

Query: 462 VQKE 473
           V+K+
Sbjct: 206 VEKK 209


>UniRef50_A7HDE9 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Anaeromyxobacter sp. Fw109-5|Rep: DEAD/DEAH box
           helicase domain protein - Anaeromyxobacter sp. Fw109-5
          Length = 680

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 38/85 (44%), Positives = 55/85 (64%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I IL++I    R   AL++ PTRELA Q+ +   AL  H +    A  GG ++
Sbjct: 69  GKTAAFAIPILERIADGRRRPSALVMCPTRELAIQVAQEFTALAKHRDLSVVAVYGGASM 128

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            E +++LE+G  ++VGTPGR+YD I
Sbjct: 129 GEQLQKLEAGAEIIVGTPGRIYDHI 153



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 30/79 (37%), Positives = 48/79 (60%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L  +   +  LDEADEML+ GF +++  +   L  D Q +L SAT+P D+ ++ R +
Sbjct: 155 RRTLKLDETMVCCLDEADEMLNMGFFEEVTRILDNLPKDCQQLLFSATVPADIEQIIRDY 214

Query: 438 MRDPVRILVQKEELTLEGI 494
           + DP  IL+  +E ++E I
Sbjct: 215 LTDPETILLSGDEYSVENI 233


>UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Euryarchaeota|Rep: DEAD/DEAH box helicase domain
           protein - Methanococcus maripaludis
          Length = 541

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 41/85 (48%), Positives = 52/85 (61%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I IL+ ID S R  QALILAPTRELA Q+ + + ++            GG ++
Sbjct: 52  GKTAAFGIPILETIDESSRNTQALILAPTRELAIQVAEEIDSIKGSKRLNVFPVYGGQSI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
              IR+L  GV +VVGTPGR+ D I
Sbjct: 112 DRQIRELRRGVQIVVGTPGRILDHI 136



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 28/76 (36%), Positives = 53/76 (69%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           +RR +    +   VLDEADEML+ GF D + ++ K +S + +++L SAT+PD ++++++ 
Sbjct: 137 SRRTIKLENVSYVVLDEADEMLNMGFIDDVEEILKSVSTEKRMLLFSATLPDSIMKLAKN 196

Query: 435 FMRDPVRILVQKEELT 482
           +MR+   I V++++LT
Sbjct: 197 YMREYDIIKVKRQQLT 212


>UniRef50_UPI0000566899 Cluster: UPI0000566899 related cluster; n=1;
           Mus musculus|Rep: UPI0000566899 UniRef100 entry - Mus
           musculus
          Length = 449

 Score = 79.8 bits (188), Expect = 7e-14
 Identities = 35/86 (40%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLN-AKCHACIGGTN 177
           GK+  + I +L+++D      QA+++ PTRELA Q+ ++ I +  H+  AK  A  GGTN
Sbjct: 130 GKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTN 189

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +R+D+ +L+   HVV+ TPGR+ D+I
Sbjct: 190 LRDDVMRLDDTGHVVIATPGRILDLI 215



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/70 (35%), Positives = 40/70 (57%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +++ VLDEAD++LS+ F   +      L  + Q++L SAT P  V +     ++ P  I 
Sbjct: 225 VQMVVLDEADKLLSQDFVQIMEAFILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEIN 284

Query: 462 VQKEELTLEG 491
           +  EELTL+G
Sbjct: 285 LM-EELTLKG 293


>UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase -
           Symbiobacterium thermophilum
          Length = 526

 Score = 79.4 bits (187), Expect = 9e-14
 Identities = 37/83 (44%), Positives = 51/83 (61%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + I++++    R  QAL+L PTRELA Q+ + +  +G H   K  A  GG ++
Sbjct: 55  GKTAAFGVPIVERLVPGQRAVQALVLTPTRELAIQVAEEITKIGRHARVKTIAIYGGQSI 114

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
              IR L  GV VV+GTPGR+ D
Sbjct: 115 ERQIRSLRFGVDVVIGTPGRILD 137



 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 32/83 (38%), Positives = 52/83 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +++ VLDEADEML  GF + I  + +   A+ Q +L SATMP ++  ++  +
Sbjct: 141 RSTLDLSQVRMVVLDEADEMLDMGFIEDIEKILQNTPAERQTLLFSATMPPEIRRLAGRY 200

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           MRDP+ I V  ++LT+  I Q++
Sbjct: 201 MRDPITISVTPQQLTVPQIDQYF 223


>UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase - Bacillus
           halodurans
          Length = 539

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 59/209 (28%), Positives = 100/209 (47%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I +++++ T  R  QALIL PTRELA Q+   +  L  H   +     GG ++
Sbjct: 55  GKTAAFGIPVVEKVSTG-RHVQALILTPTRELAIQVSGEIQKLSKHKKIRTLPIYGGQSI 113

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSRTRS 345
              I+ L+ GV VV+GTPGR+ D +     +    N + L     M  M    ++     
Sbjct: 114 VHQIKALKQGVQVVIGTPGRIIDHLRRKTLILDHVNTVILDEADEMLDMGFIDDIESILR 173

Query: 346 MMSSRFCQLMFKSYYSLLPCL-MMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELE 522
            + +    L+F +  ++ P +  +  KY++            R+ +    ++ F    LE
Sbjct: 174 QVKNERQTLLFSA--TMPPAIKKLSRKYMND----PQTVSINRREVTAPSIDQFYYKVLE 227

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
             KL++LC + D+  I   ++FC T++ V
Sbjct: 228 RNKLDSLCRIIDSEQIDLGILFCRTKKGV 256



 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 34/85 (40%), Positives = 50/85 (58%)
 Frame = +3

Query: 270 HANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDP 449
           H NT+   +LDEADEML  GF D I  + + +  + Q +L SATMP  + ++SR +M DP
Sbjct: 147 HVNTV---ILDEADEMLDMGFIDDIESILRQVKNERQTLLFSATMPPAIKKLSRKYMNDP 203

Query: 450 VRILVQKEELTLEGIKQFYMH*IRR 524
             + + + E+T   I QFY   + R
Sbjct: 204 QTVSINRREVTAPSIDQFYYKVLER 228


>UniRef50_Q11QF9 Cluster: Inducible ATP-independent RNA helicase;
           n=1; Cytophaga hutchinsonii ATCC 33406|Rep: Inducible
           ATP-independent RNA helicase - Cytophaga hutchinsonii
           (strain ATCC 33406 / NCIMB 9469)
          Length = 457

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 36/86 (41%), Positives = 55/86 (63%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + +LQQI+ S+++ Q L+L PTREL QQ+ K +     ++      A  GG  
Sbjct: 51  GKTAAFGLPVLQQINPSLQQTQVLVLVPTRELGQQVAKDLFVFSRYIVRIHTEAVYGGKK 110

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + E I++LE+  H++V TPGR+ D+I
Sbjct: 111 IEEQIKKLETPKHILVATPGRLLDLI 136



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+A++ + +K  +LDEADEML+ GF   I  + KI     + +L ++T+  ++  + R +
Sbjct: 138 RKAVNLSNLKYLILDEADEMLNMGFLPDIDKIMKIAKPTARKLLFTSTLGSELKLIIREY 197

Query: 438 M-RDPVRILVQKEELTLEGIKQFYM 509
           +  D   I ++ +E     I+  Y+
Sbjct: 198 LGTDIEEIRIKPQEYVNRNIEHQYL 222


>UniRef50_A0Z0M4 Cluster: ATP-dependent RNA helicase; n=1; marine
           gamma proteobacterium HTCC2080|Rep: ATP-dependent RNA
           helicase - marine gamma proteobacterium HTCC2080
          Length = 582

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 37/86 (43%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F++ IL  ID  +R  QAL+L PTRELAQQ+ +   + G  +   +  +  GG +
Sbjct: 58  GKTAAFALPILANIDVKVRSPQALVLCPTRELAQQVAEAFRSYGRGMGGLRILSIFGGAD 117

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +R+ ++ L  G H+VV TPGR+ D I
Sbjct: 118 MRQQLKSLREGTHIVVATPGRLLDHI 143



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 31/83 (37%), Positives = 43/83 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR++    I   VLDEADEML  GF D +  +      + +V L SATMP  V +++   
Sbjct: 145 RRSIDLTGINAVVLDEADEMLRMGFIDDVDTILAKTPKERKVALFSATMPKRVRDIANKH 204

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           + +P  I V     T E I+Q Y
Sbjct: 205 LSNPAEISVAAAATTNENIEQCY 227


>UniRef50_Q9KLE2 Cluster: ATP-dependent RNA helicase DeaD; n=35;
           Vibrionales|Rep: ATP-dependent RNA helicase DeaD -
           Vibrio cholerae
          Length = 663

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA FS+ +L +++ S  + QA+++APTRELA Q+   +  LG ++   K     GG +
Sbjct: 75  GKTAAFSLPLLNKLNLSQYKPQAIVMAPTRELAIQVAAEIKNLGQNIKGLKVLEIYGGAS 134

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + + +R L+SG H+VVGTPGRV D+I
Sbjct: 135 ILDQMRALKSGAHIVVGTPGRVKDLI 160



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 32/84 (38%), Positives = 45/84 (53%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           TR  LH +    F+LDEADEML  GF D +  + +      Q +L SATMP  V E+   
Sbjct: 161 TRDRLHLDECHTFILDEADEMLKMGFVDDVTWIMEQAPESAQRVLFSATMPPMVKEIVER 220

Query: 435 FMRDPVRILVQKEELTLEGIKQFY 506
           F+R+P  + V     T+  ++Q Y
Sbjct: 221 FLRNPECVDVAGSNQTVAKVEQQY 244


>UniRef50_Q8YXJ0 Cluster: ATP-dependent RNA helicase; n=11;
           Cyanobacteria|Rep: ATP-dependent RNA helicase - Anabaena
           sp. (strain PCC 7120)
          Length = 513

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 36/85 (42%), Positives = 54/85 (63%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA FS+ IL+++D   +  QA++L PTRELA Q+   +     +   +  A  GG ++
Sbjct: 52  GKTAAFSLPILERLDPQQKAVQAIVLTPTRELAIQVHDAMAQFVGNSGLRTLAIYGGQSI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
              + QL+ GVH+VVGTPGRV D++
Sbjct: 112 DRQMLQLKRGVHIVVGTPGRVIDLL 136



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 33/81 (40%), Positives = 44/81 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +K FVLDEADEMLS GF D +  +      D Q  L SATMP  +  +   F
Sbjct: 138 RGNLKLDQVKWFVLDEADEMLSMGFIDDVEKILSQAPQDRQTALFSATMPPSIRMLVNKF 197

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           +R PV + V++ + T   I Q
Sbjct: 198 LRSPVTVTVEQPKATPNKINQ 218


>UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2;
           Planctomycetaceae|Rep: ATP-dependent RNA helicase -
           Rhodopirellula baltica
          Length = 452

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 39/85 (45%), Positives = 54/85 (63%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT--SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA FSI IL+Q+D+    R+ QA+++ PTRELA Q+      L   +  +     GG 
Sbjct: 93  GKTAAFSIPILEQLDSLEDCRDPQAIVIVPTRELADQVAAEAERLARGVPTEIAVLSGGK 152

Query: 175 NVREDIRQLESGVHVVVGTPGRVYD 249
           N+   +RQLE+G  +VVGTPGRV+D
Sbjct: 153 NMNRQLRQLENGTQLVVGTPGRVHD 177



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 31/83 (37%), Positives = 48/83 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  N +   VLDEAD ML  GF+ QI  + +    + Q +LLSAT+P  V  ++  +
Sbjct: 181 RGTLRTNNVWCVVLDEADRMLDIGFRPQIERIMRKCPRNRQTLLLSATLPPVVRRLAESY 240

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M +PV I   ++E+ ++ I+Q Y
Sbjct: 241 MHEPVVIDCCRDEMAVDTIEQRY 263


>UniRef50_Q6MN50 Cluster: ATP-dependent RNA helicase; n=1;
           Bdellovibrio bacteriovorus|Rep: ATP-dependent RNA
           helicase - Bdellovibrio bacteriovorus
          Length = 656

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I +++ ID+++++ QAL+L+PTRELA Q+ + +  LG     +     GG + 
Sbjct: 94  GKTAAFGIPLIENIDSTVKDTQALVLSPTRELALQVAEQLTLLGKKKGVRVVTIYGGASY 153

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           R  I  ++ G H+VV TPGR+ D +
Sbjct: 154 RTQIDGIKRGAHIVVATPGRLVDFL 178



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 8/91 (8%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSAD--------VQVILLSATMPDD 413
           ++ +   ++K  VLDEADEMLS GFK+ +  +      D         +  L SATM  +
Sbjct: 180 QKMIKLQSVKTVVLDEADEMLSMGFKEALETILSATQPDDSDSVRAACRTWLFSATMSSE 239

Query: 414 VLEVSRCFMRDPVRILVQKEELTLEGIKQFY 506
           V  ++  ++ +P  + V K   T + I+Q Y
Sbjct: 240 VRRLTSTYLENPETVSVNKVGGTADTIEQVY 270


>UniRef50_Q26CN9 Cluster: ATP-dependent RNA helicase; n=1;
           Flavobacteria bacterium BBFL7|Rep: ATP-dependent RNA
           helicase - Flavobacteria bacterium BBFL7
          Length = 644

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + +L  ID + RE QALILAPTRELAQQI   +  +  HL         GG N
Sbjct: 63  GKTAAFGLPLLDLIDVNSREVQALILAPTRELAQQICGQMEQMSKHLGKLNVVPVFGGAN 122

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   IR +  G  ++V TPGR+ D++
Sbjct: 123 IMNQIRDIRRGAQIIVATPGRLMDLM 148



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/80 (30%), Positives = 41/80 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR +  + +K  VLDEADEML+ GFK+ I  +         + L SATM  ++  +   +
Sbjct: 150 RREVKLDALKYMVLDEADEMLNMGFKEDIDFILSKSDTGRNIWLFSATMAREIKRIVDTY 209

Query: 438 MRDPVRILVQKEELTLEGIK 497
           M  P  + +  + +  + I+
Sbjct: 210 MVQPEEVRINPKNIVNKNIE 229


>UniRef50_A5BNE7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 339

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 35/52 (67%), Positives = 43/52 (82%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTATF   ILQQ++  + +CQAL+LAPTRELAQQI+KV+ ALGDHLN K +
Sbjct: 61  GKTATFCSGILQQLNEELTQCQALVLAPTRELAQQIEKVMRALGDHLNVKIY 112



 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 30/58 (51%), Positives = 49/58 (84%)
 Frame = +3

Query: 339 QIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQFYMH 512
           +I+++F++L   +QV + SATMP +VLE+++ F+  PVRILV++EELTLEGI+QF+++
Sbjct: 110 KIYEIFQLLPERIQVGVFSATMPPEVLEITKKFINKPVRILVKREELTLEGIRQFHVN 167


>UniRef50_Q98RE0 Cluster: ATP-DEPENDENT RNA HELICASE; n=1;
           Mycoplasma pulmonis|Rep: ATP-DEPENDENT RNA HELICASE -
           Mycoplasma pulmonis
          Length = 480

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 38/85 (44%), Positives = 53/85 (62%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I IL  +D SI   Q L++APTRELA QI   +  LG +  +K    +GG + 
Sbjct: 50  GKTAAFAIPILSNLDCSINRIQHLVIAPTRELANQIYDQLNILGKYTCSKIALILGGVSY 109

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            +    L SGV++VV TPGR+ D++
Sbjct: 110 EKQKAALNSGVNIVVATPGRLEDLL 134



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 23/76 (30%), Positives = 36/76 (47%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           IK F LDEADE+L  GF ++I  +   L    Q    +AT  +   ++S+    +   I 
Sbjct: 144 IKTFTLDEADELLKIGFYNEIIKIMNKLPKKRQNFFFTATFDEKTKKLSQEITNEAKMIS 203

Query: 462 VQKEELTLEGIKQFYM 509
           +     T E I Q ++
Sbjct: 204 MSSGLETTEKIDQNFV 219


>UniRef50_Q81VG0 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=16; cellular organisms|Rep: DEAD-box ATP-dependent RNA
           helicase ydbR - Bacillus anthracis
          Length = 528

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 33/85 (38%), Positives = 51/85 (60%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + +L ++DT     Q +++APTRELA Q+ + +  +G H   +     GG ++
Sbjct: 51  GKTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPIYGGQDI 110

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
              IR L+   H++VGTPGR+ D I
Sbjct: 111 NRQIRALKKHPHIIVGTPGRILDHI 135



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 33/84 (39%), Positives = 51/84 (60%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    ++  VLDEADEML+ GF + I  +   +    Q +L SATMPD +  ++  F
Sbjct: 137 RKTLRLQNVETVVLDEADEMLNMGFIEDIEAILTDVPETHQTLLFSATMPDPIRRIAERF 196

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           M +P  I V+ +E+T+  I+QFY+
Sbjct: 197 MTEPQHIKVKAKEVTMPNIQQFYL 220


>UniRef50_A2TP65 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family protein; n=13; Bacteroidetes|Rep: ATP-dependent
           RNA helicase, DEAD/DEAH box family protein - Dokdonia
           donghaensis MED134
          Length = 638

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F   +LQ ID S +  Q LI+APTREL  QI   +     H+   +  A  GG+N
Sbjct: 51  GKTAAFGFPLLQNIDASSKTTQGLIIAPTRELCLQITNEMKLYAKHIKGVRVVAVYGGSN 110

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           ++E  R++  G  +VV TPGR+ DM+
Sbjct: 111 IQEQAREISRGAQIVVATPGRMQDMM 136



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 28/69 (40%), Positives = 39/69 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR +    +   VLDEADEML+ GF + I ++      D    L SATMP +V  +++ F
Sbjct: 138 RRMVDITKLSYCVLDEADEMLNMGFYEDITNILADTPEDKLTWLFSATMPREVARIAKEF 197

Query: 438 MRDPVRILV 464
           M DP+ I V
Sbjct: 198 MHDPLEITV 206


>UniRef50_Q2FKY7 Cluster: DEAD/DEAH box helicase-like; n=1;
           Methanospirillum hungatei JF-1|Rep: DEAD/DEAH box
           helicase-like - Methanospirillum hungatei (strain JF-1 /
           DSM 864)
          Length = 531

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 31/84 (36%), Positives = 57/84 (67%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L  + + L VLDEAD+ML  GF++ I ++   +  + Q ++LSAT P ++L++SR F
Sbjct: 140 RKTLLLDAVSLVVLDEADQMLDMGFREDIEEILSHIPKERQTVILSATFPPEILDISRRF 199

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
            ++P+ + +  +ELT+  I+Q+Y+
Sbjct: 200 QKNPIDVKMVHQELTVPQIEQYYI 223



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F I  ++    + R  Q ++L P+RELA Q+   +  L  H          GG  
Sbjct: 53  GKTAAFGIPAIELCQPANRNVQTIVLCPSRELAVQVGTELNKLAMHKKGISILPVYGGQP 112

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   I+ L  GV +++GTPGRV D I
Sbjct: 113 IERQIKALSRGVQIIIGTPGRVIDHI 138


>UniRef50_Q484Q1 Cluster: RNA helicase DeaD; n=1; Colwellia
           psychrerythraea 34H|Rep: RNA helicase DeaD - Colwellia
           psychrerythraea (strain 34H / ATCC BAA-681)
           (Vibriopsychroerythus)
          Length = 611

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG-DHLNAKCHACIGGTN 177
           GKTA F +  L +IDTSI++ Q ++LAPTRELA Q+ + + + G D    +     GG +
Sbjct: 64  GKTAAFGLPALAKIDTSIKKPQLMVLAPTRELAMQVAEAIESFGKDMKGLRVATLYGGQS 123

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
                +QLE G  VVVGTPGR+ D
Sbjct: 124 YGPQFQQLERGAQVVVGTPGRLMD 147



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 28/82 (34%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L  + +++ VLDEADEML+ GF + I  +   +    Q+ L SATMP  + +++  F
Sbjct: 151 RKSLKLDELRVCVLDEADEMLNMGFLEDIQWILDHIPKTAQMCLFSATMPPAIRKIANRF 210

Query: 438 MRDPVRILVQKEELTLEGIKQF 503
           ++DP  I V   +     I Q+
Sbjct: 211 LKDPEHIKVAAVKKAKANITQY 232


>UniRef50_Q9S531 Cluster: DEAD-box protein; n=4;
           Cystobacterineae|Rep: DEAD-box protein - Myxococcus
           xanthus
          Length = 808

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 37/85 (43%), Positives = 51/85 (60%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + +L++I    R  +ALIL PTRELA Q+   +  L  H   K  A  GG ++
Sbjct: 78  GKTAAFGLPLLEKIPADERRVRALILCPTRELALQVADELKMLAKHKGLKIAAIYGGASM 137

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++    LE G  ++VGTPGRV+D I
Sbjct: 138 KQQEDALEEGTPIIVGTPGRVFDHI 162



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/67 (35%), Positives = 40/67 (59%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEADEML++GF +++  +   L    QV+L SAT+P D+  +   +  +   +L+  +
Sbjct: 176 VLDEADEMLNQGFYEEVTRILDRLPKTRQVLLFSATVPTDIQNLIARYTTNAETLLLSGD 235

Query: 474 ELTLEGI 494
             T+E I
Sbjct: 236 VFTVEHI 242


>UniRef50_Q185X0 Cluster: ATP-dependent RNA helicase; n=3;
           Clostridium difficile|Rep: ATP-dependent RNA helicase -
           Clostridium difficile (strain 630)
          Length = 497

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 34/85 (40%), Positives = 53/85 (62%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA+F+I + + I+      QALI+ PTRELA Q++  +  +G     +C A  G  ++
Sbjct: 52  GKTASFAIPLCENINVDYNNIQALIVVPTRELALQVKDEISDIGRLKKVRCSAIFGKQSI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++ I +L+  VH+VV TPGR+ D I
Sbjct: 112 KDQIAELKQRVHIVVATPGRILDHI 136



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/73 (28%), Positives = 41/73 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R ++    +K  V+DEAD+M ++GF +Q+  +   L  +  V L SAT+ +++  +   +
Sbjct: 138 RGSIKLENVKYLVIDEADKMFNKGFVEQMEKILLNLPKEKIVSLFSATIDEEIKYICEKY 197

Query: 438 MRDPVRILVQKEE 476
           M D   I +++ E
Sbjct: 198 MLDYSVINIEENE 210


>UniRef50_Q2WF63 Cluster: Putative uncharacterized protein; n=4;
           Bilateria|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 561

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 39/85 (45%), Positives = 50/85 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F+I ILQ++        ALIL PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 138 GKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSL 197

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
               R+L    HVVV TPGR+ D+I
Sbjct: 198 IHQARELSERPHVVVATPGRLADLI 222



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 2/78 (2%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDP--VR 455
           I+ FVLDEAD ML   + DQ+  +F+ +S   Q +LLSAT+ +++  + R   R P    
Sbjct: 236 IQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFE 295

Query: 456 ILVQKEELTLEGIKQFYM 509
              + +E T++ ++Q Y+
Sbjct: 296 DKGKDDESTVDRLEQKYV 313


>UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12;
           Clostridium|Rep: ATP-dependent RNA helicase -
           Clostridium perfringens
          Length = 528

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L  N I   VLDEADEML+ GF D + ++ K L  D Q +L SATMP  + +++R +
Sbjct: 141 RKSLPLNDIGFLVLDEADEMLNMGFIDDLEEIVKSLKTDRQTLLFSATMPPQIKKLARNY 200

Query: 438 MR-DPVRILVQKEELTLEGIKQFY 506
           M+ D   I ++K  LT+  I+QFY
Sbjct: 201 MKEDTKHIAIKKSSLTVSKIEQFY 224



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 63/210 (30%), Positives = 97/210 (46%), Gaps = 7/210 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F  +I+   D S ++   +ALILAPTRELA Q+ + ++ LG H         GG 
Sbjct: 53  GKTAAFGCAIINNADFSGKKKSPKALILAPTRELAIQVNEELVRLGKHEKLSVLPIYGGQ 112

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSRT 339
            +   IR L++GV +VVGTPGRV D+I           FL L     M  M    ++   
Sbjct: 113 PIDRQIRALKNGVDIVVGTPGRVLDLIRRKSLPLNDIGFLVLDEADEMLNMGFIDDLEEI 172

Query: 340 RSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIEL 519
              + +    L+F +  ++ P +    +  + + E       ++ SL    +  F     
Sbjct: 173 VKSLKTDRQTLLFSA--TMPPQIKKLAR--NYMKEDTKHIAIKKSSLTVSKIEQFYFEIK 228

Query: 520 EEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
              + ETLC + D      A+IFC T++ V
Sbjct: 229 HRDRFETLCRVLDFDEPNAAIIFCKTKKGV 258


>UniRef50_Q725W5 Cluster: ATP-dependent RNA helicase, DEAD/DEAH
           family; n=2; Desulfovibrio vulgaris subsp. vulgaris|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH family -
           Desulfovibrio vulgaris (strain Hildenborough / ATCC
           29579 / NCIMB8303)
          Length = 532

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + +LQ+ID + R  QAL+L PTRELA Q+   + AL  HL   +  +  GG  
Sbjct: 54  GKTAAFGLPLLQRIDAADRSVQALVLCPTRELALQVANGLTALAKHLRGVRILSVYGGQP 113

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +      L  G  VVVGTPGR+ D I
Sbjct: 114 IEPQASALRRGAQVVVGTPGRILDHI 139



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 2/94 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L    +++ VLDEADEML  GF++ I  +   +   VQ    SATMPD +LE++R F
Sbjct: 141 RGTLQLGVVRMTVLDEADEMLDMGFREDIERILSEMPEWVQSAFFSATMPDGILELARRF 200

Query: 438 MRDPVRILVQKEELTLEGIKQ--FYMH*IRRMEA 533
           +R+P  + V + +LT+   +Q  F +   RR++A
Sbjct: 201 LREPELLRVTRRQLTVANTEQAWFEVRPFRRVDA 234


>UniRef50_Q1VPX9 Cluster: ATP-independent RNA helicase; n=9;
           Bacteroidetes|Rep: ATP-independent RNA helicase -
           Psychroflexus torquis ATCC 700755
          Length = 443

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 67/206 (32%), Positives = 97/206 (47%), Gaps = 3/206 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  FS+ +L  +D    + Q LIL P+RELA QI++V+  +G     K +A  GG  V
Sbjct: 46  GKTLAFSLPLLTILDPESPDVQVLILVPSRELAIQIEQVIRTMGS--GYKVNAVYGGRPV 103

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMS-- 354
            +D  +++    +++GTPGR+ D     RF  T    L L +  K   EV     M +  
Sbjct: 104 SKDKIEIKHNPAILIGTPGRILDHFNSERFSKTSIQTLILDEFDKSL-EVGFEEEMKAII 162

Query: 355 SRFCQLMFKSYYSLLPCLMM-YWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEEWK 531
           S+   L  +   S    L +  +  LD     +  YL   K  P K L   T I   + K
Sbjct: 163 SQLPNLNKRVLTSATQSLSIPGFVRLDK--PSIVNYL--NKKTPSK-LTIKTVISPSQSK 217

Query: 532 LETLCDLYDTLSIAQAVIFCNTRRKV 609
           L+TL DL   L  A  ++FCN R  +
Sbjct: 218 LKTLVDLVHHLGNAPGIVFCNLRDSI 243


>UniRef50_A5E6W6 Cluster: ATP-dependent rRNA helicase RRP3; n=4;
           Saccharomycetaceae|Rep: ATP-dependent rRNA helicase RRP3
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 504

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 38/83 (45%), Positives = 52/83 (62%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I ILQ + T+ +   AL+LAPTRELA QI++   ALG  +  +    IGG ++
Sbjct: 147 GKTAAFAIPILQTLYTAAQPYYALVLAPTRELAFQIKETFDALGSSMGLRSVCIIGGMSM 206

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
            E  R L    HV++ TPGR+ D
Sbjct: 207 MEQARDLMRKPHVIIATPGRLID 229


>UniRef50_Q1MY97 Cluster: DEAD/DEAH box helicase-like protein; n=2;
           Gammaproteobacteria|Rep: DEAD/DEAH box helicase-like
           protein - Oceanobacter sp. RED65
          Length = 614

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F++ +L +    +RE Q L+LAPTRELAQQ+   V +   H  N K  +  GG++
Sbjct: 55  GKTAAFTLPLLARTQNEVREPQVLVLAPTRELAQQVAMAVESYSKHESNVKVASIYGGSD 114

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
                R L+ G   VVGTPGRV D I
Sbjct: 115 FGSQFRALKQGPQWVVGTPGRVMDHI 140



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 32/83 (38%), Positives = 44/83 (53%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L    I+  VLDEADEML  GF D +  V   +    Q+ L SATMP  +  V+   
Sbjct: 142 RGTLKLEGIRAVVLDEADEMLRMGFIDDVDWVLDQVPEKRQIALFSATMPKQIKAVAEKH 201

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           +R+P  I ++ +  T E I+Q Y
Sbjct: 202 LREPTEIRIKSKTATNESIEQKY 224


>UniRef50_A4C0F9 Cluster: ATP-dependent RNA helicase; n=6;
           Bacteroidetes|Rep: ATP-dependent RNA helicase -
           Polaribacter irgensii 23-P
          Length = 447

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/86 (41%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGTN 177
           GKTA F + +LQ ID +    QA+ILAPTREL QQI   +I+  +H +    A + GG  
Sbjct: 53  GKTAAFGLPLLQLIDVNNDAIQAIILAPTRELGQQIAANLISFAEHTSQVSIATLCGGIP 112

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           ++  I +L+   H++V TPGR+ D++
Sbjct: 113 IKPQIERLKEATHIIVATPGRLADLV 138



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R A+   +I  F+LDEADEM++   K+ +  + K +    +  L +AT+P  + ++ + +
Sbjct: 140 REAIDIKSISYFILDEADEMVT-ALKEGLDSIIKEIPKARRTFLFTATLPGTLKQLIQNY 198

Query: 438 MRDPVRILVQKEELTL--EGIKQFYM 509
           M  P  I ++    TL  +GI   Y+
Sbjct: 199 MA-PKVIQIEANMTTLGHQGIDHQYV 223


>UniRef50_Q8SQK9 Cluster: ATP-dependent RNA helicase DHH1; n=1;
           Encephalitozoon cuniculi|Rep: ATP-dependent RNA helicase
           DHH1 - Encephalitozoon cuniculi
          Length = 489

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA++ + +L  I++S    Q +IL P RELA QI + V  + +         +GGT++
Sbjct: 157 GKTASYIVPMLNMINSSELSIQGIILVPIRELALQISRNVKRMSEGTGVISAPVVGGTSM 216

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++DI ++ +GVHV+VGTPGR+ D++
Sbjct: 217 QDDIIRVSNGVHVMVGTPGRIVDLV 241



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V DEAD++L   F + +  +  +L  + Q++L SAT P  V    R +M++P+ I + 
Sbjct: 253 ILVFDEADKLLDVTFGETVTKLLDLLPREKQMLLYSATFPYFVTGFIRRYMKNPLCINLM 312

Query: 468 KEELTLEGIKQFYMH 512
           K EL   G+KQFY +
Sbjct: 313 K-ELAPVGVKQFYTY 326


>UniRef50_Q6MN67 Cluster: ATP-dependent RNA helicase; n=3;
           Deltaproteobacteria|Rep: ATP-dependent RNA helicase -
           Bdellovibrio bacteriovorus
          Length = 505

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 42/86 (48%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA FS+ IL +I+      QALIL PTRELA Q+   +  LG  L   K  A  GG +
Sbjct: 96  GKTAAFSLPILNKINLDQPLLQALILCPTRELASQVVTEIRKLGRRLPGLKVLAMTGGQS 155

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
            RE    LE+GV +VVGTPGR+ D +
Sbjct: 156 GREQADALENGVQIVVGTPGRLADFV 181



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/76 (36%), Positives = 44/76 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  +  + +K  VLDEAD+ML  GF D+I  V + L    Q +L SAT P+ +  +SR +
Sbjct: 183 RNRIDLSAVKTVVLDEADKMLDMGFADEIKTVMRDLPGSRQTVLFSATFPESIEHLSRKY 242

Query: 438 MRDPVRILVQKEELTL 485
            R   +++++ EE  L
Sbjct: 243 QRHAQQVIIEDEEQNL 258


>UniRef50_P96614 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=90; Bacilli|Rep: DEAD-box ATP-dependent RNA helicase
           ydbR - Bacillus subtilis
          Length = 494

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 32/84 (38%), Positives = 52/84 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR +  N +   V+DEADEML+ GF D I  +   + ++ Q +L SATMP  +  ++  F
Sbjct: 138 RRTIRLNNVNTVVMDEADEMLNMGFIDDIESILSNVPSEHQTLLFSATMPAPIKRIAERF 197

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           M +P  + V+ +E+T+  I+QFY+
Sbjct: 198 MTEPEHVKVKAKEMTVSNIQQFYL 221



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 33/85 (38%), Positives = 52/85 (61%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I ++++I+      QA+++APTRELA Q+ + +  +G    AK     GG ++
Sbjct: 52  GKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRAKVLPIYGGQDI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
              IR L+   +++VGTPGR+ D I
Sbjct: 112 GRQIRALKKNPNIIVGTPGRLLDHI 136


>UniRef50_A2EPG4 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 389

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 34/85 (40%), Positives = 55/85 (64%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI  L ++  + +  + +I++PTRELA Q +  + +LG    A   AC+GG ++
Sbjct: 69  GKTATFSIGTLARLRLTSKTTELIIVSPTRELAIQTENTLKSLG----ANTRACVGGNSL 124

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
             D++ L+ G+H V GTPGR+  ++
Sbjct: 125 GADVKALQKGIHCVSGTPGRILQLL 149



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           + A  ++  VLDEADEML+  FK  I D+ + L    Q ++++AT+  DV+E++   +R+
Sbjct: 154 IQAEKVQSVVLDEADEMLT-SFKSTIMDILQKL-PHAQKVIVTATVSADVVELATAHLRN 211

Query: 447 PVRILVQKEELTLEGIKQF 503
            V I V ++ELTL GI Q+
Sbjct: 212 SVEIRVPRDELTLTGIDQY 230



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 16/32 (50%), Positives = 24/32 (75%)
 Frame = +1

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRRK 606
           +E EEWK +TL D+Y +++I +AVIF N+  K
Sbjct: 234 VENEEWKFDTLIDIYQSIAIEKAVIFVNSVEK 265


>UniRef50_Q893G8 Cluster: ATP-dependent RNA helicase; n=4;
           Clostridiales|Rep: ATP-dependent RNA helicase -
           Clostridium tetani
          Length = 386

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 38/87 (43%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH--LNAKCHACIGGT 174
           GKT  + + I Q+IDTS RE QA+ILAPT ELA QI K +  L  +  ++      IG  
Sbjct: 52  GKTLAYLLPIFQKIDTSKREMQAIILAPTHELAMQINKEIQLLSGNSKVSVTSTPIIGNA 111

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
           NV+  I +L+   HV+VG+ GR+ ++I
Sbjct: 112 NVKRQIEKLKEKPHVIVGSSGRILELI 138



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/83 (31%), Positives = 42/83 (50%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ + A+TIK  V+DE D++L       I DV K    D Q+++ SAT+ +  L V++  
Sbjct: 140 KKKISAHTIKTIVVDEGDKLLDHSNLSSIKDVIKTTMRDRQLMVFSATINEKTLNVAKGL 199

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M+D   I  + E      I   Y
Sbjct: 200 MKDAEFIKAKSENAINPNITHMY 222


>UniRef50_Q3AX69 Cluster: DEAD/DEAH box helicase-like; n=15;
           Cyanobacteria|Rep: DEAD/DEAH box helicase-like -
           Synechococcus sp. (strain CC9902)
          Length = 624

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 39/84 (46%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIA-LGDHLNAKCHACIGGTN 177
           GKTA F++ +L+++++  +  Q L+LAPTRELA Q+     A    H + K  A  GGT+
Sbjct: 120 GKTAAFALPLLERLESGQKTPQVLVLAPTRELAMQVADSFKAYAAGHPHLKVLAVYGGTD 179

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
            R  I  L  GV VVVGTPGRV D
Sbjct: 180 FRSQISTLRRGVDVVVGTPGRVMD 203



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + +   VLDEADEML  GF D +  + + L  + QV+L SATMP ++  +S+ ++ D
Sbjct: 210 LDTSGLTSLVLDEADEMLRMGFIDDVEWILEQLPKERQVVLFSATMPPEIRRLSKRYLND 269

Query: 447 PVRILVQKEELTLEGIKQ 500
           P  + ++ ++   + I+Q
Sbjct: 270 PAEVTIKTKDQDGKLIRQ 287


>UniRef50_Q5CIF9 Cluster: DEAD-box RNA helicase; n=2;
           Cryptosporidium|Rep: DEAD-box RNA helicase -
           Cryptosporidium hominis
          Length = 518

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 62/208 (29%), Positives = 102/208 (49%), Gaps = 7/208 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF++++L ++DT I   Q + L PTRELA+Q Q VV  LG          +     
Sbjct: 162 GKTATFALAMLGKVDTRIIHPQCMCLCPTRELARQNQDVVNELGKFTGITTWLVV----A 217

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           + D      G  +++ TPG++ D +    F   P+ F+ LM + +   E+   R+MM+S+
Sbjct: 218 QGDKYDKTIGSQIIICTPGKMQDFLKKRSF---PTEFMKLMVIDE-ADEMIDHRNMMASQ 273

Query: 361 FCQL--MFKSYYSLLPCLMMYWKYLDAL*EILYAYL----YRRKSLPWKVLNNFTCIELE 522
             Q+   F+    +L     Y + +    E +         +++ L    +  F  I  +
Sbjct: 274 VGQIRKFFRQNLQILLFSATYHEEVRLFAEKIVPNANKINVKKEELTLNTIQQFYVICND 333

Query: 523 EW-KLETLCDLYDTLSIAQAVIFCNTRR 603
           +  KL  L DLY  +SI Q++IF NTR+
Sbjct: 334 DADKLSFLSDLYACMSIGQSIIFVNTRK 361


>UniRef50_Q5ZT20 Cluster: ATP-dependent RNA helicase; n=4;
           Legionella pneumophila|Rep: ATP-dependent RNA helicase -
           Legionella pneumophila subsp. pneumophila (strain
           Philadelphia 1 /ATCC 33152 / DSM 7513)
          Length = 589

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 40/86 (46%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F++ ILQ +   I   QALILAPTRELA Q+ +    L  +  N       GG  
Sbjct: 55  GKTAAFALPILQNLSPEISTTQALILAPTRELAIQVAEQFELLSKYQRNVTIAVLCGGQE 114

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
               ++QL SG  VVVGTPGR+ D I
Sbjct: 115 YGRQLKQLRSGAQVVVGTPGRILDHI 140



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +K F+LDEADEML  GF + +  + + L    Q+ L SATMP  + +++  ++ DP  
Sbjct: 148 NNLKTFILDEADEMLRMGFIEDVETILEKLPEKKQMALFSATMPYRIRQIANTYLNDPAS 207

Query: 456 ILVQKEELTLEGIKQFYM 509
           I ++ E  T++ I+Q ++
Sbjct: 208 IEIRMETATVKSIEQRFL 225


>UniRef50_Q1QYG3 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Chromohalobacter salexigens DSM 3043|Rep: DEAD/DEAH box
           helicase-like protein - Chromohalobacter salexigens
           (strain DSM 3043 / ATCC BAA-138 / NCIMB13768)
          Length = 568

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 37/84 (44%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F++ +L ++D   RE Q L+LAPTRELAQQ+    +  G  +   +  +  GG  
Sbjct: 58  GKTAAFALPLLSRLDLQRREPQVLVLAPTRELAQQVAASFVQYGRGVKGLEVLSLCGGQE 117

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
            RE +  L  G  V+VGTPGRV D
Sbjct: 118 YREQLSGLRRGAQVIVGTPGRVID 141



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 31/81 (38%), Positives = 47/81 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R +L  + +   VLDEADEML  GF D +  V      D Q +  SAT+PD++  +   +
Sbjct: 145 RGSLKLDGLNALVLDEADEMLRMGFIDDVKRVVSDTPKDAQRVFFSATLPDEISRIVNHY 204

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           + DP+RI ++ +  T EGI+Q
Sbjct: 205 LVDPLRIAIETKTKTAEGIEQ 225


>UniRef50_Q8A2K2 Cluster: ATP-dependent RNA helicase; n=10; cellular
           organisms|Rep: ATP-dependent RNA helicase - Bacteroides
           thetaiotaomicron
          Length = 647

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F + +LQQID   R  Q+LIL PTREL  QI   +     +++  K     GG++
Sbjct: 52  GKTAAFGLPLLQQIDVKNRVPQSLILCPTRELCLQIAGDLNDYSKYIDGLKVLPVYGGSS 111

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   IR L+ GVH++V TPGR+ D++
Sbjct: 112 IDSQIRSLKRGVHIIVATPGRLLDLM 137



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/80 (27%), Positives = 46/80 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ +  +T+   V+DEADEML+ GF D I+ +   +  +   +L SATM  ++  +S+ +
Sbjct: 139 RKTVSLSTVHNIVMDEADEMLNMGFTDSINAILADVPKERNTLLFSATMSPEIARISKNY 198

Query: 438 MRDPVRILVQKEELTLEGIK 497
           +++   I + ++  +   +K
Sbjct: 199 LQNAKEITIGRKNESTSNVK 218


>UniRef50_Q14NT1 Cluster: Putative atp-dependent rna helicase
           protein; n=1; Spiroplasma citri|Rep: Putative
           atp-dependent rna helicase protein - Spiroplasma citri
          Length = 443

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 36/85 (42%), Positives = 49/85 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L  + IK  VLDEADEML  GFK  +  VF+      Q +L SATMP  VLE++  +
Sbjct: 136 RKTLRLDKIKTIVLDEADEMLKMGFKTDLDKVFQNAPNKYQTLLFSATMPKQVLEIANNY 195

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
             +PV I+V K  +    I Q Y++
Sbjct: 196 QTNPVEIVVTKNVIEQNNISQHYVN 220



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 34/86 (39%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGTN 177
           GKT  F + ILQ ++T +++ QA+IL PT ELA QI + V     +L       I GG++
Sbjct: 50  GKTVAFIVPILQNLNTHLKQPQAIILCPTHELASQIIEQVRKFATYLEGVNATLICGGSH 109

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           ++  I  L    +++VGTPGR+ D I
Sbjct: 110 IQRQIYALRKS-NIIVGTPGRIADHI 134


>UniRef50_Q82T78 Cluster: RhlE; ATP-dependent RNA helicase RhlE;
           n=3; Nitrosomonadaceae|Rep: RhlE; ATP-dependent RNA
           helicase RhlE - Nitrosomonas europaea
          Length = 498

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 49/144 (34%), Positives = 77/144 (53%), Gaps = 13/144 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI----DTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA F++ +L ++    +TS+   +    ALI+APTRELA QI + V   G +L  +  
Sbjct: 54  GKTAGFTLPLLYRLQAYANTSVSPARHPVRALIMAPTRELAMQIDESVRKYGKYLALRTA 113

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI--LVVRFMPTPSNFL---FLMKLMKCC 321
              GG N+   I  L++GV ++V TPGR+ D++    V F  T    L     M  M   
Sbjct: 114 VVFGGINIEPQIAALQAGVEILVATPGRLLDLVEQKAVNFSKTEILVLDEADRMLDMGFL 173

Query: 322 PEVSRTRSMMSSRFCQLMFKSYYS 393
           P++ R  +++S +   LMF + +S
Sbjct: 174 PDIKRVMALLSPQRQSLMFSATFS 197



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/79 (31%), Positives = 43/79 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A++ +  ++ VLDEAD ML  GF   I  V  +LS   Q ++ SAT   ++ +++   
Sbjct: 148 QKAVNFSKTEILVLDEADRMLDMGFLPDIKRVMALLSPQRQSLMFSATFSGEIRKLADSL 207

Query: 438 MRDPVRILVQKEELTLEGI 494
           ++ PVRI    +    E I
Sbjct: 208 LKQPVRIEAAVQNTVNESI 226


>UniRef50_Q6F0U0 Cluster: ATP-dependent RNA helicase; n=1;
           Mesoplasma florum|Rep: ATP-dependent RNA helicase -
           Mesoplasma florum (Acholeplasma florum)
          Length = 666

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA+F + IL++I+ + R  QA+I+APTRELA QI   +   G  + N      IGG +
Sbjct: 50  GKTASFVLPILEKIEPNKRRVQAVIMAPTRELAMQIVNQIRIFGSRIENLVIAPLIGGAD 109

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           +R+ I++L+    +VVGTPGRV D
Sbjct: 110 MRDQIKRLKDS-QIVVGTPGRVND 132



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 25/63 (39%), Positives = 42/63 (66%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L  + ++  +LDEADEML  GFK++I  +F+ +S DVQ+ L SAT    V++++  +
Sbjct: 136 RKTLKLDDVRTIILDEADEMLKMGFKNEIDALFERVSPDVQIGLFSATTSPKVMQIANDY 195

Query: 438 MRD 446
           M +
Sbjct: 196 MNE 198


>UniRef50_Q5L3G9 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=7; Bacteria|Rep: DEAD-box ATP-dependent RNA helicase
           ydbR - Geobacillus kaustophilus
          Length = 467

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/85 (40%), Positives = 51/85 (60%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I I+++++      QAL++APTRELA Q+ + +  +G     +     GG ++
Sbjct: 51  GKTAAFGIPIVEKVNVKNSAVQALVVAPTRELAIQVSEELYKIGAVKRVRVLPIYGGQDI 110

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
              IR L+   HV+VGTPGR+ D I
Sbjct: 111 ERQIRALKKHPHVIVGTPGRIIDHI 135



 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           T R  H +T+   VLDEADEML+ GF + I  +   + A+ Q +L SATMPD +  ++  
Sbjct: 139 TLRLEHVHTV---VLDEADEMLNMGFIEDIEAILSHVPAERQTLLFSATMPDPIRRIAER 195

Query: 435 FMRDPVRILVQKEELTLEGIKQFYM 509
           FM +P  + V+ +E+T+  I+Q+Y+
Sbjct: 196 FMNEPELVKVKAKEMTVPNIQQYYL 220


>UniRef50_O34750 Cluster: YfmL protein; n=5; Bacillus|Rep: YfmL
           protein - Bacillus subtilis
          Length = 376

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 32/85 (37%), Positives = 55/85 (64%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  +++ +L++I    +  QA+ILAP+REL  QI +V+         +  + IGG NV
Sbjct: 53  GKTLAYALPVLERIKPEQKHPQAVILAPSRELVMQIFQVIQDWKAGSELRAASLIGGANV 112

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++ + +L+   H++VGTPGRV+++I
Sbjct: 113 KKQVEKLKKHPHIIVGTPGRVFELI 137



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 20/83 (24%), Positives = 42/83 (50%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           + L  + +K  VLDE D+++    ++ +  + K    D Q++  SAT+  +  +V R   
Sbjct: 140 KKLKMHEVKTIVLDETDQLVLPEHRETMKQIIKTTLRDRQLLCFSATLKKETEDVLRELA 199

Query: 441 RDPVRILVQKEELTLEGIKQFYM 509
           ++P  + VQ+ +     +K  Y+
Sbjct: 200 QEPEVLKVQRSKAEAGKVKHQYL 222


>UniRef50_Q8EZ11 Cluster: ATP-dependent RNA helicase; n=4;
           Leptospira|Rep: ATP-dependent RNA helicase - Leptospira
           interrogans
          Length = 521

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 36/83 (43%), Positives = 51/83 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R ++H + IK+ VLDEADEML  GF++ +  + K   AD Q I+ SATM DDVL + + F
Sbjct: 145 RGSIHLDEIKIVVLDEADEMLDMGFREDMEFILKDTPADRQTIMFSATMTDDVLTLMKKF 204

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
              P  I V  ++L+   I+Q Y
Sbjct: 205 QNHPQIIDVTHQKLSAPKIEQIY 227



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F+I  ++ ++   +  QALIL PTREL  Q+ +    L  +  N +     GG  
Sbjct: 58  GKTAAFAIPTIELLEVESKHLQALILCPTRELVIQVSEQFRKLIKYKGNFEVVPIYGGQE 117

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           +   +R L     +V+ TPGR+ D
Sbjct: 118 IERQLRALRKNPQIVIATPGRMMD 141


>UniRef50_Q0FAJ4 Cluster: Dead-box ATP-dependent RNA helicase; n=6;
           Alphaproteobacteria|Rep: Dead-box ATP-dependent RNA
           helicase - alpha proteobacterium HTCC2255
          Length = 531

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F++ ++QQ     I    R  +A+IL+PTRELA QI +  ++ G  L       I
Sbjct: 152 GKTAAFALPLIQQLLMNPIAIKGRSARAIILSPTRELALQIHEAFVSFGKRLPLNFTHAI 211

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG  +R+ +R L  GV ++V TPGR+ D++
Sbjct: 212 GGAPIRKQMRDLSKGVDILVATPGRLEDLV 241



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 29/85 (34%), Positives = 50/85 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  +  K  VLDEAD+ML  GF   +  +   ++ D Q +L SATM  ++ +++  +
Sbjct: 243 QKGLRLDETKFLVLDEADQMLDIGFLPAVKRIISKVNKDRQTLLFSATMSKEIKKLTETY 302

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           + DPV++ V  E  T++ I+Q  MH
Sbjct: 303 LTDPVQVSVTPENSTVDKIEQSLMH 327


>UniRef50_UPI00015B4D43 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 990

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F I  L+ ID  I   Q +ILAPTRE+A QI++V+ +LG  +   K  + IGG  
Sbjct: 73  GKTAVFGIIALEMIDIKISSVQVIILAPTREIAIQIKEVIASLGCEIKGLKVESFIGGVA 132

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +  D ++L S  H+ +G PGRV  +I
Sbjct: 133 MDIDRKKL-SNCHIAIGAPGRVKHLI 157



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/79 (32%), Positives = 44/79 (55%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + ++LFVLDEAD+++   F+  I+ ++  L  + QVI  SAT P D+      +M+ 
Sbjct: 162 LKMDHVRLFVLDEADKLMEESFQKDINYIYAKLPPNRQVISSSATYPGDLEIFLESYMQS 221

Query: 447 PVRILVQKEELTLEGIKQF 503
           P+      +   L G++QF
Sbjct: 222 PILSSADNDGPILVGLRQF 240


>UniRef50_UPI0000E23613 Cluster: PREDICTED: similar to eukaryotic
           initiation factor 4AI; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to eukaryotic initiation factor 4AI -
           Pan troglodytes
          Length = 151

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 33/54 (61%), Positives = 43/54 (79%)
 Frame = +3

Query: 351 VFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQFYMH 512
           +F +  AD  V+LLSA MP DVLEV++ FMRDP+ ILV+KEELTLEG+  FY++
Sbjct: 96  MFVLDEADEMVVLLSAIMPSDVLEVTKKFMRDPIWILVRKEELTLEGVCSFYVN 149



 Score = 33.1 bits (72), Expect(2) = 0.004
 Identities = 15/24 (62%), Positives = 19/24 (79%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQAL 72
           GK ATF+ISILQQI+  ++  QAL
Sbjct: 40  GKMATFAISILQQIELDLKATQAL 63



 Score = 30.3 bits (65), Expect(2) = 0.004
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = +1

Query: 190 IRQLESGVHVVVGTPGRVYDMI 255
           ++Q     H++VGTPG V+DM+
Sbjct: 63  LKQQMEAPHIIVGTPGHVFDML 84


>UniRef50_UPI0000585111 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 1117

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS+  L+ ID +    Q LILAPTRE+A QIQ  + A+G  +   + H  IGGT 
Sbjct: 15  GKTCVFSVIALEGIDLTNPSTQVLILAPTREIAVQIQDTIRAIGCEMEGLRSHVFIGGTL 74

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
              D ++L+   H+ VGTPGR+  +I
Sbjct: 75  FGPDRQKLKK-CHIAVGTPGRIKQLI 99



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/81 (39%), Positives = 55/81 (67%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L   TI+LFVLDEAD++L   F++Q++ ++  LS + Q++ LSAT P+ + +    +MR+
Sbjct: 104 LKTGTIRLFVLDEADKLLDDTFQEQVNWIYNHLSDNKQMLALSATYPEYLAKHLTKYMRE 163

Query: 447 PVRILVQKEELTLEGIKQFYM 509
           P+ + +  ++L L GIKQ Y+
Sbjct: 164 PMFVRLNPKDLALRGIKQLYV 184


>UniRef50_Q89IS2 Cluster: Cold-shock dead-box protein A; n=28;
           Alphaproteobacteria|Rep: Cold-shock dead-box protein A -
           Bradyrhizobium japonicum
          Length = 650

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 34/89 (38%), Positives = 56/89 (62%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  + +++ + +   I   +      ALI+APTRELA Q+Q+ +  L +H + +  +C
Sbjct: 48  GKTLAYGLALAKDLLDGIERFERAGAPLALIVAPTRELALQVQRELAWLYEHADGRVVSC 107

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +GG + R + R+L +G H+VVGTPGR+ D
Sbjct: 108 VGGMDPRREQRELAAGAHIVVGTPGRLCD 136



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 23/73 (31%), Positives = 41/73 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +K  VLDEADEML+ GF++ +  + +      + +L SAT P  ++ +++ +
Sbjct: 140 RGRLDISELKAVVLDEADEMLNLGFREDMEFILETTPETRRTLLFSATFPRGIVALAKQY 199

Query: 438 MRDPVRILVQKEE 476
            +   RI V  +E
Sbjct: 200 QQQAFRIEVAGDE 212


>UniRef50_Q6MR64 Cluster: ATP-dependent RNA helicase; n=5; cellular
           organisms|Rep: ATP-dependent RNA helicase - Bdellovibrio
           bacteriovorus
          Length = 505

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 37/89 (41%), Positives = 50/89 (56%), Gaps = 5/89 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ-----ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA FS+ ILQ +    R+ +      LIL PTRELA QI + + A   HLN K     
Sbjct: 53  GKTAAFSLPILQNLSKHTRKIEPKSPRCLILTPTRELAIQIHENIEAYSKHLNMKHAVIF 112

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDM 252
           GG      +R L+ GV +++ TPGR+ D+
Sbjct: 113 GGVGQNPQVRALQGGVDILIATPGRLMDL 141



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  + +++FVLDEAD ML  GF   I  +  +L      +  SATMP ++  ++   
Sbjct: 144 QKHLKLDRVEIFVLDEADRMLDMGFMQDIKKILPLLPQKRHNLFFSATMPHEIQTLANRI 203

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           + +P ++ V     T E ++Q  M
Sbjct: 204 LVNPKKVEVTPVSSTAEKVEQRVM 227


>UniRef50_Q5NZY2 Cluster: ATP-dependent RNA helicase DeaD; n=18;
           Bacteria|Rep: ATP-dependent RNA helicase DeaD - Azoarcus
           sp. (strain EbN1) (Aromatoleum aromaticum (strain EbN1))
          Length = 658

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 36/86 (41%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F++ +L ++D +++  Q L+LAPTRELA Q+ +       +L         GG +
Sbjct: 93  GKTAAFALPLLDRLDLAVKNPQVLVLAPTRELAIQVAEAFQRYAKNLPGFHVLPVYGGQS 152

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   +RQL  G HV+VGTPGRV D I
Sbjct: 153 MVVQLRQLARGAHVIVGTPGRVMDHI 178



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L+ +++   VLDEADEML  GF D +  + +   A+ Q  L SATMPD +  V+  +
Sbjct: 180 RKSLNLDSLTTLVLDEADEMLRMGFIDDVEWILQHTPAERQTALFSATMPDAIRRVAHRY 239

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           +R+P  + ++    T+   +Q Y
Sbjct: 240 LREPREVKIKASTTTVSTTRQRY 262


>UniRef50_A2U1Q9 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family protein; n=4; Flavobacteriaceae|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH box family protein
           - Polaribacter dokdonensis MED152
          Length = 373

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 34/87 (39%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAK--CHACIGGT 174
           GKTA F + +L  ID +    QALIL+PTREL QQI+K +     +++ +    A  GG 
Sbjct: 52  GKTAAFGLPVLHHIDANSDHIQALILSPTRELVQQIKKQLFKFTKYVDDRIFLEAVFGGE 111

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
            +   +  L+   H+V+ TPGR+ D+I
Sbjct: 112 KIDRQMNNLKRTTHIVIATPGRLIDLI 138



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 2/82 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS-ADVQVILLSATMPDDVLEVSRC 434
           R A+  + +K  +LDEADEMLS GFK  ++ + K  + +D +  L SATMPD++  + + 
Sbjct: 140 RGAVDISHVKTVILDEADEMLSMGFKQDLNRILKFTTKSDRKTWLFSATMPDEIKRIVKT 199

Query: 435 FM-RDPVRILVQKEELTLEGIK 497
           +M  +  RI + K  L    I+
Sbjct: 200 YMDANAPRIEINKNTLVNANIR 221


>UniRef50_P0A9P8 Cluster: Cold-shock DEAD box protein A; n=54;
           Gammaproteobacteria|Rep: Cold-shock DEAD box protein A -
           Shigella flexneri
          Length = 629

 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA FS+ +LQ +D  ++  Q L+LAPTRELA Q+ + +     H+      A  GG  
Sbjct: 55  GKTAAFSLPLLQNLDPELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQR 114

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
               +R L  G  +VVGTPGR+ D
Sbjct: 115 YDVQLRALRQGPQIVVGTPGRLLD 138



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 29/83 (34%), Positives = 43/83 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +   VLDEADEML  GF + +  +   +    Q  L SATMP+ +  ++R F
Sbjct: 142 RGTLDLSKLSGLVLDEADEMLRMGFIEDVETIMAQIPEGHQTALFSATMPEAIRRITRRF 201

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M++P  + +Q    T   I Q Y
Sbjct: 202 MKEPQEVRIQSSVTTRPDISQSY 224


>UniRef50_Q6AMK6 Cluster: Probable ATP-dependent RNA helicase; n=1;
           Desulfotalea psychrophila|Rep: Probable ATP-dependent
           RNA helicase - Desulfotalea psychrophila
          Length = 632

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + +L  ID S +  QAL+LAPTRELAQQ+   +               GG++ 
Sbjct: 104 GKTAAFGLPLLNNIDFSKKCVQALVLAPTRELAQQVGDALATYSGDDGRNVLVVYGGSSY 163

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           +  +  L  G  VVVGTPGR+ D+I
Sbjct: 164 QAQVGGLRRGARVVVGTPGRLLDLI 188



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 28/81 (34%), Positives = 44/81 (54%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +L  + +K  VLDEADEMLS GF D I  +      D Q +L SAT+   V+ ++  ++ 
Sbjct: 192 SLKLDQLKTLVLDEADEMLSMGFIDDIETILSQTPKDRQTMLFSATLSSRVMSIANRYLH 251

Query: 444 DPVRILVQKEELTLEGIKQFY 506
            P  I +  +++    I+Q Y
Sbjct: 252 SPESISISPKQMIGSSIEQRY 272


>UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2;
           Treponema|Rep: ATP-dependent RNA helicase - Treponema
           pallidum
          Length = 649

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 33/85 (38%), Positives = 49/85 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + ++Q++ +      AL+L PTRELA Q+   + +L      + H   GG ++
Sbjct: 96  GKTAAFGLPLIQELGSPCEHPGALVLVPTRELAAQVASELSSLRIQKIPRIHTVYGGVSI 155

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            E +R LE G  ++VGT GRV D I
Sbjct: 156 AEQLRNLEQGGEIIVGTTGRVIDHI 180



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 25/61 (40%), Positives = 40/61 (65%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R +L  + ++ F+LDEADEML+ GF + I  +F   + D +V++ SATMP  +L ++  F
Sbjct: 182 RGSLELSYLRYFILDEADEMLNMGFVEDIESIFSHANKDARVLMFSATMPRQILSIASTF 241

Query: 438 M 440
           M
Sbjct: 242 M 242


>UniRef50_Q0C4R1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=1; Hyphomonas neptunium ATCC 15444|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH box family -
           Hyphomonas neptunium (strain ATCC 15444)
          Length = 708

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 38/92 (41%), Positives = 56/92 (60%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI----DTSIRECQA---LILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT  F ++I  ++    DT +        LI+APTRELA Q+ + +  L  + NA+   
Sbjct: 49  GKTVAFGLAIANELLGGEDTFLIRAATPLGLIIAPTRELALQVARELRWLYANTNAEIAT 108

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           C+GG ++R++ R LE G H+VVGTPGR+ D I
Sbjct: 109 CVGGMDMRDERRALERGAHIVVGTPGRLVDHI 140



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/72 (26%), Positives = 41/72 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R +   + I+  VLDEADEML  GF++++  + +    + + ++ SAT+P  +  ++  +
Sbjct: 142 RGSFDTSAIRAVVLDEADEMLDLGFREELELILEDTPKERRTLMFSATVPKGIAALATRY 201

Query: 438 MRDPVRILVQKE 473
            ++ +RI    +
Sbjct: 202 QKNGLRITTDSD 213


>UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Firmicutes|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 484

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 56/209 (26%), Positives = 98/209 (46%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I I Q +D    + QAL+L PTRELA Q+++ +  +G     K  A  G    
Sbjct: 53  GKTAAFAIPICQLVDWDENKPQALVLVPTRELAIQVKEDMFNIGRFKRLKVAAVYGKAPF 112

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSR-TR 342
               ++L+   HVVVGTPGR+ D +    F  +   +L +     M  M    ++    +
Sbjct: 113 YHQEKELKQKTHVVVGTPGRIIDHMEKGTFDTSQIKYLVIDEADEMFNMGFVDQIETIIK 172

Query: 343 SMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELE 522
            +   R   L+  +  S +  L    +Y+    + ++A +    S   ++      +E  
Sbjct: 173 DLSKKRVTMLLSATMPSAIETLSN--RYMK---DPIHAEIEEESSAVDRISQERYTVEYR 227

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           + K++ L D+    +    +IFCNT+++V
Sbjct: 228 D-KMKLLSDITIVENPDSCIIFCNTKQRV 255



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 31/73 (42%), Positives = 45/73 (61%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           IK  V+DEADEM + GF DQI  + K LS     +LLSATMP  +  +S  +M+DP+   
Sbjct: 147 IKYLVIDEADEMFNMGFVDQIETIIKDLSKKRVTMLLSATMPSAIETLSNRYMKDPIHAE 206

Query: 462 VQKEELTLEGIKQ 500
           +++E   ++ I Q
Sbjct: 207 IEEESSAVDRISQ 219


>UniRef50_A4J5M3 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Clostridiales|Rep: DEAD/DEAH box helicase domain
           protein - Desulfotomaculum reducens MI-1
          Length = 438

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 37/87 (42%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH--LNAKCHACIGGT 174
           GKT  + + I Q+ID+S RE QALILAPT EL  QI K +  L  +  L       IG  
Sbjct: 52  GKTLAYLLPIFQKIDSSKRETQALILAPTHELVMQIDKQIKTLSSNAGLTINSTVMIGEV 111

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
           N+   I +L+   H++VG+ GRV ++I
Sbjct: 112 NIVRQIEKLKEKPHIIVGSTGRVLELI 138



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/84 (29%), Positives = 43/84 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ + ++TIK  V+DEAD +L +     + DV K    D Q+++ SA M    +  S+  
Sbjct: 140 RKKISSHTIKTIVIDEADMLLDQNNLAGVKDVIKTTMRDRQLMIFSAYMNQRAMAESKEL 199

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
            +D   I+++ E L    I   Y+
Sbjct: 200 TKDAEVIIIEDEILVNPNITHLYL 223


>UniRef50_Q01PH0 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Solibacter usitatus Ellin6076|Rep: DEAD/DEAH box
           helicase domain protein - Solibacter usitatus (strain
           Ellin6076)
          Length = 422

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKT  F +  +Q + T  R+   +ALIL PTRELA QI + ++ +      +    +GG 
Sbjct: 51  GKTLAFLLPTIQLLSTEPRQPGVRALILTPTRELALQINEALLQIARGTGIRAAVAVGGL 110

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
           N R  +R +  G ++VV TPGR+YD +
Sbjct: 111 NERSQLRDIRGGANIVVATPGRLYDFM 137



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/68 (32%), Positives = 39/68 (57%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           +R  ++  T+++ +LDE+D ML  GF   I  +   + A+ Q +L SAT+   V ++   
Sbjct: 138 SRGLINLTTVRMLILDESDRMLDMGFLPTIKRIIAAMPAERQTLLFSATLESSVKQLVET 197

Query: 435 FMRDPVRI 458
            +R+ VRI
Sbjct: 198 HVRNAVRI 205


>UniRef50_Q014T4 Cluster: Chromosome 07 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 07 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 506

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 34/91 (37%), Positives = 59/91 (64%), Gaps = 2/91 (2%)
 Frame = -2

Query: 503 KLFNTFQGKLFLLYKYAYRISHKASRYFQYIIRHGSRE*YDLNIS*QNLEDIMDLVLETS 324
           +L NTF+G+   L + A+R+ H+ +R  + + R    E  +LN+  +  ED++DL+LETS
Sbjct: 198 ELLNTFKGEFVTLDQNAHRLGHELARDLERLRRKRRGENTNLNLRREQGEDVVDLILETS 257

Query: 323 GQHFISFIKNKKFDGVGMKRTTS--IISYTR 237
           G+HFI F+K+K  D V ++  T+  +++ TR
Sbjct: 258 GKHFIGFVKSKDLDVVALQSATTKHVVNSTR 288



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/80 (31%), Positives = 44/80 (55%)
 Frame = -1

Query: 252 HIIYTTWSAHHHMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLLGQLSCGSQD 73
           H++ +T      ++T+L+ A IFT+    +A +A  ++V+ +  H LL+LLGQL    QD
Sbjct: 282 HVVNSTRGTDDDVDTSLEDAGIFTNGRTADARVALHLKVVAEGAHDLLDLLGQLPRRRQD 341

Query: 72  QSLTFTNACIDLL*NRYRES 13
           + L   +  +  L +   ES
Sbjct: 342 ERLALGDGVVQGLEDTGAES 361


>UniRef50_Q22MC1 Cluster: Type III restriction enzyme, res subunit
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Type III restriction enzyme, res subunit family protein
           - Tetrahymena thermophila SB210
          Length = 440

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 35/85 (41%), Positives = 47/85 (55%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+  ILQ +        A++L   RELA QI +     G  LN +    +GG + 
Sbjct: 51  GKTATFAFPILQDLAKDPFGVFAIVLTANRELAMQISEQFTIFGSSLNLRVSTLVGGVDF 110

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            + + +LE   H+VVGTPGR  DMI
Sbjct: 111 NKQLSELERIPHIVVGTPGRTLDMI 135



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 15/48 (31%), Positives = 26/48 (54%)
 Frame = +3

Query: 270 HANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDD 413
           +   +K  VLDEAD +      + I  + + +  + Q+IL +AT+ DD
Sbjct: 144 YIENVKYLVLDEADRLFEDSIIEDIQSILEFIPQEKQIILATATINDD 191


>UniRef50_P38712 Cluster: ATP-dependent rRNA helicase RRP3; n=6;
           Ascomycota|Rep: ATP-dependent rRNA helicase RRP3 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 501

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 34/83 (40%), Positives = 49/83 (59%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I IL ++        A ILAPTRELAQQI++   +LG  +  +    +GG N+
Sbjct: 130 GKTAAFAIPILNRLWHDQEPYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNM 189

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
            +  R L    H+++ TPGR+ D
Sbjct: 190 MDQARDLMRKPHIIIATPGRLMD 212



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKIL-SADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           +K  V+DEAD +L   F   +  + KI+ + +    L SATM   + ++ R  + +PV+ 
Sbjct: 225 LKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASLTNPVKC 284

Query: 459 LVQKEELTLEGIKQFYM 509
            V  +  T++ + Q  M
Sbjct: 285 AVSNKYQTVDTLVQTLM 301


>UniRef50_Q1VL45 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: DEAD/DEAH box
           helicase-like protein - Psychroflexus torquis ATCC
           700755
          Length = 255

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 36/84 (42%), Positives = 50/84 (59%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + IL++   S  + QAL+LAPTRELA Q+ +    L  +         GGT++
Sbjct: 54  GKTAAFGLPILERCQPS-GKLQALVLAPTRELANQVAQEFELLQGNAGLSIVTVYGGTDL 112

Query: 181 REDIRQLESGVHVVVGTPGRVYDM 252
            +  + L  GV ++VGTPGRV DM
Sbjct: 113 EKQAKTLAKGVDIIVGTPGRVMDM 136



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  +  N+ K+  LDEAD ML  GF   I  + + +++  Q +L SAT P ++++ +  F
Sbjct: 139 RGHIDLNSPKMLCLDEADRMLDMGFFPDIMWIVERMTSRQQTLLFSATFPQEIIDAAHEF 198

Query: 438 MRDPVRILVQKEELTLEGI 494
           M +P  +L   EEL +  I
Sbjct: 199 MNEPDFVLTNAEELDIPPI 217


>UniRef50_Q5GZA1 Cluster: ATP-dependent RNA helicase; n=6;
           Xanthomonas|Rep: ATP-dependent RNA helicase -
           Xanthomonas oryzae pv. oryzae
          Length = 482

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 36/86 (41%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + +LQ++D ++   QAL+L PTRELA Q+ K +  L   + N K     GG  
Sbjct: 75  GKTAAFGLGLLQKLDPALTRAQALVLCPTRELADQVGKQLRKLATGIPNMKLVVLTGGMP 134

Query: 178 VREDIRQLES-GVHVVVGTPGRVYDM 252
           +   +  LE+   HVVVGTPGR+ ++
Sbjct: 135 LGPQLASLEAHDPHVVVGTPGRIQEL 160



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/83 (36%), Positives = 48/83 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +RALH   ++  VLDEAD ML  GF++ I ++        Q +L SAT PD +  ++R  
Sbjct: 163 KRALHLGGVRTLVLDEADRMLDMGFEEPIREIASRCDKHRQSLLFSATFPDIIRTLAREI 222

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           ++DP+ I V+  +   E  +QF+
Sbjct: 223 LKDPIEITVEGADNAPEIDQQFF 245


>UniRef50_Q2LY23 Cluster: Superfamily II DNA and RNA helicases; n=2;
           Bacteria|Rep: Superfamily II DNA and RNA helicases -
           Syntrophus aciditrophicus (strain SB)
          Length = 572

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F I ++Q  DT ++  QAL+L PTREL  Q+   +  +G ++   K     GG +
Sbjct: 52  GKTAAFGIPLIQLTDTRLKRTQALVLCPTRELCVQVAGDLNLMGRYVQKLKIVPVYGGAS 111

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +     +L  G  VVV TPGR++D+I
Sbjct: 112 IVSQTEELRKGAQVVVATPGRLHDLI 137



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R A+  + +   VLDEADEML  GF+D+++ +  +       +L SATMP +V  ++  +
Sbjct: 139 RGAVDLSGVSWVVLDEADEMLQMGFQDELNAILAVTPDSKNTLLFSATMPREVAAIAANY 198

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M+DP+ I+V +     E +   Y
Sbjct: 199 MKDPLEIIVGRRNAGAENVDHIY 221


>UniRef50_Q188H5 Cluster: Putative ATP-dependent RNA helicase; n=2;
           Clostridium difficile|Rep: Putative ATP-dependent RNA
           helicase - Clostridium difficile (strain 630)
          Length = 381

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 38/88 (43%), Positives = 56/88 (63%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQI--QKVVIALGDHLNAKCHACIGGT 174
           GKT  + + I ++IDTS RE QALILAPT EL  QI  Q  ++A    L+    A IG  
Sbjct: 51  GKTLAYLLPIFEKIDTSKRETQALILAPTHELVMQITNQVELLAKNAELSVTSLALIGEV 110

Query: 175 NVREDIRQLES-GVHVVVGTPGRVYDMI 255
           N+++ I+ +++   H+V+G+ GRV D+I
Sbjct: 111 NIQKQIKNIKAVKPHIVIGSCGRVLDLI 138



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L ++ IK  VLDE D +L+      I D+ +    D Q+I  SA++ D  +++    
Sbjct: 140 QKKLKSHNIKTIVLDEVDNLLNGKNITCIEDIIRTTLRDRQIIGCSASLTDSTIKICDKL 199

Query: 438 MRDPVRILVQKEE 476
           M++   I+  KE+
Sbjct: 200 MKE-FEIIKTKEK 211


>UniRef50_A6TTG0 Cluster: DEAD/DEAH box helicase domain protein;
           n=3; Clostridiaceae|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 549

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 32/83 (38%), Positives = 49/83 (59%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F + IL++++      QALI+ PTRELA QI      L +       A  GG +V
Sbjct: 52  GKTLAFILPILERVNVEKPTIQALIITPTRELAIQITAETKKLAEVKGINILAAYGGQDV 111

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
            + +R+L+  +H+++GTPGR+ D
Sbjct: 112 EQQLRKLKGSIHIIIGTPGRLLD 134



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/81 (37%), Positives = 50/81 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ ++   + + VLDEAD+ML  GF   + D+   +    Q +  SATMP+ V  ++  +
Sbjct: 138 RKTINLGKLSMLVLDEADQMLHMGFLRDVEDIMTHIPKRRQNMFFSATMPNQVRTLAEQY 197

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           M+DPV+I VQ + +TL+ I+Q
Sbjct: 198 MKDPVQIQVQSKRVTLDEIRQ 218


>UniRef50_A6H0L1 Cluster: Probable ATP-dependent RNA helicase,
           DEAD/DEAH box family; n=1; Flavobacterium psychrophilum
           JIP02/86|Rep: Probable ATP-dependent RNA helicase,
           DEAD/DEAH box family - Flavobacterium psychrophilum
           (strain JIP02/86 / ATCC 49511)
          Length = 644

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 35/86 (40%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F   ++Q+ID + R  QALIL+PTREL  QI   +     +       A  GG +
Sbjct: 52  GKTAAFGFPVIQKIDANNRNTQALILSPTRELCLQITNELKNYSKYEKGINVVAVYGGAS 111

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + E  R ++ G  ++V TPGR+ DMI
Sbjct: 112 ITEQARDIKRGAQIIVATPGRMQDMI 137



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/69 (39%), Positives = 39/69 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR +  + I   +LDEADEML+ GF + I ++      +    L SATMP +V  + + F
Sbjct: 139 RRLVDISQINYCILDEADEMLNMGFYEDIVNILSTTPDEKNTWLFSATMPAEVARIGKQF 198

Query: 438 MRDPVRILV 464
           M DP+ I V
Sbjct: 199 MTDPIEITV 207


>UniRef50_A4M6V6 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; cellular organisms|Rep: DEAD/DEAH box helicase
           domain protein - Petrotoga mobilis SJ95
          Length = 530

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 33/83 (39%), Positives = 49/83 (59%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I +++++D    + QAL+L PTRELA Q+   + +L  +         GG ++
Sbjct: 52  GKTAAFGIPLIERLDEKANDVQALVLTPTRELALQVCNEIDSLKGNKRLNLLPVYGGVSI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
              IR L+  V +VVGTPGR+ D
Sbjct: 112 GNQIRALKRRVDLVVGTPGRIID 134



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L    IK  V+DEADEML  GF + +  +    + + Q+++ SATMP  ++ ++R  
Sbjct: 138 RGTLDITKIKYLVIDEADEMLDMGFIEDVEMILSKTNKEKQILMFSATMPQRIVTLARKH 197

Query: 438 M---RDPVRILVQKEELTLEGIKQFY 506
           M        +   KE++T++  KQ Y
Sbjct: 198 MGNFETVTTVQENKEDITVKKAKQIY 223


>UniRef50_Q4N4B1 Cluster: ATP-dependent RNA helicase, putative; n=4;
           Eukaryota|Rep: ATP-dependent RNA helicase, putative -
           Theileria parva
          Length = 470

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 34/83 (40%), Positives = 52/83 (62%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I ILQ++    +   +LILAPTREL+ QI++ +I+LG  +       +GG ++
Sbjct: 90  GKTAAFTIPILQKLLEKPQRLFSLILAPTRELSLQIKEQLISLGSEIGLDVCLILGGLDM 149

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                QL    H++VG+PGR+ D
Sbjct: 150 VSQALQLSKKPHIIVGSPGRIAD 172



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 27/77 (35%), Positives = 42/77 (54%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           TIK  VLDEAD++LS  F D ++ +   L  D    L SATM   + ++ +  +  P++I
Sbjct: 184 TIKYLVLDEADKLLSTDFDDSLNKIITSLPKDKVTYLYSATMTSKITKLQKVTLMKPIQI 243

Query: 459 LVQKEELTLEGIKQFYM 509
            V  +  T E + Q Y+
Sbjct: 244 NVNTKYHTSEHLIQKYL 260


>UniRef50_Q2NEZ7 Cluster: Predicted helicase; n=6; cellular
           organisms|Rep: Predicted helicase - Methanosphaera
           stadtmanae (strain DSM 3091)
          Length = 583

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F I +L+ ID+     QA+IL PTRELA Q+ + +  L  +L         GG  
Sbjct: 53  GKTAAFGIPLLENIDSEDNNLQAIILCPTRELAIQVAEELRKLSVYLPKIDVLPVYGGQP 112

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   I+ L+ GV +++GTPGRV D I
Sbjct: 113 IDRQIKALQKGVQIIIGTPGRVMDHI 138



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 31/83 (37%), Positives = 51/83 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  N IK  +LDEADEML  GF++ I  + + +  + Q +L SAT+P ++L++++ +
Sbjct: 140 RGTLSLNNIKTVILDEADEMLDMGFREDIEYILEDIPYERQFLLFSATLPQEILQLAQRY 199

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
             +P  + V K ELT   ++Q Y
Sbjct: 200 QTNPEIVKVTKHELTTPDVEQKY 222


>UniRef50_Q81QF0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=25; Firmicutes|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 450

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTN 177
           GKT  F + IL++ID    + QALI+APTRELA QI  ++   L    +    A  GG +
Sbjct: 54  GKTLAFVLPILEKIDPESSDVQALIVAPTRELALQITTEIKKMLVQREDINVLAIYGGQD 113

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           V + +R+L+   H+VV TPGR+ D I
Sbjct: 114 VAQQLRKLKGNTHIVVATPGRLLDHI 139



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  +  + +   VLDEAD+ML  GF   I D+        Q +L SAT+P D+ ++++ +
Sbjct: 141 RETIDLSNLSTIVLDEADQMLYFGFLYDIEDILDETPGSKQTMLFSATIPKDIKKLAKRY 200

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           M +P  I VQ EE+T++ I+Q
Sbjct: 201 MDEPQMIQVQSEEVTVDTIEQ 221


>UniRef50_Q4PNH7 Cluster: Putative cold-shock dead-box protein A;
           n=1; uncultured marine bacterium 66A03|Rep: Putative
           cold-shock dead-box protein A - uncultured marine
           bacterium 66A03
          Length = 659

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 40/91 (43%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F ISI   +     E        A+I+APTRELA Q++K +  L     A+  +C
Sbjct: 49  GKTLAFGISIATTLLAEKMEFDRPKIPLAIIIAPTRELALQVRKELEWLYVRTKAQFASC 108

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           +GG + R + R LESG H+VVGTPGR+ D I
Sbjct: 109 VGGMDPRAERRTLESGAHIVVGTPGRLRDHI 139



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 25/73 (34%), Positives = 44/73 (60%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + IK  VLDEADEML  GF++ +  +      + + +L SAT+P  ++++++ +
Sbjct: 141 RGVLRLSDIKAVVLDEADEMLDMGFREDLTFILGKAPVERRTLLFSATVPTQIVKLAKTY 200

Query: 438 MRDPVRILVQKEE 476
            +D VRI V  ++
Sbjct: 201 QKDSVRISVSSKK 213


>UniRef50_P75172 Cluster: Probable ATP-dependent RNA helicase MG425
           homolog; n=4; Mycoplasma|Rep: Probable ATP-dependent RNA
           helicase MG425 homolog - Mycoplasma pneumoniae
          Length = 450

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 35/87 (40%), Positives = 53/87 (60%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F I +++ +    S    Q L++APTRELA+QI+   I    H + K  + IGG 
Sbjct: 52  GKTAVFGIPVIETLLKKPSKGTTQTLVVAPTRELAEQIKTTFINFAKHTHLKVVSLIGGI 111

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
            + + ++QLE+   +VVGT GRV D++
Sbjct: 112 PIWQQLKQLENQPEIVVGTMGRVMDLL 138



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           ++DE D ML RGFK ++ D+   +    Q+ + SA+  ++ +E ++
Sbjct: 152 IIDEVDLMLDRGFKRKLFDLLSRIEKFEQIAVYSASYNEETIETAK 197


>UniRef50_UPI0000D55AB0 Cluster: PREDICTED: similar to Probable
           ATP-dependent RNA helicase DDX20 (DEAD box protein 20)
           (DEAD box protein DP 103) (Component of gems 3)
           (Gemin-3) (Regulator of steroidogenic factor 1)
           (ROSF-1); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to Probable ATP-dependent RNA helicase DDX20
           (DEAD box protein 20) (DEAD box protein DP 103)
           (Component of gems 3) (Gemin-3) (Regulator of
           steroidogenic factor 1) (ROSF-1) - Tribolium castaneum
          Length = 688

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 35/86 (40%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L+ ++T+    Q LIL PTRE+A QI+ V+ ++G H+N  K  + IGG  
Sbjct: 73  GKTLVFSTIALETVNTAKDHLQVLILVPTREIAVQIEDVLRSVGCHVNGLKIESFIGGRP 132

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D+++  S  H+ VG PGRV  ++
Sbjct: 133 LEDDLKK-SSKCHIAVGAPGRVKHLL 157



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 29/80 (36%), Positives = 47/80 (58%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           AL  N +KLFVLDEAD+++   F+  I++++  L    Q+I+ SAT P ++      +M+
Sbjct: 161 ALTTNLVKLFVLDEADKLMEESFQSDINEIYNSLPPRKQMIVSSATYPQELDTFLANYMQ 220

Query: 444 DPVRILVQKEELTLEGIKQF 503
            P  +  + E   L G+KQF
Sbjct: 221 SPTHVTSENETPLLLGLKQF 240


>UniRef50_Q8R4Z5 Cluster: DEAD-box corepressor DP103 beta; n=5;
           Tetrapoda|Rep: DEAD-box corepressor DP103 beta - Mus
           musculus (Mouse)
          Length = 505

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 112 GKTCVFSTIALDSLILENYSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 171

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 172 LSQDKTRLKK-CHIAVGSPGRIKQLI 196



 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 201 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEVLANALTRYMR 260

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 261 DPTFVRLNPSDPSLIGLKQYY 281


>UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellular
           organisms|Rep: ATP-dependent RNA helicase - Xylella
           fastidiosa
          Length = 614

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 31/83 (37%), Positives = 49/83 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +K  VLDEADEML  GF + + +V + L A  QV L SATMP  +  +++ +
Sbjct: 151 RGTLDLSELKTLVLDEADEMLRMGFIEDVEEVLRKLPASRQVALFSATMPPQIRRIAQTY 210

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           ++DP+ + +  +  T   I+Q Y
Sbjct: 211 LQDPIEVTIATKTTTAANIRQRY 233



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F++ +L +   +  + Q L+LAPTRELA Q+ +        ++  +     GG +
Sbjct: 64  GKTAAFALPLLTRTVLNQVKPQVLVLAPTRELAIQVAEAFQRYAASISGFRVLPVYGGQS 123

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
             + +  L+ GVHV+VGTPGRV D
Sbjct: 124 YGQQLAALKRGVHVIVGTPGRVID 147


>UniRef50_Q6MBR0 Cluster: Putative ATP-dependent RNA helicase; n=1;
           Candidatus Protochlamydia amoebophila UWE25|Rep:
           Putative ATP-dependent RNA helicase - Protochlamydia
           amoebophila (strain UWE25)
          Length = 407

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 35/85 (41%), Positives = 49/85 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTAT +I I  +++T + + QALI+ PTRELA Q       +G +   K  A  GG + 
Sbjct: 64  GKTATCAIPICNRVNTELTDIQALIIVPTRELALQYATETQKIGKYKGVKAFAIFGGEDS 123

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
                +L+ GV V+V TPGR+ D I
Sbjct: 124 ALQQSKLKHGVQVLVATPGRLIDFI 148



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 24/66 (36%), Positives = 40/66 (60%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R +  + ++  +LDEADEMLS GF D +  + + L+   Q +L SATMP  +  +++  M
Sbjct: 151 RQIDLSHVETLILDEADEMLSMGFYDDLVFIIQCLNHSHQTLLFSATMPAAIQRLAKHHM 210

Query: 441 RDPVRI 458
           +DP  +
Sbjct: 211 KDPQEV 216


>UniRef50_Q5QWG1 Cluster: ATP-dependent RNA helicase; n=1;
           Idiomarina loihiensis|Rep: ATP-dependent RNA helicase -
           Idiomarina loihiensis
          Length = 474

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 37/84 (44%), Positives = 47/84 (55%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG-DHLNAKCHACIGGTN 177
           GKT  F++++L +++      QAL+L PTRELA Q+   V  L    LN K     GG  
Sbjct: 70  GKTTAFALTLLAKLEAKSFSPQALVLCPTRELAHQVADEVRKLAKSMLNIKILTLCGGEP 129

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
            R     LE G HV+VGTPGRV D
Sbjct: 130 SRIQTNSLEHGAHVLVGTPGRVLD 153



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 19/53 (35%), Positives = 31/53 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDV 416
           +R +  + +   VLDEAD ML  GF+D ++ + K +    Q +L SAT P ++
Sbjct: 157 QRNVDLSMLTTLVLDEADRMLEMGFQDSLNAIVKHIPKTRQTLLFSATYPKNI 209


>UniRef50_Q15T34 Cluster: DEAD/DEAH box helicase-like; n=1;
           Pseudoalteromonas atlantica T6c|Rep: DEAD/DEAH box
           helicase-like - Pseudoalteromonas atlantica (strain T6c
           / BAA-1087)
          Length = 458

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 34/88 (38%), Positives = 52/88 (59%), Gaps = 4/88 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQI----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA F++ +LQ++     T ++  ++LI+ PTRELA Q+   V      LN +  A  G
Sbjct: 50  GKTAAFTLPLLQRLAAKQSTKVQGVRSLIVTPTRELAAQVAISVEIYSTQLNIRSFAVYG 109

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDM 252
           G  +   I QL+ GV V++ TPGR+ D+
Sbjct: 110 GVRIEPQIAQLQEGVDVLIATPGRLLDL 137



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/83 (31%), Positives = 41/83 (49%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +RALH   +++ V DEAD ML  GF D +  +  +L    Q +L SAT    +   +R  
Sbjct: 140 QRALHFENLEILVFDEADRMLDLGFIDDVKRIQSLLPVKRQTLLFSATFSKQIKHFAREM 199

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           +  P  I V     T++ + Q +
Sbjct: 200 LNAPKTIEVSAVNSTVDLVAQTF 222


>UniRef50_Q03YT1 Cluster: Superfamily II DNA and RNA helicase; n=1;
           Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293|Rep: Superfamily II DNA and RNA helicase -
           Leuconostoc mesenteroides subsp. mesenteroides (strain
           ATCC 8293 /NCDO 523)
          Length = 431

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 35/86 (40%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F + +L +IDT+++  Q LILAP++ELA Q  +V    G+ + A   + IGG N 
Sbjct: 42  GKTLAFVLPVLSRIDTNLKRTQVLILAPSQELAMQTTQVAREWGNAVGASVASLIGGANG 101

Query: 181 REDIRQLESG-VHVVVGTPGRVYDMI 255
           R    +++    H+VVGT GRV  M+
Sbjct: 102 RRQADKIKKDKPHIVVGTLGRVLTMV 127



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           L  + I   + DEAD ML+    D +H++   L + +Q+ L SAT   D+  VS  F
Sbjct: 132 LKLDHIATVIFDEADAMLTEERHDSLHELADKLPSHIQLGLFSATSGVDLNYVSDTF 188


>UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Fervidobacterium nodosum Rt17-B1|Rep: DEAD/DEAH box
           helicase domain protein - Fervidobacterium nodosum
           Rt17-B1
          Length = 571

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 30/83 (36%), Positives = 50/83 (60%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + ++  VLDEAD ML  GF D + ++ K    + +  L SATMP ++++++R F
Sbjct: 155 RDTLDLSHVEYLVLDEADRMLDMGFLDDVLEIIKRTGENKRTFLFSATMPKEIVDIARKF 214

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M++ + +   K+ELT E  +Q Y
Sbjct: 215 MKEYIHVSTVKDELTTENAEQLY 237



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 35/84 (41%), Positives = 51/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA F I +L++ID    +  +A+I+ PTRELA QI + + +L      K     GG +
Sbjct: 68  GKTAAFGIPLLERIDFKANKFVKAIIVTPTRELALQIFEELKSLKGTKRVKITTLYGGQS 127

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           + +  + LE GV +VVGTPGR+ D
Sbjct: 128 LEKQFKDLEKGVDIVVGTPGRIID 151


>UniRef50_A4BET4 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Reinekea sp. MED297|Rep: DEAD/DEAH box helicase-like
           protein - Reinekea sp. MED297
          Length = 579

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 36/84 (42%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA FS+ +L +IDT+  + QAL+L PTRELA Q+ +        + N       GG +
Sbjct: 54  GKTAAFSLPLLSRIDTTKNKPQALVLCPTRELAIQVAEAFQTYARGVDNFHVLPIYGGAD 113

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           +R  +R L+    V+VGTPGRV D
Sbjct: 114 MRNQLRALKQNPQVIVGTPGRVMD 137



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 30/81 (37%), Positives = 45/81 (55%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +K  VLDEADEML  GF + I  + +    D Q  L SATMP  +  ++  +
Sbjct: 141 RGTLDLSDLKHLVLDEADEMLRMGFIEDIDWILEHTPKDKQTALFSATMPHQIKRITDQY 200

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
            +DPV+I ++     L+ I+Q
Sbjct: 201 QKDPVKIEIKASHSELQQIEQ 221


>UniRef50_A3ZWP8 Cluster: ATP-dependent RNA helicase; n=1;
           Blastopirellula marina DSM 3645|Rep: ATP-dependent RNA
           helicase - Blastopirellula marina DSM 3645
          Length = 428

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 36/87 (41%), Positives = 52/87 (59%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQID--TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F I I+++++   + R  QALIL PTRELA Q++  +  L         A  GG 
Sbjct: 53  GKTAAFGIPIIERLEHGPNSRNPQALILTPTRELAVQVRDEIAKLTHGQRINVVAVYGGK 112

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
            +R  + +L+   H+VVGTPGRV D++
Sbjct: 113 PLRSQMEKLKRAPHIVVGTPGRVIDLM 139



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/84 (35%), Positives = 50/84 (59%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           TRRAL    ++  VLDEAD ML  GF+  I  + +    + Q +LLSAT+P  + ++++ 
Sbjct: 140 TRRALQLEMLRTVVLDEADRMLDIGFRPDIEKILRRCPEERQTLLLSATVPPTIEKLAQR 199

Query: 435 FMRDPVRILVQKEELTLEGIKQFY 506
           +MR+P ++      ++ E I+Q Y
Sbjct: 200 YMRNPEKVDFSPTNISAETIEQRY 223


>UniRef50_A0V009 Cluster: DEAD/DEAH box helicase-like; n=1;
           Clostridium cellulolyticum H10|Rep: DEAD/DEAH box
           helicase-like - Clostridium cellulolyticum H10
          Length = 542

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 36/85 (42%), Positives = 47/85 (55%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F +SILQ  +      Q LIL P RELA Q+   +  +  +L  K  A  G  N+
Sbjct: 52  GKTAVFGVSILQLTNPEEAGPQGLILTPARELAVQVDNDIRKMAKYLKHKTTAIYGQHNI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
             + + L  GV +V GTPGRV+D I
Sbjct: 112 NLETQILNKGVSIVTGTPGRVFDHI 136



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 30/80 (37%), Positives = 46/80 (57%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L    I+  VLDEAD ML  GF DQ+  + K L  +   +L SATMP ++  + + +M +
Sbjct: 141 LSTKNIRFLVLDEADRMLDMGFLDQVVRIVKTLPKERITLLFSATMPPEIHNICKRYMNN 200

Query: 447 PVRILVQKEELTLEGIKQFY 506
           PV I ++ +  T++ I Q Y
Sbjct: 201 PVTIEIESQTKTVDTIHQVY 220


>UniRef50_Q978T9 Cluster: ATP-dependent RNA helicase; n=3;
           Thermoplasma|Rep: ATP-dependent RNA helicase -
           Thermoplasma volcanium
          Length = 373

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 31/83 (37%), Positives = 51/83 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L+ + +  FVLDEADEML  GF + I  +  +L  + Q  L SAT+P +++E+++ F
Sbjct: 136 RGILNFDKVSYFVLDEADEMLDMGFIEDIKKIINVLPVERQSFLFSATIPSEIIELAKGF 195

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M +   + + K+E+T+ GI   Y
Sbjct: 196 MHNEEILFLSKDEVTVNGIDHNY 218



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 34/85 (40%), Positives = 48/85 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA + I I+       +  +ALIL PTRELA Q+ KV  ALG     +     GG ++
Sbjct: 51  GKTAAYLIPIINNTAKE-KGIRALILLPTRELAVQVAKVSEALGKRSGIRTVVVYGGVSI 109

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            + I  +  G +++VGTPGR  D+I
Sbjct: 110 NKQIELILRGANIIVGTPGRTLDLI 134


>UniRef50_Q8SQM5 Cluster: ATP-dependent RNA helicase eIF4A; n=1;
           Encephalitozoon cuniculi|Rep: ATP-dependent RNA helicase
           eIF4A - Encephalitozoon cuniculi
          Length = 425

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 33/83 (39%), Positives = 57/83 (68%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS--ADVQVILLSATMPDDVLEVSRCFM 440
           L  + IKLFV+DEADEML  GF++Q+  +F+ ++   +VQ+ + SAT  ++ L VS   +
Sbjct: 176 LSMDNIKLFVIDEADEMLKAGFQEQVKSIFRRITNKDEVQIAMFSATYDEEELRVSEEIL 235

Query: 441 RDPVRILVQKEELTLEGIKQFYM 509
            +PV I ++  + TL+GI+Q+++
Sbjct: 236 INPVIIDLRYNDQTLKGIRQYFI 258



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 36/85 (42%), Positives = 46/85 (54%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F+++ LQ  D S    Q L+LA TRE+A Q       LG  + A+     GG+ +
Sbjct: 87  GKTGAFAVAALQICDMSQDVTQILVLASTREIAAQNAARFEDLGCFMGARVALLSGGSPI 146

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
             D   LE   H+VVGTPGRV  MI
Sbjct: 147 AADKVALEKKPHIVVGTPGRVEHMI 171


>UniRef50_Q9UHI6 Cluster: Probable ATP-dependent RNA helicase DDX20;
           n=24; Eumetazoa|Rep: Probable ATP-dependent RNA helicase
           DDX20 - Homo sapiens (Human)
          Length = 824

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>UniRef50_Q5NML9 Cluster: DNA and RNA helicase; n=28;
           Alphaproteobacteria|Rep: DNA and RNA helicase -
           Zymomonas mobilis
          Length = 458

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 33/82 (40%), Positives = 50/82 (60%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +RAL    +++FVLDEAD+ML  GF   +  + K+L  + Q +  SATMP  + E+S  F
Sbjct: 146 QRALVLKDVEVFVLDEADQMLDLGFIHALRRIDKLLPKNRQTLFFSATMPKTIQELSSQF 205

Query: 438 MRDPVRILVQKEELTLEGIKQF 503
           + DPV + V  +  T E ++QF
Sbjct: 206 LSDPVTVSVAPQSSTAERVEQF 227



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI-----RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F++  +  + T+      R C+ LIL+PTRELA QI +       HL    +A  
Sbjct: 55  GKTAAFALPSIHYLATNPQARPQRGCRMLILSPTRELASQIARACNDYTRHLRMSVNAVF 114

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG  +   +R L+ G  ++V TPGR+ D+I
Sbjct: 115 GGVPIGRQMRMLDRGTDILVATPGRLLDLI 144


>UniRef50_O66866 Cluster: ATP-dependent RNA helicase DeaD; n=1;
           Aquifex aeolicus|Rep: ATP-dependent RNA helicase DeaD -
           Aquifex aeolicus
          Length = 293

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 40/86 (46%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + IL  +    +   ALILAPTRELA QI+        +LN +  A  GGT V
Sbjct: 21  GKTAAFGLPILNSLKEGEK---ALILAPTRELALQIRDNFRDFARYLNVRTFAFYGGTKV 77

Query: 181 REDIRQLESG-VHVVVGTPGRVYDMI 255
             D++ L  G V VV+GTPGR+ D+I
Sbjct: 78  FGDLKVLRGGKVDVVIGTPGRIKDLI 103



 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 29/74 (39%), Positives = 42/74 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL  + ++ FVLDE D ML   FK+ I  ++  L  + QV  +SAT P +V E+S  +
Sbjct: 105 RGALKTDDVRYFVLDEVDVMLDMNFKEDIDFIYSQLPEEKQVFFVSATFPKEVRELSHRY 164

Query: 438 MRDPVRILVQKEEL 479
            + P  I V+  EL
Sbjct: 165 TKKPEFIKVESREL 178


>UniRef50_A6NQG8 Cluster: Putative uncharacterized protein; n=2;
           Bacteroidales|Rep: Putative uncharacterized protein -
           Bacteroides capillosus ATCC 29799
          Length = 636

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 36/87 (41%), Positives = 51/87 (58%), Gaps = 3/87 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI---RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKT  F+  ILQ++   I   R  ++LIL PTRELA QIQ+   A G HL  +     GG
Sbjct: 50  GKTCAFAAPILQRLGGDIPAGRPIRSLILTPTRELALQIQESFEAYGKHLPLRSAVIFGG 109

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYDM 252
              +  + +L+ GV ++V TPGR+ D+
Sbjct: 110 VGQQPQVDKLKKGVDILVATPGRLLDL 136



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/73 (38%), Positives = 44/73 (60%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +++FVLDEAD ML  GF   +  V K+L A  Q +  SATMP +V+++    +++PV++ 
Sbjct: 147 LEIFVLDEADRMLDMGFLHDVRRVLKLLPAVKQTLFFSATMPPEVMDLVNGLLKNPVKVA 206

Query: 462 VQKEELTLEGIKQ 500
           V      +E I Q
Sbjct: 207 VDPVSSPVEIIDQ 219


>UniRef50_A1U3D6 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Marinobacter aquaeolei VT8|Rep: DEAD/DEAH box
           helicase domain protein - Marinobacter aquaeolei (strain
           ATCC 700491 / DSM 11845 / VT8)(Marinobacter
           hydrocarbonoclasticus (strain DSM 11845))
          Length = 528

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F++ +L +ID ++ E Q L+LAPTRELA Q+ +          N       GG +
Sbjct: 73  GKTAAFALPLLSRIDANVAEPQILVLAPTRELAIQVAEAFTTYASKFRNFHVLPIYGGQD 132

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
               IR L+ G  V+VGTPGR+ D
Sbjct: 133 FSPQIRGLKRGAQVIVGTPGRMLD 156



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 28/81 (34%), Positives = 45/81 (55%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + +K  VLDEADEML  GF D +  +        Q  L SATMP  + +V++ ++++
Sbjct: 163 LKLDGLKALVLDEADEMLRMGFIDDVEAILAKTPDTCQRALFSATMPPQIKKVAQTYLKN 222

Query: 447 PVRILVQKEELTLEGIKQFYM 509
              + ++ E  T+E I QF +
Sbjct: 223 ATEVRIESETRTVERIAQFVL 243


>UniRef50_Q9LKL6 Cluster: DEAD box protein P68; n=5;
           Viridiplantae|Rep: DEAD box protein P68 - Pisum sativum
           (Garden pea)
          Length = 622

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 41/89 (46%), Positives = 53/89 (59%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQ--IDTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNA-KCHAC 162
           GKTA F+I +LQ   +   IR      AL+LAPTRELAQQI+K V A    L + K    
Sbjct: 167 GKTAAFTIPMLQHCLVQPPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLESLKNCIV 226

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +GGTN+ +   +L +GV + V TPGR  D
Sbjct: 227 VGGTNIEKQRSELRAGVEIAVATPGRFID 255



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 26/73 (35%), Positives = 42/73 (57%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           I   VLDEAD ML  GF+ QI ++ + L    Q +L SATMP ++  +++ ++ +PV++ 
Sbjct: 267 ISYVVLDEADRMLDMGFEPQIREIMRSLPEKHQTLLFSATMPVEIEALAKEYLANPVQVK 326

Query: 462 VQKEELTLEGIKQ 500
           V K       + Q
Sbjct: 327 VGKVSSPTTNVSQ 339


>UniRef50_Q49K88 Cluster: DEAD box RNA helicase; n=1; Toxoplasma
           gondii|Rep: DEAD box RNA helicase - Toxoplasma gondii
          Length = 479

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 36/83 (43%), Positives = 47/83 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + ILQ++    +   ALILAPTREL  QI + ++A+G  L       +GG + 
Sbjct: 100 GKTAAFGLPILQRLLQRTQRFYALILAPTRELCLQISQQILAMGGTLGVTVVTLVGGLDH 159

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    HVVVG+PGRV D
Sbjct: 160 NTQAIALAKKPHVVVGSPGRVVD 182



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 2/79 (2%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILS--ADVQVILLSATMPDDVLEVSRCFMRDPV 452
           ++K+ VLDEAD +LS  F   +  + + +   A+ Q +L SATM   V ++ +  ++ PV
Sbjct: 194 SVKVLVLDEADRLLSLDFDAALQVLLEHVGSPAERQTMLFSATMTTKVSKLQKASLKKPV 253

Query: 453 RILVQKEELTLEGIKQFYM 509
           ++ V  +      ++Q ++
Sbjct: 254 KLEVNSKYDVASHLQQHFL 272


>UniRef50_Q18W60 Cluster: DEAD/DEAH box helicase-like; n=2;
           Desulfitobacterium hafniense|Rep: DEAD/DEAH box
           helicase-like - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 425

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 38/91 (41%), Positives = 52/91 (57%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKTA F+I ILQ +          R+ +AL+LAPTRELA QI +   A G +L  +    
Sbjct: 50  GKTAAFAIPILQSLAMGQGLLKGKRQIRALVLAPTRELATQIAESFTAYGVNLPLRTLVI 109

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GG       R+LE G+ ++V TPGR+ D+I
Sbjct: 110 FGGVGQAPQTRKLEKGIDILVATPGRLLDLI 140



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++ FVLDE D+ML  G    +  +   L  + Q +L SATMP ++ +++   ++ PV+I 
Sbjct: 150 VEHFVLDETDQMLDMGMLHDVKRIITYLPRERQNMLFSATMPVEIEKLADTILKGPVKIA 209

Query: 462 VQKEELTLEGIKQ 500
           +  E   L+ I+Q
Sbjct: 210 MTPEFSPLDIIEQ 222


>UniRef50_Q0BUS0 Cluster: ATP-dependent RNA helicase; n=3;
           Rhodospirillales|Rep: ATP-dependent RNA helicase -
           Granulobacter bethesdensis (strain ATCC BAA-1260 /
           CGDNIH1)
          Length = 731

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 31/61 (50%), Positives = 43/61 (70%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           ALI+APTRELA Q+Q+ ++ L     A+  +CIGG + R + + LE G H+VVGTPGR+ 
Sbjct: 120 ALIVAPTRELAMQVQQELLWLYGPAGARVVSCIGGMDARREAQALERGCHIVVGTPGRLC 179

Query: 247 D 249
           D
Sbjct: 180 D 180



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/67 (31%), Positives = 42/67 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L+ + ++  VLDEADEML  GF+D++ ++     A+ + +L SAT+  ++  +++ +
Sbjct: 184 RGRLNLSRLRAVVLDEADEMLDLGFRDELEEILDATPAERRTLLFSATIAREIAALAKRY 243

Query: 438 MRDPVRI 458
             + +RI
Sbjct: 244 QTNALRI 250


>UniRef50_A3I1F5 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Algoriphagus sp. PR1|Rep: DEAD/DEAH box helicase-like
           protein - Algoriphagus sp. PR1
          Length = 399

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 34/84 (40%), Positives = 49/84 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F I I++    +  +  ALI+ PTRELA QI +   +L   +       IGGTN+
Sbjct: 104 GKTGAFLIPIIEHALKNPGQFTALIVTPTRELALQIDQEFKSLSKGMRLHSATFIGGTNI 163

Query: 181 REDIRQLESGVHVVVGTPGRVYDM 252
             D++ L   +HV+VGTPGR+ D+
Sbjct: 164 NTDMKVLSRKLHVIVGTPGRLLDL 187



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/81 (29%), Positives = 42/81 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L  N +K  VLDE D ML  GF + +  +   ++   Q +L SAT+  +   + +  
Sbjct: 190 RKLLKLNQVKTLVLDEFDRMLDMGFVNDVKKLVGGMTQREQTMLFSATLEPNQKNLIQSL 249

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           +++PV + +     T E I+Q
Sbjct: 250 LKNPVEVKINTGVSTNENIEQ 270


>UniRef50_A1VA48 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Deltaproteobacteria|Rep: DEAD/DEAH box helicase
           domain protein - Desulfovibrio vulgaris subsp. vulgaris
           (strain DP4)
          Length = 577

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 34/86 (39%), Positives = 47/86 (54%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F + +L+++D +    QAL+L PTRELA Q++     L +    +  A  GG   
Sbjct: 86  GKTGAFLLPLLERLDPAEASTQALVLVPTRELALQVEHEARTLFEGTGLRVAAVYGGVGY 145

Query: 181 REDIRQLESGVHVVVGTPGRVYDMIL 258
            +    L  G H VVGTPGRV D +L
Sbjct: 146 GKQNDALREGAHFVVGTPGRVLDHLL 171



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL-SADVQVILLSATMPDDVLEVSRC 434
           RR +  + ++    DEAD MLS GF   + ++ + L    +   L SAT P  VL ++  
Sbjct: 172 RRTMQLDRLRALTFDEADRMLSIGFYPDMKEIQRYLPKRRIATCLFSATYPPHVLNLAGE 231

Query: 435 FMRDP 449
           F+R+P
Sbjct: 232 FLREP 236


>UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=195;
           cellular organisms|Rep: ATP-independent RNA helicase
           dbpA - Escherichia coli (strain K12)
          Length = 457

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 36/84 (42%), Positives = 47/84 (55%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + +LQQID S+ + QAL+L PTRELA Q+   +  L   L N K     GG  
Sbjct: 52  GKTAAFGLGLLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGGQP 111

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
                  L+   H++V TPGR+ D
Sbjct: 112 FGMQRDSLQHAPHIIVATPGRLLD 135



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 28/77 (36%), Positives = 40/77 (51%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           + +   V+DEAD ML  GF D I DV +   A  Q +L SAT P+ +  +S    RDP+ 
Sbjct: 145 DALNTLVMDEADRMLDMGFSDAIDDVIRFAPASRQTLLFSATWPEAIAAISGRVQRDPLA 204

Query: 456 ILVQKEELTLEGIKQFY 506
           I +   +      +QFY
Sbjct: 205 IEIDSTDALPPIEQQFY 221


>UniRef50_Q8D6Y8 Cluster: Superfamily II DNA and RNA helicase; n=32;
           Gammaproteobacteria|Rep: Superfamily II DNA and RNA
           helicase - Vibrio vulnificus
          Length = 427

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 37/90 (41%), Positives = 52/90 (57%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA FS+ ++QQ+       S +  +ALI APTRELA+QI   + A   + N    A  
Sbjct: 50  GKTAAFSLPLIQQLLESGKSASRKTARALIFAPTRELAEQIADNIKAYTKYTNLSVAAIF 109

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG  +    R LE+GV ++V TPGR+ + I
Sbjct: 110 GGRKMSSQERMLENGVDILVATPGRLEEHI 139



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           I+  V DEAD +L  GF + +  +   +  + Q+++ SAT    + E+S+  +R P RI 
Sbjct: 149 IEFLVFDEADRILDMGFINAVRKIMLDVETNPQIMMFSATTSSQLNELSKDILRKPKRIA 208

Query: 462 VQKEELT 482
           V++E  T
Sbjct: 209 VERENTT 215


>UniRef50_A5FST0 Cluster: DEAD/DEAH box helicase domain protein;
           n=8; Bacteria|Rep: DEAD/DEAH box helicase domain protein
           - Dehalococcoides sp. BAV1
          Length = 561

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 36/86 (41%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR-ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA +++ I+Q++ ++ R   + L++APTRELA QI     +LG     +  +  GG N
Sbjct: 50  GKTAAYALPIIQKMLSTPRGRVRTLVIAPTRELACQISDSFRSLGQRARIRECSIYGGVN 109

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + + IR+L SGV VVV  PGR+ D I
Sbjct: 110 MDQQIRRLRSGVDVVVACPGRLLDHI 135



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++  ++DEAD M   GF+  I  + K L    Q +L SATMP +V +++     +PV + 
Sbjct: 145 VETLIIDEADRMFDMGFQPDIQSILKCLVQPHQTLLFSATMPPEVRKLTLETQTNPVTVQ 204

Query: 462 V 464
           V
Sbjct: 205 V 205


>UniRef50_A5BYF4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 377

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 28/52 (53%), Positives = 41/52 (78%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT+ F++++ Q +DTS RE QALI +PTRELA Q +KV++A+GD +N + H
Sbjct: 325 GKTSMFALTVYQMVDTSNREVQALISSPTRELASQTEKVILAIGDSVNIQAH 376


>UniRef50_P0C218 Cluster: Probable ATP-dependent RNA helicase DDX20;
           n=9; Euteleostomi|Rep: Probable ATP-dependent RNA
           helicase DDX20 - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 761

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  F+   L  +       Q L+LAPTRE+A QI  VV+A+G  +   +CH  IGG  
Sbjct: 75  GKTCVFTTIALDSLILENATTQVLVLAPTREIAVQIHAVVMAIGSAMEGLECHVFIGGRP 134

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D + L+   H+ +G+PGR+  +I
Sbjct: 135 ISQDKQHLKK-CHIAIGSPGRIKQLI 159



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 32/85 (37%), Positives = 55/85 (64%), Gaps = 4/85 (4%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEML----SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           AL  ++I+LFVLDEAD++L    S  F++QI+ ++  L A+ Q++ LSAT P+ + +   
Sbjct: 163 ALMVSSIRLFVLDEADKLLEDDSSSSFQEQINWIYSSLPANKQMLALSATYPESLAQQLS 222

Query: 432 CFMRDPVRILVQKEELTLEGIKQFY 506
            +MR+P  + +   +  L G+KQ+Y
Sbjct: 223 RYMREPTFVRLNPTDPGLLGLKQYY 247


>UniRef50_Q81LV0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=20; Bacillales|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 436

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 36/91 (39%), Positives = 54/91 (59%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL------GDHLNAKCHAC 162
           GKT  + +  L +I+    E Q +I APTRELAQQI + ++ L         + A+C   
Sbjct: 53  GKTHAYLLPTLNRINPGREEVQLVITAPTRELAQQIYEEIVKLTKFCAEDQMITARC--L 110

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           IGGT+ +  I +L+   H+VVGTPGR+ D++
Sbjct: 111 IGGTDKQRSIEKLKKQPHIVVGTPGRIKDLV 141



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKI---LSADVQVILLSATMPDDVLEVSR 431
           +AL  +     ++DEAD ML  GF   IHDV KI   +  ++Q+++ SAT+P  +    +
Sbjct: 144 QALFVHKANTIIVDEADLMLDMGF---IHDVDKIAARMPKNLQMLVFSATIPQKLKPFLK 200

Query: 432 CFMRDPVRILVQKEELTLEGIKQF 503
            +M +P  I +  +++    I+ +
Sbjct: 201 KYMENPEHIHINPKQVAAGNIEHY 224


>UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           ATP-dependent RNA helicase - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 530

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 33/83 (39%), Positives = 47/83 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  +  + +K  VLDEADEML  GF   I  +      + Q  L SAT+PD+V E+   F
Sbjct: 138 RGTISLSPLKYVVLDEADEMLDMGFLPDIQKILSQCPRERQTFLFSATLPDEVRELGTKF 197

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M+ P  IL++  E T+  I+Q+Y
Sbjct: 198 MKQPEIILIESPERTVPEIEQYY 220



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/83 (38%), Positives = 48/83 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA+F I IL ++       QAL+L PTRELA Q+ + + +L   +  +  A  GG ++
Sbjct: 53  GKTASFGIPILNRVIKG-EGLQALVLCPTRELAVQVTEEISSLSRRMRIQVLAIYGGQSI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
              +R L     ++VGTPGR+ D
Sbjct: 112 ELQLRSLRRNPEIIVGTPGRLMD 134


>UniRef50_Q4P3U9 Cluster: ATP-dependent rRNA helicase RRP3; n=20;
           Eukaryota|Rep: ATP-dependent rRNA helicase RRP3 -
           Ustilago maydis (Smut fungus)
          Length = 551

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 35/83 (42%), Positives = 48/83 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I ILQ +  + +   A +LAPTRELA QI + V ALG  +  +    +GG ++
Sbjct: 153 GKTAAFTIPILQALWDNPKPFFACVLAPTRELAYQISQQVEALGSTIGVRSATIVGGMDM 212

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    HV+V TPGR+ D
Sbjct: 213 MSQSIALSKRPHVIVATPGRLQD 235



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++  V+DEAD +L   F   I  + + +  + + +L SATM   V ++ R  +++PVR+ 
Sbjct: 248 LQYLVMDEADRLLDMDFGPIIDKLLQSIPRERRTMLFSATMTTKVAKLQRASLKNPVRVE 307

Query: 462 VQKEELTLEGIKQFYM 509
           V  +  T+  +KQ YM
Sbjct: 308 VDTKYTTVSTLKQHYM 323


>UniRef50_UPI00015BD198 Cluster: UPI00015BD198 related cluster; n=1;
           unknown|Rep: UPI00015BD198 UniRef100 entry - unknown
          Length = 364

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/86 (34%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F+I I++++     + +AL+L PTRELA Q+++ +  L  +     +   GGT+V
Sbjct: 49  GKTGAFAIPIVEKLQKGKPDVKALVLTPTRELAIQVKEQIYMLTKYKRLSSYVFYGGTSV 108

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMI 255
           ++++  L++  V +++GTPGR+ D+I
Sbjct: 109 KQNLDILQNKNVDILIGTPGRIKDLI 134



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+AL+ + ++  VLDE D+ML  GF + I  +   L  +    + SAT+P  +  +++ F
Sbjct: 136 RKALNLSKVEYLVLDEFDQMLDMGFIEDIEYIISFLPKERTTYMFSATVPSRIELLAKRF 195

Query: 438 MRDPVR-ILVQKEEL 479
           ++   + + VQ  EL
Sbjct: 196 LKSDFKFVKVQSVEL 210


>UniRef50_Q81JK1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=30; Firmicutes|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 481

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 33/85 (38%), Positives = 49/85 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA+F I + + ++    + QAL+L PTRELA Q+++ +  +G     K  A  G +  
Sbjct: 53  GKTASFGIPLCEMVEWEENKPQALVLTPTRELAVQVKEDITNIGRFKRIKAAAIYGKSPF 112

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
                +L+   H+VVGTPGRV D I
Sbjct: 113 ARQKLELKQKTHIVVGTPGRVLDHI 137



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 29/77 (37%), Positives = 44/77 (57%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L    +K  V+DEADEML+ GF DQ+  +   L      +L SAT+P+DV  +SR +M  
Sbjct: 142 LSLERLKYLVIDEADEMLNMGFIDQVEAIIDELPTKRMTMLFSATLPEDVERLSRTYMNA 201

Query: 447 PVRILVQKEELTLEGIK 497
           P  I ++   +T + I+
Sbjct: 202 PTHIEIKAAGITTDKIE 218


>UniRef50_Q1Q4V2 Cluster: Similar to ATP-independent RNA helicase
           DbpA; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Similar to ATP-independent RNA helicase DbpA -
           Candidatus Kuenenia stuttgartiensis
          Length = 407

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 55/208 (26%), Positives = 99/208 (47%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA  +I ++Q++D S+   Q L++ PTREL  Q  + +  +    +   +A  GG + 
Sbjct: 50  GKTAACAIPLIQKVDPSLDAIQGLVIVPTRELCMQYVEEIRKIAAKTDVIPYAVYGGFDR 109

Query: 181 REDIRQLESGVHVVVGTPGRVYDMIL--VVRFMPTPSNFL-FLMKLMKC--CPEVSRTRS 345
              I +++  VH++V TPGR+ D++   ++ F       L    +L+K     ++    S
Sbjct: 110 AAQIARVKQTVHILVATPGRLIDLLYEGILSFARIKCVILDEADELLKVGFLEDIEFILS 169

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            +  +   L+F    + +P  +      D L E  Y  L  ++S P  + + F+ +  ++
Sbjct: 170 CIRHKHQTLLFS---ATMPDDIKKLTQ-DCLHEPQYISLVTKRSAPESIEHYFSYVNPKQ 225

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            K E L        + QA+IFCN R  V
Sbjct: 226 -KHEELVKYLKGEEVNQALIFCNARHMV 252



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 25/77 (32%), Positives = 44/77 (57%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           IK  +LDEADE+L  GF + I  +   +    Q +L SATMPDD+ ++++  + +P  I 
Sbjct: 144 IKCVILDEADELLKVGFLEDIEFILSCIRHKHQTLLFSATMPDDIKKLTQDCLHEPQYIS 203

Query: 462 VQKEELTLEGIKQFYMH 512
           +  +    E I+ ++ +
Sbjct: 204 LVTKRSAPESIEHYFSY 220


>UniRef50_A5CVQ6 Cluster: ATP-dependent RNA helicase DeaD; n=2;
           sulfur-oxidizing symbionts|Rep: ATP-dependent RNA
           helicase DeaD - Vesicomyosocius okutanii subsp.
           Calyptogena okutanii (strain HA)
          Length = 608

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 37/86 (43%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKTA F + +L +I+ +I   Q LILAPTRELA Q+ + V      +         GG +
Sbjct: 61  GKTAAFVLPLLDKINLNINAPQLLILAPTRELAIQVSEAVQTYARGMKGFHVLPIYGGQS 120

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
               +R L+ GVH +VGTPGRV D I
Sbjct: 121 YDIQLRPLKRGVHAIVGTPGRVMDHI 146



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 30/83 (36%), Positives = 48/83 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  + +K FVLDEADEML  GF D I  + + +    Q+ L SATMP+ + ++++ F
Sbjct: 148 KKTLKLDNLKSFVLDEADEMLKMGFIDDIKWIMQRIPEQRQIALFSATMPNVIKKIAKQF 207

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           +  P  I ++ +  T   I Q Y
Sbjct: 208 LNQPKIIKIKTKTETATTITQKY 230


>UniRef50_A3J7I3 Cluster: ATP-independent RNA helicase; n=5;
           Bacteroidetes|Rep: ATP-independent RNA helicase -
           Flavobacteria bacterium BAL38
          Length = 463

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 31/85 (36%), Positives = 50/85 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F + I Q ++  ++  Q LIL P+REL  QI++V   +G H   K + C GG ++
Sbjct: 45  GKTLAFLLPIFQMMEEEVKGVQCLILVPSRELGLQIEQVWKKMGTHF--KVNTCYGGHSI 102

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
             + + L +   +++GTPGR+ D I
Sbjct: 103 ETEFKNLSNPPALLIGTPGRIADHI 127


>UniRef50_Q8L4E9 Cluster: DEAD-box ATP-dependent RNA helicase 36;
           n=7; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           36 - Oryza sativa subsp. japonica (Rice)
          Length = 501

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 37/85 (43%), Positives = 48/85 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ IL ++        AL LAPTRELA Q+ +   ALG  L  +C A IGG + 
Sbjct: 126 GKTAAFALPILHRLGEDPYGVAALALAPTRELAAQLAEQFRALGAPLGLRCLAAIGGFDS 185

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
               + L    HVVV TPGR+  +I
Sbjct: 186 LGQAKGLARRPHVVVATPGRIATLI 210



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           K  VLDEAD +L   F++ +  +F  L    Q  L SAT+ D++  +      +      
Sbjct: 224 KFLVLDEADRVLDINFEEDLRVIFGSLPKKRQTFLFSATISDNLRSLLELSGNNSYFFEA 283

Query: 465 QKEELTLEGIKQFYMH 512
            +   T++ +KQ Y+H
Sbjct: 284 YEGFKTVDTLKQLYIH 299


>UniRef50_A5E058 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Lodderomyces elongisporus NRRL
           YB-4239|Rep: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5 - Lodderomyces elongisporus (Yeast)
           (Saccharomyces elongisporus)
          Length = 994

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/62 (43%), Positives = 43/62 (69%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L+PTRELA QI+K ++     ++ K   C GG+N+   I +L+ GV+V+V TPGR+ D
Sbjct: 465 LVLSPTRELALQIEKEILKFSSTMDLKVCCCYGGSNIENQISELKRGVNVIVATPGRLID 524

Query: 250 MI 255
           ++
Sbjct: 525 LL 526



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/69 (34%), Positives = 38/69 (55%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD M   GF+ QI  +F  +  D Q +L SAT P  + ++++  + +P+ I+V   
Sbjct: 543 VLDEADRMFDMGFEPQIQKIFTQIRPDKQTVLFSATFPRKLEQLAKKVLHNPIEIIVGGV 602

Query: 474 ELTLEGIKQ 500
            +    I Q
Sbjct: 603 SVVASEISQ 611


>UniRef50_Q92GV2 Cluster: ATP-dependent RNA helicase RhlE; n=10;
           Rickettsia|Rep: ATP-dependent RNA helicase RhlE -
           Rickettsia conorii
          Length = 414

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 34/85 (40%), Positives = 49/85 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R +L  + I + VLDE D ML  G K+Q+ ++ K L    QV++ SATMP  ++ VS+ +
Sbjct: 136 RGSLKIDRIGITVLDEMDRMLDMGMKEQLEEINKFLPEKRQVLMFSATMPKHIIAVSQKY 195

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           + +PVRI V         IKQ  MH
Sbjct: 196 LNNPVRITVGATNKAAAEIKQESMH 220



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR-ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKT  +   +L  ID+ I+ +  ALIL PTRELA QI   +  +           IGG  
Sbjct: 52  GKTLAY---LLPLIDSFIKNKTTALILVPTRELATQIHSTLNKVTTSYKINSAVLIGGEP 108

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           + +   QL+    V++GTPGR+ D
Sbjct: 109 MPKQFIQLKKNPKVIIGTPGRIID 132


>UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 793

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 58/213 (27%), Positives = 100/213 (46%), Gaps = 8/213 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS---IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA+F++ +LQ++  S    R  ++LIL PTRELA Q+ +     G +L       IGG
Sbjct: 340 GKTASFTLPMLQKLAGSRARARMPRSLILEPTRELALQVAENFKLYGKYLRLTHALLIGG 399

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSR 336
            ++ E    L  GV V++ TPGR+ D+      + T ++ L +     M  M   P++ +
Sbjct: 400 ESMAEQRDVLNRGVDVLIATPGRLLDLFGRGGLLLTQTSTLVIDEADRMLDMGFIPDIEK 459

Query: 337 TRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIE 516
             +++ +    L F +  ++ P +    +  DA           R+S     +     I 
Sbjct: 460 IVALLPAHRQTLFFSA--TMAPEIR---RLADAFLRHPVEITVSRQSSVATTIEEALVIV 514

Query: 517 LEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
            E+ K  TL  L    ++  A++FCN +R V +
Sbjct: 515 PEDEKRRTLKKLLRRENVQSAIVFCNRKRDVDM 547



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           V+DEAD ML  GF   I  +  +L A  Q +  SATM  ++  ++  F+R PV I V ++
Sbjct: 441 VIDEADRMLDMGFIPDIEKIVALLPAHRQTLFFSATMAPEIRRLADAFLRHPVEITVSRQ 500

Query: 474 ELTLEGIKQ 500
                 I++
Sbjct: 501 SSVATTIEE 509


>UniRef50_Q39MK8 Cluster: DEAD/DEAH box helicase; n=10;
           Proteobacteria|Rep: DEAD/DEAH box helicase -
           Burkholderia sp. (strain 383) (Burkholderia cepacia
           (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 481

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 5/89 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F++ +LQ++       S    + L+L PTRELA+Q+ +  IA G  L+ +  A  
Sbjct: 50  GKTAGFALPLLQRLVQHGPAVSSNRARVLVLVPTRELAEQVLQSFIAYGKGLDLRFLAAY 109

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDM 252
           GG ++   + +L  GV V+V TPGR+ D+
Sbjct: 110 GGVSINPQMMKLRKGVDVLVATPGRLLDL 138



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 31/82 (37%), Positives = 45/82 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + A+  + ++  VLDEAD ML  GF  +++ VF  L A  Q +L SAT  DD+  ++   
Sbjct: 141 QNAVQFDQVQTLVLDEADRMLDLGFARELNAVFAALPAQRQTLLFSATFSDDIRAMAATI 200

Query: 438 MRDPVRILVQKEELTLEGIKQF 503
           +R PV I V     T   IKQ+
Sbjct: 201 LRGPVNISVSPPNATASKIKQW 222


>UniRef50_Q11TW3 Cluster: Possible ATP-dependent RNA helicase; n=5;
           Bacteria|Rep: Possible ATP-dependent RNA helicase -
           Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
          Length = 388

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 30/80 (37%), Positives = 55/80 (68%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           +A++ + +++ VLDEAD+ML+ GFK+++ ++FK+L    Q +L SAT+  DV  ++   +
Sbjct: 150 KAVYLSDVEVLVLDEADKMLNLGFKEEMANIFKLLPQKRQNLLFSATLGKDVDTITEFLL 209

Query: 441 RDPVRILVQKEELTLEGIKQ 500
            DPV+I +  EE  ++ I+Q
Sbjct: 210 HDPVKIEIIAEEQNIDLIQQ 229



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI----RECQALILAPTRELAQQIQKVVIALGDHL--NAKCHAC 162
           GKTA+F + ILQ + T      R   AL+L PTRELA Q+ +V  A  + L    K  A 
Sbjct: 58  GKTASFVLPILQMLQTKPLGKNRHINALVLVPTRELAVQVGQVFQAFSNALPNKIKSLAV 117

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GG ++   + QL+ GV +++ TPGR+ D++
Sbjct: 118 YGGVSINPQMIQLQ-GVEILIATPGRLLDLV 147


>UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Janthinobacterium sp. (strain Marseille) (Minibacterium
           massiliensis)
          Length = 778

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA+F++ IL +ID      QAL+LAPTRELA Q+ +       ++         GG +
Sbjct: 56  GKTASFALPILARIDIKQTTPQALVLAPTRELAIQVAEAFQRYATYIPGFHVLPIYGGQS 115

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
               +  L  GVHVVVGTPGRV D
Sbjct: 116 YGAQLSALRRGVHVVVGTPGRVID 139



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 31/81 (38%), Positives = 44/81 (54%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +L  + IK  VLDEADEML  GF D +  + +      Q  L SATMP  +  ++  ++R
Sbjct: 145 SLDLSRIKTMVLDEADEMLRMGFIDDVETILQKTPESRQTALFSATMPSAIKRIATTYLR 204

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  I V  +  T + I+Q Y
Sbjct: 205 DPDLITVAAKTGTADNIRQRY 225


>UniRef50_A5UZK3 Cluster: DEAD/DEAH box helicase domain protein;
           n=12; Bacteria|Rep: DEAD/DEAH box helicase domain
           protein - Roseiflexus sp. RS-1
          Length = 467

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR-ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA F + ILQ++    R   +A+I+ PTRELA+QIQ V+ ALG +   +     GG  
Sbjct: 50  GKTAAFVLPILQRLMRGPRGRVRAMIVTPTRELAEQIQGVIEALGKYTGLRSVTLYGGVG 109

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
            +  I++L  GV + V  PGR+ D
Sbjct: 110 YQGQIQRLRRGVEIAVVCPGRLLD 133



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/69 (33%), Positives = 38/69 (55%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L    + + +LDEAD+M   GF   +  + ++  A  Q +L SATMPD +  ++R  
Sbjct: 137 RGTLTLEHLDMLILDEADQMFDMGFLPDVRRILRLAPAQRQTMLFSATMPDAIRALAREA 196

Query: 438 MRDPVRILV 464
           +R+P  I +
Sbjct: 197 LREPQTIQI 205


>UniRef50_A3ZXX1 Cluster: ATP-dependent RNA helicase; n=2;
           Planctomycetaceae|Rep: ATP-dependent RNA helicase -
           Blastopirellula marina DSM 3645
          Length = 447

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 51/90 (56%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQID---TSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F++ IL Q+D   +    C  Q L+L+PTRELA QI +     G ++  +     
Sbjct: 45  GKTAAFALPILNQLDLDRSRADACAPQVLVLSPTRELAVQIAQSFNVYGRNVKFRLTTIF 104

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG      +R L+ GVHV + TPGR+ D++
Sbjct: 105 GGVGQNPQVRALKRGVHVAIATPGRLLDLM 134



 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 30/76 (39%), Positives = 41/76 (53%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           K FVLDEAD ML  GF   +  +   L    Q I  +ATMP  V +++   + +PVRI V
Sbjct: 145 KTFVLDEADRMLDMGFMPALKTIVSKLPKQRQTIFFTATMPPKVAQLASGLLNNPVRIEV 204

Query: 465 QKEELTLEGIKQFYMH 512
             E  T E ++Q  M+
Sbjct: 205 APESTTAERVEQRLMY 220


>UniRef50_A3WD13 Cluster: DNA and RNA helicase; n=2;
           Alphaproteobacteria|Rep: DNA and RNA helicase -
           Erythrobacter sp. NAP1
          Length = 484

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 51/90 (56%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATF---SISILQQIDTSI--RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F   SI  L++ D  I  + C+ L+LAPTREL  QI       G     K  + +
Sbjct: 51  GKTAAFMLPSIDRLREADNRIPFKSCRMLVLAPTRELVSQIAASAKDYGALAGLKVQSIV 110

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT+V +D  +L  G  +++ TPGR+ D+I
Sbjct: 111 GGTSVNKDRNKLHRGTDILIATPGRLLDLI 140



 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 26/82 (31%), Positives = 48/82 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A +  ++++ VLDEAD+ML  GF   +  + +++  + Q +  SATMP  + E+   +
Sbjct: 142 QKAFNLGSVEVLVLDEADQMLDLGFVHALRRISQLVPKERQTLFFSATMPKAIKELVSGY 201

Query: 438 MRDPVRILVQKEELTLEGIKQF 503
             +PV++ V  E  T E I Q+
Sbjct: 202 CNNPVQVSVTPESTTAERIDQY 223


>UniRef50_UPI0000498D8E Cluster: ATP-dependent RNA helicase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: ATP-dependent RNA
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 450

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 35/100 (35%), Positives = 52/100 (52%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ I+  + T      AL+L PTRELA QI     A G  +N +    +GG +V
Sbjct: 79  GKTAAFALPIIHHLSTDPYTGFALVLTPTRELASQIADQFKAFGACINIRVVQVVGGVDV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL 300
              +  L    HV++ TPG++  +I  + F    + FL L
Sbjct: 139 IRILHHLSGSPHVIIATPGKLVSLIDHLPFSFDSAKFLIL 178


>UniRef50_Q64VR8 Cluster: ATP-dependent RNA helicase DeaD; n=14;
           Bacteria|Rep: ATP-dependent RNA helicase DeaD -
           Bacteroides fragilis
          Length = 427

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 38/87 (43%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA FSI ILQ++  T  R+  +AL+L PTRELA QI +   A G +   K     GG 
Sbjct: 50  GKTAAFSIPILQKLYKTDHRKGIKALVLTPTRELAIQIGESFEAYGRYTGLKHAVIFGGV 109

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
             +     L SG+ ++V TPGR+ D+I
Sbjct: 110 GQKPQTDALRSGIQILVATPGRLLDLI 136



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/75 (34%), Positives = 41/75 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           +++  FVLDEAD ML  GF   I  + K+L A  Q +  SATMP ++  ++   +  P +
Sbjct: 144 SSLDFFVLDEADRMLDMGFIHDIKRILKLLPARRQTLFFSATMPPEIETLANSMLTKPEK 203

Query: 456 ILVQKEELTLEGIKQ 500
           + V     T++ I Q
Sbjct: 204 VEVTPASSTVDIISQ 218


>UniRef50_Q5QY63 Cluster: ATP-dependent RNA helicase; n=3;
           Alteromonadales|Rep: ATP-dependent RNA helicase -
           Idiomarina loihiensis
          Length = 594

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGTN 177
           GKTA F +  L +ID S+++ Q L++ PTRELA Q+ + +      +     A + GG  
Sbjct: 57  GKTAAFGLPALAKIDASVKQTQVLVVTPTRELAIQVAEALEGFAAKMRGVGVATVYGGAP 116

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
               ++ L+ G  +VVGTPGR+ D++
Sbjct: 117 FGPQVKALKQGTAIVVGTPGRLIDLL 142



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 29/81 (35%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +  L  + +K+ VLDEADEML+ GF + I  + K +    Q  L SATMP+ + ++++ F
Sbjct: 144 KNVLQLDGLKVGVLDEADEMLNMGFIEDIETILKAVPNTAQRALFSATMPNAIRKLAKTF 203

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           ++DP+ I ++        IKQ
Sbjct: 204 LKDPLNIQIEAIAREKATIKQ 224


>UniRef50_Q2BMZ1 Cluster: ATP-dependent RNA helicase; n=1;
           Neptuniibacter caesariensis|Rep: ATP-dependent RNA
           helicase - Neptuniibacter caesariensis
          Length = 417

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 34/76 (44%), Positives = 46/76 (60%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + AL    +K  VLDEAD ML  GF D++ D+      +VQ +L SAT PD V E++   
Sbjct: 142 KNALDLRGLKALVLDEADRMLDLGFADELDDILDQTPGNVQTLLFSATFPDKVKELTEEL 201

Query: 438 MRDPVRILVQKEELTL 485
           +R+PV I V K+E TL
Sbjct: 202 LRNPVEISV-KQEATL 216



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT----SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH--AC 162
           GKTA F + +L+++ +          AL+L PTRELA Q+ + V    ++   K    A 
Sbjct: 50  GKTAGFVLPLLEKLHSIPAPGNNLTHALVLVPTRELAVQVSQSVDRYSENCPRKIRSVAI 109

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GG  +   ++ L  G  +VV TPGR+ D++
Sbjct: 110 YGGAAINPQMQSLSKGCDIVVATPGRLLDLM 140


>UniRef50_Q0HKH0 Cluster: DEAD/DEAH box helicase domain protein;
           n=37; Gammaproteobacteria|Rep: DEAD/DEAH box helicase
           domain protein - Shewanella sp. (strain MR-4)
          Length = 427

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 34/93 (36%), Positives = 54/93 (58%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNA--KCH 156
           GKTA F++ +LQ++      + S  + + L+L PTRELAQQ+    ++   H N   K  
Sbjct: 58  GKTAAFAVPLLQRLFEAKTAEKSAGQVRCLVLVPTRELAQQVADSFLSYASHFNGQLKIV 117

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           A  GG +V   ++ L +G  V+V TPGR+ D++
Sbjct: 118 AAFGGVSVNLQMQSLRAGADVLVATPGRLLDLL 150



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           AL  N +   VLDEAD MLS GF D+++ V + L A  Q +L SAT P++V  ++   + 
Sbjct: 154 ALKLNRVLALVLDEADRMLSLGFTDELNQVLEALPAKKQTLLYSATFPEEVRALTAKLLH 213

Query: 444 DPVRILVQKE-ELTLE 488
            P+   +Q E E T+E
Sbjct: 214 QPLEYHLQSEQESTIE 229


>UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=4;
           Eukaryota|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 699

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/63 (49%), Positives = 38/63 (60%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G  +NA      GG      IR LE G  +V+ TPGR+ 
Sbjct: 198 ALVLAPTRELAQQIQQVATDFGQRINANNTCVFGGAPKGPQIRDLERGAEIVIATPGRLI 257

Query: 247 DMI 255
           D +
Sbjct: 258 DFL 260



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           VLDEAD ML  GF+ QI  +   +  D QV++ SAT P +V  ++  F+ D ++I
Sbjct: 274 VLDEADRMLDMGFEPQIRKIMGQIRPDRQVLMWSATWPKEVRNLAEEFLNDYIQI 328


>UniRef50_A6N5Z1 Cluster: Helicase; n=7; Plasmodium|Rep: Helicase -
           Plasmodium falciparum
          Length = 576

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 57/205 (27%), Positives = 96/205 (46%), Gaps = 4/205 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT TF I++L +I+ ++   QA+ + PTREL+QQ   VV     +LN K    +    +
Sbjct: 210 GKTLTFVIAMLCKINRTLSSLQAVCICPTRELSQQNYDVVCNFTKYLNVKVFLAV---PL 266

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            E   +   G  + VGTPG+  D  L  +F+ T +  LF++       ++    S     
Sbjct: 267 CERYNK-SGGYQIYVGTPGKTLD-FLKRKFIDTKNIKLFVLDEADDLIDIKNNMSSQVET 324

Query: 361 FCQLMFKSYYSLLPCLM---MYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCI-ELEEW 528
             + + +S   LL          K+ D           R++ L  K +  +  I E +E 
Sbjct: 325 IKRFLPRSCQILLFSATYNDSVRKFADQFAPKATKISVRQEDLTLKCVKQYYLITENDEQ 384

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRR 603
           K   L +LY +++I+Q VIF N+++
Sbjct: 385 KYYYLSELYCSMTISQCVIFVNSKK 409


>UniRef50_Q0W8H7 Cluster: ATP-dependent RNA helicase; n=1;
           uncultured methanogenic archaeon RC-I|Rep: ATP-dependent
           RNA helicase - Uncultured methanogenic archaeon RC-I
          Length = 497

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/83 (37%), Positives = 49/83 (59%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I +++ I  + +  Q L++ PTRELA Q+ + +  +G     +  A  GG + 
Sbjct: 51  GKTAAFGIPMVEAIRPTSKGVQGLVVVPTRELAVQVAEELTRIGKVRGIRSVAIYGGQDF 110

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
           R  ++ LE   H+VVGTPGR+ +
Sbjct: 111 RSQVKALEELPHIVVGTPGRLLE 133



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 29/84 (34%), Positives = 49/84 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  +  + I++ VLDEAD+ML  GF D+   + K L    Q +L SAT+   V  ++R +
Sbjct: 137 REYVRTSDIRIAVLDEADKMLDMGFIDEAEKILKKLPERRQTLLFSATLSPPVQMLARKY 196

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           ++DP  I  ++E +T+    Q+Y+
Sbjct: 197 LKDPELIEFEEEGITVPTTVQYYI 220


>UniRef50_P54475 Cluster: Probable ATP-dependent RNA helicase yqfR;
           n=12; Bacillaceae|Rep: Probable ATP-dependent RNA
           helicase yqfR - Bacillus subtilis
          Length = 438

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL-----GDHLNAKCHACI 165
           GKT  + + +L +ID +    Q +I APTRELA QI +  + +     G  + +KC   I
Sbjct: 53  GKTHAYLLPLLNKIDPAKDVVQVVITAPTRELANQIYQEALKITQGEEGSQIRSKCF--I 110

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT+ ++ I +L+   H+VVGTPGR+ D+I
Sbjct: 111 GGTDKQKSIDKLKIQPHLVVGTPGRIADLI 140



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           +AL  +  +  V+DEAD ML  GF   +  +   +  D+Q+++ SAT+P+ +    + +M
Sbjct: 143 QALSVHKAESLVIDEADLMLDMGFLADVDYIGSRMPEDLQMLVFSATIPEKLKPFLKKYM 202

Query: 441 RDPVRILVQKEELTLEGIK 497
            +P    V+ +++T   I+
Sbjct: 203 ENPKYAHVEPKQVTAAKIE 221


>UniRef50_Q13838 Cluster: Spliceosome RNA helicase BAT1; n=55;
           Eukaryota|Rep: Spliceosome RNA helicase BAT1 - Homo
           sapiens (Human)
          Length = 428

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>UniRef50_P44586 Cluster: Cold-shock DEAD box protein A homolog;
           n=20; Pasteurellaceae|Rep: Cold-shock DEAD box protein A
           homolog - Haemophilus influenzae
          Length = 613

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L+ + ++  VLDEADEML  GF D +  V   L  + Q  L SATMP+ +  +++ F
Sbjct: 141 RGTLNLSELRFIVLDEADEMLRMGFIDDVETVMAELPENHQTALFSATMPEPIRRITKRF 200

Query: 438 MRDPVRILVQKEELTLEGIKQ--FYMH*IRRMEA 533
           M DP  + ++        I Q  +Y+H +R+ EA
Sbjct: 201 MNDPQEVKIKVNNENAPDIDQSCWYVHGVRKNEA 234



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 35/86 (40%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F++ +L QID S +  Q L++APTRELA Q+         +    +     GG  
Sbjct: 54  GKTAAFALPLLAQIDPSEKHPQMLVMAPTRELAIQVADACELFVKYAQGTRIVTLYGGQR 113

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
               +R L+ G  VVVGTPGR+ D I
Sbjct: 114 YDIQLRALKQGAQVVVGTPGRILDHI 139


>UniRef50_Q88XN5 Cluster: ATP-dependent RNA helicase; n=2;
           Lactobacillus|Rep: ATP-dependent RNA helicase -
           Lactobacillus plantarum
          Length = 444

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 35/85 (41%), Positives = 51/85 (60%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F+  +L+ +       QALILAP++ELA Q   VV   G  ++AK  A  GG NV
Sbjct: 43  GKTLAFTWPMLEALRVG-EGTQALILAPSQELAMQTTNVVREWGQLIDAKVLAITGGANV 101

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           +  + +L+    V+VGTPGR+ ++I
Sbjct: 102 KRQMEKLKKHPEVIVGTPGRITNLI 126


>UniRef50_Q6D2K3 Cluster: ATP-independent RNA helicase; n=6;
           Proteobacteria|Rep: ATP-independent RNA helicase -
           Erwinia carotovora subsp. atroseptica (Pectobacterium
           atrosepticum)
          Length = 460

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 36/84 (42%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F I +L +I  S    QAL+L PTRELA Q+ K +  L     N K     GG  
Sbjct: 53  GKTAAFGIGLLDRIVVSDFTTQALVLCPTRELADQVSKELRRLARFAQNIKILTLCGGQP 112

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           + + +  L    H+VVGTPGR+ D
Sbjct: 113 MGQQLDSLVHAPHIVVGTPGRIQD 136



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +++L  +++K+ VLDEAD ML  GF D I DV     +D Q +L SAT P ++ ++S   
Sbjct: 140 KQSLALDSLKVLVLDEADRMLDMGFTDAIDDVISYTPSDRQTLLFSATYPQEIEQISARV 199

Query: 438 MRDPVR--ILVQKEELTLEGIKQFY 506
            R P R  I    EE  +E  ++FY
Sbjct: 200 QRQPQRFEIADDVEESAIE--QRFY 222


>UniRef50_Q08Q14 Cluster: HeliCase, c-terminal:dead/deah box
           helicase, n-terminal; n=3; Bacteria|Rep: HeliCase,
           c-terminal:dead/deah box helicase, n-terminal -
           Stigmatella aurantiaca DW4/3-1
          Length = 608

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 35/86 (40%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE---CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA FS+ +LQ+I           AL+L PTRELA Q+ + +   G  L        GG
Sbjct: 85  GKTAAFSLPLLQRITPGAHAPFTASALVLVPTRELAMQVAEAIHRYGQKLGISVVPLYGG 144

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
             + + +R L+ GV VVV TPGR  D
Sbjct: 145 QVISQQLRVLKRGVDVVVATPGRALD 170



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    +++ VLDEADEML  GF + +  +        Q  L SAT+P  +  ++   
Sbjct: 174 RKTLKLEQVRVVVLDEADEMLDMGFAEDLEAILSSTPEKRQTALFSATLPPRIASIAERH 233

Query: 438 MRDPVRILVQKEEL 479
           +R+PVR+ + +E++
Sbjct: 234 LREPVRVRIAREKV 247


>UniRef50_A7JLA3 Cluster: ATP-dependent RNA helicase; n=20;
           Francisella|Rep: ATP-dependent RNA helicase -
           Francisella tularensis subsp. novicida GA99-3548
          Length = 569

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GG 171
           GKTA F++ ++  +D + R+   Q L+LAPTRELA Q+ +   A   ++     ACI GG
Sbjct: 56  GKTAAFALPLINNMDLASRDRAPQVLVLAPTRELAIQVAEQFEAFAKNVPNLDVACIYGG 115

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYDMI 255
                 IR L+ GV VVVGT GRV D I
Sbjct: 116 QEYGSQIRALKQGVKVVVGTTGRVMDHI 143



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 28/81 (34%), Positives = 48/81 (59%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + ++  VLDEADEML  GF D +  V   +S + Q +L SAT+P D+ ++   ++R+
Sbjct: 148 LQLDNLRALVLDEADEMLRMGFIDDVKFVLSHVSDECQRLLFSATIPTDIADIIEEYLRN 207

Query: 447 PVRILVQKEELTLEGIKQFYM 509
           P +I V+ +  T   + Q ++
Sbjct: 208 PCKIQVKAKTKTANTVTQKFI 228


>UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Acidiphilium cryptum JF-5|Rep: DEAD/DEAH box
           helicase domain protein - Acidiphilium cryptum (strain
           JF-5)
          Length = 525

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 37/90 (41%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI-----RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + IL +I  +      R C+AL+LAPTRELA QI       G          I
Sbjct: 106 GKTAAFVLPILHRIAANRARPAPRACRALVLAPTRELATQIADAARTYGKFTRPSVAVVI 165

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG       R++ESGV ++V TPGR+ D +
Sbjct: 166 GGAKPGPQARRMESGVDLLVATPGRLLDHV 195



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           +  + ++  VLDEAD+ML  GF   I  +   L    Q ++ SATMP  +  ++  F+RD
Sbjct: 200 IRLDAVETVVLDEADQMLDLGFIPAIRQIMAKLPRQRQAVMFSATMPKPIRALAGEFLRD 259

Query: 447 PVRILVQKEELTLEGIKQ 500
           P  + V  E   ++ I Q
Sbjct: 260 PREVAVSVESKPVDRIDQ 277


>UniRef50_A4LYS0 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Desulfuromonadales|Rep: DEAD/DEAH box helicase
           domain protein - Geobacter bemidjiensis Bem
          Length = 482

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 37/90 (41%), Positives = 52/90 (57%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR-----ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTATF ISI  ++ +  +       +ALILAPTREL  QI+K   ALG +      A  
Sbjct: 50  GKTATFLISIFTKLLSQAKTGGEHHPRALILAPTRELVVQIEKDAQALGKYTGFNIQAIY 109

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG +  +    L++G  +V+GTPGR+ D +
Sbjct: 110 GGVDYMKQRDALKAGADIVIGTPGRLIDYL 139



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +3

Query: 249 YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSA--DVQVILLSATMPDDVLE 422
           Y  ++      ++  V+DEAD M   GF   +  + + L      Q +L SAT+   V+E
Sbjct: 138 YLKQKVYSVKDVEALVIDEADRMFDMGFIADLRFILRRLPPYDKRQNLLFSATLNTRVME 197

Query: 423 VSRCFMRDPVRILVQKEELTLEGIKQFYMH*IRR 524
           ++  FM  P ++ V  E++T E ++Q   H  R+
Sbjct: 198 LAYEFMNMPEKVSVTPEQMTAERVEQVLYHVSRK 231


>UniRef50_A0RP33 Cluster: Putative ATP-dependent RNA helicase RhlE;
           n=1; Campylobacter fetus subsp. fetus 82-40|Rep:
           Putative ATP-dependent RNA helicase RhlE - Campylobacter
           fetus subsp. fetus (strain 82-40)
          Length = 624

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 55/211 (26%), Positives = 100/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR-----ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F++ IL+++ +  R     + + L+L PTRELA Q+ + + +    L  K     
Sbjct: 50  GKTAAFALPILEKLSSKERNKKRPQTRVLVLVPTRELANQVTQNIKSYAKKLPFKTLPVF 109

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEV 330
           GG +    I+ L+SG+ +VV TPGR+ D+ L         + L       M  M    ++
Sbjct: 110 GGVSSYPQIQALKSGIDIVVATPGRLLDLALQNALSLEHIDTLVFDEADRMFDMGFIHDI 169

Query: 331 SRTRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTC 510
            +   M+  +   L+F + Y   P  +M       L + L   +  + S    ++     
Sbjct: 170 KQIVKMLPEKRQNLLFSATY---PSEVMS-LCNSMLKDPLRIQIEEQNSTALNIIQRVIL 225

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
           ++ ++ K+E L +++   SI QA++F  T+R
Sbjct: 226 VDRDK-KMELLNEVFGVESIDQALVFTRTKR 255



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 28/81 (34%), Positives = 42/81 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + AL    I   V DEAD M   GF   I  + K+L    Q +L SAT P +V+ +    
Sbjct: 141 QNALSLEHIDTLVFDEADRMFDMGFIHDIKQIVKMLPEKRQNLLFSATYPSEVMSLCNSM 200

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           ++DP+RI ++++  T   I Q
Sbjct: 201 LKDPLRIQIEEQNSTALNIIQ 221


>UniRef50_Q8MZI3 Cluster: GH10652p; n=2; Drosophila
           melanogaster|Rep: GH10652p - Drosophila melanogaster
           (Fruit fly)
          Length = 818

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 30/63 (47%), Positives = 40/63 (63%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V I  G + + +     GG    +  R LE GV +V+ TPGR+ 
Sbjct: 233 ALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLI 292

Query: 247 DMI 255
           D +
Sbjct: 293 DFL 295



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           VLDEAD ML  GF+ QI  + + +  D QV++ SAT P +V +++  F+ + +++
Sbjct: 309 VLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQV 363


>UniRef50_P42305 Cluster: ATP-dependent RNA helicase dbpA; n=9;
           Firmicutes|Rep: ATP-dependent RNA helicase dbpA -
           Bacillus subtilis
          Length = 479

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 34/85 (40%), Positives = 50/85 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA+F I + +  +    + QALIL PTRELA Q+++ +  +G     K  A  G ++ 
Sbjct: 51  GKTASFGIPLCELANWDENKPQALILTPTRELAVQVKEDITNIGRFKRIKATAVFGKSSF 110

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            +   +L+   H+VVGTPGRV D I
Sbjct: 111 DKQKAELKQKSHIVVGTPGRVLDHI 135



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 29/77 (37%), Positives = 47/77 (61%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + +   V+DEADEML+ GF +Q+  + K L  +   +L SAT+P D+ ++SR +M++
Sbjct: 140 LPLDRLSYLVIDEADEMLNMGFIEQVEAIIKHLPTERTTMLFSATLPQDIEKLSRQYMQN 199

Query: 447 PVRILVQKEELTLEGIK 497
           P  I V+   LT   I+
Sbjct: 200 PEHIEVKAAGLTTRNIE 216


>UniRef50_Q7VQL9 Cluster: Cold-shock DEAD-box protein A, inducible
           ATP-independent RNA helicase; n=2;
           Enterobacteriaceae|Rep: Cold-shock DEAD-box protein A,
           inducible ATP-independent RNA helicase - Blochmannia
           floridanus
          Length = 487

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI--GGT 174
           GKTA F + +LQ ID   R  Q LI+ PTRELA QI  V +     L+   +  +  GG 
Sbjct: 55  GKTAAFLLPLLQNIDIKQRFVQGLIIVPTRELAIQIGHVCMYFIKSLSHIINIAVLYGGQ 114

Query: 175 NVREDIRQLESGVHVVVGTPGRVYD 249
           N R     L+   H+++GTPGR+ D
Sbjct: 115 NYRIQFNDLKKNPHIIIGTPGRLLD 139



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 2/93 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R L  + +K  ++DEADEML  GF + I  + + +    Q  L SAT+P  + ++S  FM
Sbjct: 143 RGLDISKLKTLIIDEADEMLRMGFIEDIEHIIRYVPTHRQTALFSATLPVSIRKLSYKFM 202

Query: 441 RDPVRILVQKEELTLEGIKQFY--MH*IRRMEA 533
            +P  I +         IKQ Y  +H I + EA
Sbjct: 203 CNPKEIYINPSISACADIKQSYWLVHGISKHEA 235


>UniRef50_Q3AZR1 Cluster: DEAD/DEAH box helicase-like; n=2;
           Synechococcus|Rep: DEAD/DEAH box helicase-like -
           Synechococcus sp. (strain CC9902)
          Length = 458

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 31/89 (34%), Positives = 53/89 (59%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA F + I++ +    +    +  +L+L PTRELA Q++    A   +L  +  A  G
Sbjct: 73  GKTAAFILPIIELLRAEDKPKRYQVHSLVLTPTRELAAQVEASAKAYTKYLALRSDAVFG 132

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           G ++R  +++L+ GV ++V TPGR+ D+I
Sbjct: 133 GVSIRPQVKRLQGGVDILVATPGRLLDLI 161



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/67 (32%), Positives = 37/67 (55%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  + +K+ VLDEAD ML  GF   I  V + L  + Q ++ SAT    + +++   
Sbjct: 163 QKMIRFDNLKVLVLDEADRMLDMGFIRDIKKVIEYLPKNRQNMMFSATFSTPIKKLALGL 222

Query: 438 MRDPVRI 458
           + DPV I
Sbjct: 223 LNDPVEI 229


>UniRef50_Q2BP56 Cluster: Putative ATP-dependent RNA helicase; n=1;
           Neptuniibacter caesariensis|Rep: Putative ATP-dependent
           RNA helicase - Neptuniibacter caesariensis
          Length = 427

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 32/89 (35%), Positives = 54/89 (60%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA+F++ I++++  +     R  +AL+LAPTRELA Q+    +  G  L  +  +  G
Sbjct: 53  GKTASFALPIIEKLSKNPIDGYRPVRALVLAPTRELAIQVADNTLEYGRDLGMRVISVYG 112

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           G  V   I++L+ G  ++V TPGR+ D++
Sbjct: 113 GVPVENQIKRLKRGTDILVATPGRLLDLL 141



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/82 (31%), Positives = 44/82 (53%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A+    ++  VLDEAD ML  GF D I  +    + D Q +L +AT  + V  ++  +
Sbjct: 143 QKAISLEKLEYLVLDEADRMLDLGFIDPIQKIMDYAADDRQTLLFTATADESVEVLAEFY 202

Query: 438 MRDPVRILVQKEELTLEGIKQF 503
           + +P +I V     T + I+QF
Sbjct: 203 LNNPTKIKVTPRNSTAKQIRQF 224


>UniRef50_Q0AR94 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Proteobacteria|Rep: DEAD/DEAH box helicase domain
           protein - Maricaulis maris (strain MCS10)
          Length = 787

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKTA F +++ + +   D          ALI+APTRELA Q+Q+ +  L      +  +C
Sbjct: 49  GKTAAFGMAMAKTLLGDDDQFNRPDLPMALIVAPTRELALQVQRELAWLYGEARGQIASC 108

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           +GG + R + + LE G H+VVGTPGR+ D I
Sbjct: 109 VGGMDPRAERKALERGCHIVVGTPGRLRDHI 139



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/72 (37%), Positives = 42/72 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL  + +K  VLDEADEML  GF++ +  +     A  + +L SAT+P  + +++R F
Sbjct: 141 RGALDMSQLKAVVLDEADEMLDFGFREDLEYILDAAPASRRTLLFSATVPRAIADIARRF 200

Query: 438 MRDPVRILVQKE 473
            +D +RI    E
Sbjct: 201 QKDALRISTVSE 212


>UniRef50_Q6BLU9 Cluster: Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28; n=2; Saccharomycetaceae|Rep:
           Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 580

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 32/73 (43%), Positives = 42/73 (57%)
 Frame = +1

Query: 37  QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVH 216
           Q +++  +   LILAPTRELA QI K     GD LN      IGG    E +  + +GVH
Sbjct: 230 QQESNFNKPLGLILAPTRELALQITKEAKLFGDKLNLNVVTIIGGHQYEETVHSVRNGVH 289

Query: 217 VVVGTPGRVYDMI 255
           +VV TPGR+ D +
Sbjct: 290 IVVATPGRLIDSL 302


>UniRef50_O00148 Cluster: ATP-dependent RNA helicase DDX39; n=27;
           Eukaryota|Rep: ATP-dependent RNA helicase DDX39 - Homo
           sapiens (Human)
          Length = 427

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+     +K FVLDE D+ML +   +  + ++F++   + Q ++ SAT+  D+  V R F
Sbjct: 182 RSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKF 241

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ + V  E +LTL G++Q+Y+
Sbjct: 242 MQDPMEVFVDDETKLTLHGLQQYYV 266



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG +
Sbjct: 93  GKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLS 152

Query: 178 VREDIRQLESGV-HVVVGTPGRVYDMI 255
           +++D   L+    HVVVGTPGR+  ++
Sbjct: 153 IKKDEEVLKKNCPHVVVGTPGRILALV 179


>UniRef50_Q5KBP5 Cluster: ATP-dependent RNA helicase DBP5; n=3;
           Filobasidiella neoformans|Rep: ATP-dependent RNA
           helicase DBP5 - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 546

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 54/213 (25%), Positives = 104/213 (48%), Gaps = 6/213 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++++L ++D +I   QA+ +AP+RELA+QIQ+V+  +G          I G+  
Sbjct: 199 GKTAAFTLNMLSRVDPTIPTPQAICIAPSRELARQIQEVIDQIGQFTQVGTFLAIPGSWS 258

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSM--MS 354
           R    +++    +++GTPG + DM++    +  P   +  + ++    E+   + +   +
Sbjct: 259 RNS--RIDK--QILIGTPGTLVDMLMRGSRILDPR--MIRVLVLDEADELIAQQGLGEQT 312

Query: 355 SRFCQLMFKSYYSLLPCLMM---YWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTCIELE 522
            R  QL+  +  ++L          ++ D           R++ +    +   +   + E
Sbjct: 313 FRIKQLLPPNVQNVLFSATFNDDVQEFADRFAPEANKIFLRKEDITVDAIRQLYLECDSE 372

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKVGLAH 621
           + K E L  LYD L I Q+++FC  +RKV   H
Sbjct: 373 DQKYEALSALYDCLVIGQSIVFC--KRKVTADH 403



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 31/84 (36%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R L    I++ VLDEADE++++ G  +Q   + ++L  +VQ +L SAT  DDV E +  F
Sbjct: 284 RILDPRMIRVLVLDEADELIAQQGLGEQTFRIKQLLPPNVQNVLFSATFNDDVQEFADRF 343

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
             +  +I ++KE++T++ I+Q Y+
Sbjct: 344 APEANKIFLRKEDITVDAIRQLYL 367


>UniRef50_Q480Z7 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=2; Alteromonadales|Rep: ATP-dependent RNA
           helicase, DEAD box family - Colwellia psychrerythraea
           (strain 34H / ATCC BAA-681) (Vibriopsychroerythus)
          Length = 399

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA FS+ I+ +     ID   +  ++LIL PTRELA QI + +    D L  K     
Sbjct: 51  GKTAAFSLPIINKFGRNKIDIKAKSTRSLILTPTRELASQIMQNIDDYSDGLGLKTKVVY 110

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG   +  +  +E G+ ++V TPGR+ D+I
Sbjct: 111 GGVGRQAQVDSIELGLDILVATPGRLLDLI 140



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 26/82 (31%), Positives = 45/82 (54%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           ++   +++FVLDEAD ML  GF   +  +   L    Q +L SATMP ++  ++   + D
Sbjct: 145 INFKALEVFVLDEADTMLDMGFFKDVQSIISKLPKSRQTLLFSATMPAEIEILAEAILTD 204

Query: 447 PVRILVQKEELTLEGIKQFYMH 512
           P +I +  E +T++ + Q   H
Sbjct: 205 PTKIQITAETVTIDLVNQSVYH 226


>UniRef50_Q1GJ43 Cluster: DEAD/DEAH box helicase-like protein; n=30;
           cellular organisms|Rep: DEAD/DEAH box helicase-like
           protein - Silicibacter sp. (strain TM1040)
          Length = 710

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F ++I   I   D +        AL++APTRELA Q+++ +  L     A   +C
Sbjct: 51  GKTVGFGLAIAPTILGEDGTFERAASPLALVIAPTRELALQVKRELSWLYGDAGAVLASC 110

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           +GG ++R++ R LE G H+VV TPGR+ D I
Sbjct: 111 VGGMDMRDERRALERGAHIVVATPGRLRDHI 141



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           TR ++  + +   VLDEADEML  GF++ +  + +    D Q +L SAT+   +  +++ 
Sbjct: 142 TRGSIDLSGVAAVVLDEADEMLDLGFREDLEFILEETPEDRQTLLFSATVSKPIAALAQT 201

Query: 435 FMRDPVRI-LVQKEE 476
           +  D  RI  + K E
Sbjct: 202 YQNDAQRISTINKSE 216


>UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA
           helicase; n=2; Bacteria|Rep: Cold-shock DeaD box
           ATP-dependent RNA helicase - Frankia alni (strain
           ACN14a)
          Length = 608

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 35/86 (40%), Positives = 47/86 (54%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQID---TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L ++    T     QAL+L PTRELA Q+ + +   G  L A+     GG
Sbjct: 106 GKTAAFALPLLHRLTDDRTGDHGPQALVLVPTRELAVQVSEAIHRYGRDLGARVLPVYGG 165

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
             +   +R L  GV VVV TPGR  D
Sbjct: 166 APIGRQVRALVQGVDVVVATPGRALD 191



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/69 (39%), Positives = 40/69 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +   VLDEADEML  GF + I  + +      Q +L SAT+P  + +++R  
Sbjct: 195 RGTLRLDGLHTVVLDEADEMLDMGFAEDIDAILEQAPQKRQTVLFSATLPPRMDQIARRH 254

Query: 438 MRDPVRILV 464
           +RDPVRI +
Sbjct: 255 LRDPVRIQI 263


>UniRef50_Q0HYG8 Cluster: DEAD/DEAH box helicase domain protein;
           n=62; Proteobacteria|Rep: DEAD/DEAH box helicase domain
           protein - Shewanella sp. (strain MR-7)
          Length = 549

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA F++ +L+ +    +    + +AL+L PTRELA Q+ + V   G +L  +     G
Sbjct: 50  GKTAGFTLPLLELLSKGNKAKAGQIRALVLTPTRELAAQVSESVETYGKYLPLRSAVVFG 109

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMIL--VVRF 270
           G  +   I++L  GV V+V TPGR+ D++   VV+F
Sbjct: 110 GVPINPQIQKLRHGVDVLVATPGRLLDLVQQNVVKF 145



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/76 (34%), Positives = 41/76 (53%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +++ VLDEAD ML  GF   I  +  +L A  Q ++ SAT  D++ E+++  +  PV 
Sbjct: 146 NQLEILVLDEADRMLDMGFIRDIKKILALLPAKRQNLMFSATFSDEIRELAKGLVNQPVE 205

Query: 456 ILVQKEELTLEGIKQF 503
           I V         +KQ+
Sbjct: 206 ISVTPRNAAANTVKQW 221


>UniRef50_A6DK15 Cluster: ATP-dependent RNA helicase, specific for
           23S rRNA; n=1; Lentisphaera araneosa HTCC2155|Rep:
           ATP-dependent RNA helicase, specific for 23S rRNA -
           Lentisphaera araneosa HTCC2155
          Length = 462

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + +L ++       Q LIL PTREL +Q+ K +  L   + N K  +  GG  
Sbjct: 53  GKTAAFGLGVLSKLVLDDYRIQVLILCPTRELCEQVSKAIRDLARMMPNIKLLSLGGGMP 112

Query: 178 VREDIRQLESGVHVVVGTPGRV 243
            R  ++ +  G H+VVGTPGR+
Sbjct: 113 FRPQMKSVAHGAHIVVGTPGRI 134



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/86 (34%), Positives = 49/86 (56%), Gaps = 3/86 (3%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + +L  + ++  VLDEAD ML  GF+D+I  +    +   Q +L SAT P  +  +++  
Sbjct: 140 KSSLSLDHVRTLVLDEADRMLDMGFQDEIDAIIDQTNKQRQTLLFSATYPKKIATIAKRV 199

Query: 438 MRDPVRILVQK---EELTLEGIKQFY 506
           M+DP+RI +     EE T+E  + FY
Sbjct: 200 MKDPLRIELDSQVHEESTIE--QHFY 223


>UniRef50_A4B5L7 Cluster: ATP-dependent RNA helicase DbpA; n=3;
           Proteobacteria|Rep: ATP-dependent RNA helicase DbpA -
           Alteromonas macleodii 'Deep ecotype'
          Length = 459

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 35/86 (40%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTN 177
           GKT  F I  L++I+ +    QA++L PTRELA+Q+ Q+   A  D  N K     GG  
Sbjct: 53  GKTLCFVIPALEKIEVNDFSTQAIMLCPTRELAEQVAQQCRSAAKDIGNIKVTTLCGGQP 112

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   I+ L+   H++VGTPGRV D +
Sbjct: 113 MGPQIQSLKHSPHIIVGTPGRVMDHV 138



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 26/73 (35%), Positives = 42/73 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +R +    +KL VLDEAD ML  GF+D +  +F      VQ +L SAT  + +  V++ +
Sbjct: 140 KRRIDLRNVKLRVLDEADRMLDMGFEDDLRIIFGQTPKQVQTLLFSATFTEQIERVAKQY 199

Query: 438 MRDPVRILVQKEE 476
           + +PV   V+ +E
Sbjct: 200 LHNPVTCKVESQE 212


>UniRef50_A4RIF1 Cluster: ATP-dependent RNA helicase DBP5; n=7;
           Ascomycota|Rep: ATP-dependent RNA helicase DBP5 -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 504

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 63/211 (29%), Positives = 100/211 (47%), Gaps = 11/211 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQID-TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKT  F ++IL ++D     + QAL LAP+RELA+QIQ V+ ++G      C   +    
Sbjct: 147 GKTGAFVVTILSRVDFNQPNQPQALALAPSRELARQIQSVIQSIGQF----CTGLVVDAA 202

Query: 178 VREDIRQLESGV--HVVVGTPGRVYDMILVVRFMPTPSNFLF------LMKLMKCCPEVS 333
           +   I + E+GV  +VVVGTPG V D+I   +F  +    L       ++       +  
Sbjct: 203 IPGAISR-ETGVKANVVVGTPGTVMDLIRRRQFDVSQLKLLVVDEADNMLDQQGLGEQCV 261

Query: 334 RTRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN--FT 507
           R ++M+      L+F + +   P  +    Y +           R++ L  K ++     
Sbjct: 262 RVKNMLPKTIQTLLFSATF---PDHVK--SYAEKFAPQANQMKLRQQELTVKGISQMYMD 316

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTR 600
           C  L+E K E LC LY  ++I  +VIF  TR
Sbjct: 317 CPSLKE-KYEVLCKLYGLMTIGSSVIFVKTR 346



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           RR    + +KL V+DEAD ML + G  +Q   V  +L   +Q +L SAT PD V   +  
Sbjct: 231 RRQFDVSQLKLLVVDEADNMLDQQGLGEQCVRVKNMLPKTIQTLLFSATFPDHVKSYAEK 290

Query: 435 FMRDPVRILVQKEELTLEGIKQFYM 509
           F     ++ ++++ELT++GI Q YM
Sbjct: 291 FAPQANQMKLRQQELTVKGISQMYM 315


>UniRef50_UPI00006CBDDC Cluster: DEAD/DEAH box helicase family
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           DEAD/DEAH box helicase family protein - Tetrahymena
           thermophila SB210
          Length = 598

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/94 (34%), Positives = 58/94 (61%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISI----LQQIDTSIREC-QALILAPTRELAQQIQKVVIALGDHL---NAKCH 156
           GKT  F + I    ++Q+ T+ + C  AL++APTRELA+QI ++ + L  HL        
Sbjct: 58  GKTLAFLLPIFNVLIKQVKTANKNCVYALVIAPTRELAKQIHEIAVQLASHLENNQFSIQ 117

Query: 157 ACIGGTNVREDIRQLES-GVHVVVGTPGRVYDMI 255
            CIGG + + D+  ++S G ++++ TPG++ +++
Sbjct: 118 LCIGGVSTKIDVSNIQSQGANILIATPGKLKELM 151


>UniRef50_UPI0000499A01 Cluster: DEAD/DEAH box helicase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 684

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 1/82 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA + + I+ +++T   E  ++LI+ PTRELA Q  KV   LG   N K    IGG+ 
Sbjct: 62  GKTAAYLVPIINRLETHSTEGVRSLIICPTRELALQTIKVFNELGKLTNLKASLIIGGSK 121

Query: 178 VREDIRQLESGVHVVVGTPGRV 243
           + +    L SG  ++V TPGR+
Sbjct: 122 LSDQFDNLSSGPDIIVATPGRL 143



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 24/79 (30%), Positives = 43/79 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +++   DEAD M   GF +Q+ D+ ++L    Q++L SAT+P ++ E  +  ++ P  
Sbjct: 155 NRVEMVCFDEADLMFESGFSEQVSDIMRMLPPTRQILLFSATLPRNLAEFLKNTLKQPEI 214

Query: 456 ILVQKEELTLEGIKQFYMH 512
           I +  EE     +  F+ H
Sbjct: 215 IRLDTEERLSPDLDNFFYH 233


>UniRef50_Q8D7D0 Cluster: Superfamily II DNA and RNA helicase; n=20;
           Gammaproteobacteria|Rep: Superfamily II DNA and RNA
           helicase - Vibrio vulnificus
          Length = 418

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 43/141 (30%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE------CQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKTA + + ++Q +    RE       +ALILAPTRELAQQ+   +     H        
Sbjct: 52  GKTAAYGLPLIQMLSRQSREETAPKHPRALILAPTRELAQQVFDNLKQYAQHTELAIVTV 111

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPE 327
            GGT++R    QL  GV +++ TPGR+ D +   +        L L     M  M   P+
Sbjct: 112 YGGTSIRVQQEQLAKGVDILIATPGRLLDHLFTKKTSLNQLQMLVLDEADRMLDMGFLPD 171

Query: 328 VSRTRSMMSSRFCQLMFKSYY 390
           + R    M      L+F + +
Sbjct: 172 IQRIMKRMPEERQTLLFSATF 192



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/75 (34%), Positives = 40/75 (53%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +++ VLDEAD ML  GF   I  + K +  + Q +L SAT    V  ++   M++PV 
Sbjct: 150 NQLQMLVLDEADRMLDMGFLPDIQRIMKRMPEERQTLLFSATFETRVKALAYRLMKEPVE 209

Query: 456 ILVQKEELTLEGIKQ 500
           + V     T + +KQ
Sbjct: 210 VQVAAANSTADTVKQ 224


>UniRef50_Q31AC4 Cluster: DEAD/DEAH box helicase-like protein; n=7;
           Prochlorococcus marinus|Rep: DEAD/DEAH box helicase-like
           protein - Prochlorococcus marinus (strain MIT 9312)
          Length = 593

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N+I   VLDEADEML+ GF + I  +   L  + Q++L SATMP+++  +++ ++ DP  
Sbjct: 194 NSINCLVLDEADEMLNMGFLEDIEWIIDQLPKNKQMVLFSATMPNEIRNIAKKYLNDPAE 253

Query: 456 ILVQ--KEELTLEGIKQFYMH*IRRMEA 533
           IL++  K+E  L   K  Y+    +++A
Sbjct: 254 ILIKSVKKETQLISQKFLYVQRHHKLDA 281



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKVVIALG-DHLNAKCHACIGGT 174
           GKTA F++ +++++ D      + L++ PTRELA Q+ +   +   +  N K  A  GGT
Sbjct: 100 GKTAAFALPLIEKLADNKELNAKVLVMTPTRELATQVAESFKSYSSESTNFKTIAIYGGT 159

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL 300
           + R  I  L+  V VVVGTPGR+ D I    F     N L L
Sbjct: 160 DYRNQIYALKRKVDVVVGTPGRIMDHIRQGTFKVNSINCLVL 201


>UniRef50_Q0TQ86 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=3; Clostridium perfringens|Rep: ATP-dependent
           RNA helicase, DEAD/DEAH box family - Clostridium
           perfringens (strain ATCC 13124 / NCTC 8237 / Type A)
          Length = 405

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA--CIGGT 174
           GKT  + + I+++ID S  E QA+IL+PT EL  QI  V+  L   L  K  +   +G  
Sbjct: 51  GKTLAYLLPIIEKIDDSKNEMQAIILSPTHELGVQINNVLNDLKRGLGKKITSTTLVGSG 110

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
           N++  + +L++  H++VGT GR+ ++I
Sbjct: 111 NIKRQMEKLKNKPHILVGTTGRILELI 137



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVS 428
           ++ +  NTIK  V+DE D++L       +  V K    D Q ++ SATM +  LE +
Sbjct: 139 KKKITTNTIKTIVIDEGDKLLDFINIKDVKSVVKSCPRDTQKLIFSATMNEKALETA 195


>UniRef50_A6DIU5 Cluster: Probable ATP dependent RNA helicase; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Probable ATP
           dependent RNA helicase - Lentisphaera araneosa HTCC2155
          Length = 537

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/85 (38%), Positives = 48/85 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + I+Q+I+  +++ QALIL PTRELA Q+ + + +             GG  +
Sbjct: 52  GKTAAFGLPIVQKIEPGLKKPQALILCPTRELAIQVNEEIKSFCKGRGITTVTLYGGAPI 111

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            +  R L+ GV +VV TPGR    I
Sbjct: 112 MDQKRALKKGVDLVVATPGRCIHFI 136



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 30/87 (34%), Positives = 50/87 (57%)
 Frame = +3

Query: 240 CI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVL 419
           CI +     L  ++++  VLDEADEML+ GF + +  V K    D  V++ SATMP  + 
Sbjct: 132 CIHFIEDGKLELDSLEYLVLDEADEMLNMGFVEDVEKVLKASPDDRTVLMFSATMPPRLK 191

Query: 420 EVSRCFMRDPVRILVQKEELTLEGIKQ 500
           +++  +M + + I  + E +T+E I Q
Sbjct: 192 KIAESYMHNSITIKAKSETMTMETIDQ 218


>UniRef50_A6CFZ8 Cluster: ATP-dependent RNA helicase; n=1;
           Planctomyces maris DSM 8797|Rep: ATP-dependent RNA
           helicase - Planctomyces maris DSM 8797
          Length = 445

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 35/90 (38%), Positives = 50/90 (55%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC-----QALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA  ++ IL Q+  + R+       AL+LAPTRELA QI     A G HL  +     
Sbjct: 51  GKTAALALPILNQLGKNSRKSIPHHPLALVLAPTRELAIQIGDSFDAYGRHLKLRSVLIY 110

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG      ++ L+ G H++V TPGR+ D++
Sbjct: 111 GGVGQGNQVKALKRGAHILVATPGRLLDLM 140



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/78 (32%), Positives = 41/78 (52%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +++FVLDEAD ML  GF   +  +   L    Q +  SAT+   + E++   +  PV 
Sbjct: 148 NQLEVFVLDEADRMLDMGFLPDLKRIITQLPTQRQSLFFSATLAPKITELAHSLLSKPVT 207

Query: 456 ILVQKEELTLEGIKQFYM 509
           + V  +  ++E I+Q  M
Sbjct: 208 VNVTPKTTSVEKIQQQLM 225


>UniRef50_Q7QP86 Cluster: GLP_397_1016_18; n=1; Giardia lamblia ATCC
           50803|Rep: GLP_397_1016_18 - Giardia lamblia ATCC 50803
          Length = 332

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/85 (38%), Positives = 51/85 (60%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ ILQ++        AL+L PTRELA QI++ + A G+ L  +  + IGG + 
Sbjct: 110 GKTLCFALPILQELSQDPYGIFALVLTPTRELALQIEQQMNAYGNPLGIQAQSLIGGKDS 169

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            E    L+S  H+++ TPGR+  M+
Sbjct: 170 VEQSAILDSRPHILIATPGRLAYML 194


>UniRef50_Q58HG3 Cluster: DEAD-box RNA helicase; n=4; Eukaryota|Rep:
           DEAD-box RNA helicase - Athelges takanoshimensis
          Length = 124

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 4/88 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA F++ +LQ +  +     R  +AL+L P+RELA QI + V     HL+ K     G
Sbjct: 9   GKTAGFTLPVLQYLSETKHPKYRPVRALVLTPSRELAAQILENVKEYSTHLDIKSTVVFG 68

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDM 252
           G      I+ L  GV ++V TPGR+ D+
Sbjct: 69  GVKASGQIKTLRQGVDILVATPGRLLDL 96


>UniRef50_Q55BR9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 508

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 34/81 (41%), Positives = 46/81 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA+F+I IL Q+        A+IL PTRELA QI +   A+G  +N  C   IGG + 
Sbjct: 53  GKTASFAIPILNQLSEDPYGVFAVILTPTRELAVQIGEQFNAIGAPMNVNCSVVIGGIDN 112

Query: 181 REDIRQLESGVHVVVGTPGRV 243
                 L+   H++V TPGR+
Sbjct: 113 VTQALILDKRPHIIVATPGRL 133



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 2/78 (2%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADV--QVILLSATMPDDVLEVSRCFMRDPVRI 458
           K  VLDEAD +L   F+ +I  + + L      Q +L SATM  ++ ++    +  P   
Sbjct: 149 KFLVLDEADRLLGEDFELEIASILEHLPPPEKRQTLLFSATMTKNLTKLDSIALNKPFIF 208

Query: 459 LVQKEELTLEGIKQFYMH 512
               +  T++ +KQ Y++
Sbjct: 209 EDNSKYDTVDTLKQEYIY 226


>UniRef50_A2DFG9 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 441

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/81 (39%), Positives = 45/81 (55%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ I+  +        AL+++PTRELAQQI +     G  +NA     IGG  +
Sbjct: 52  GKTAAFALPIISTLSKDPYGIYALVISPTRELAQQICQQFKIFGRGMNADICPIIGGLAI 111

Query: 181 REDIRQLESGVHVVVGTPGRV 243
            +    LE   H+VV TPGR+
Sbjct: 112 TDQASALEKNPHIVVATPGRI 132



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +3

Query: 228 HSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMP 407
           H RS    +TR +   + ++  VLDE D +   G+ D + ++ K L    Q +  SAT  
Sbjct: 135 HLRSASKGNTRFSF--DNLQYLVLDEVDRLFKDGYWDDVLEIIKYLPEKRQTLCFSATKS 192

Query: 408 DDV 416
           D V
Sbjct: 193 DQV 195


>UniRef50_A0EA02 Cluster: Chromosome undetermined scaffold_85, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_85,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 957

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 28/68 (41%), Positives = 44/68 (64%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           ++ N I + +LDEAD ML  GF+ Q+ D+   +  D Q ILLSAT P++V ++S+ F  D
Sbjct: 219 VNLNKITMLILDEADRMLDMGFEPQVRDIVSTIREDRQTILLSATWPNEVQQLSKEFCYD 278

Query: 447 PVRILVQK 470
           P+ + + K
Sbjct: 279 PILVKIGK 286



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 17/79 (21%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHL------NAKCHA---------CI--GGTNVREDIRQ 198
           LIL PTREL  QI   ++ L +        N K ++         CI  G  N ++ +  
Sbjct: 136 LILVPTRELGVQIYDQLLQLIEFYYGNKKQNEKENSPNLTNLKIVCIYGGNPNKKQQVEL 195

Query: 199 LESGVHVVVGTPGRVYDMI 255
           ++ G+HV+V TPGR+ ++I
Sbjct: 196 IQKGIHVIVATPGRLIELI 214


>UniRef50_Q6BML1 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=4; Saccharomycetales|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 913

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS--IRECQA---LILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT +F + +L+ I     +R       LI+ PTRELA QI K +      LN     C 
Sbjct: 366 GKTLSFVLPLLRHIQDQPPLRRGDGPIGLIMTPTRELALQIHKELNHFTKKLNISSCCCF 425

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG+++   I +L+ G  ++VGTPGR+ D++
Sbjct: 426 GGSSIESQIAELKKGAQIIVGTPGRIIDLL 455



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R  +   +   VLDEAD M   GF+ Q+  VF  +  D Q +L SAT P  +  +++  +
Sbjct: 461 RVTNLQRVTYLVLDEADRMFDMGFEPQVTKVFTRVRPDRQTVLFSATFPRKMELLAKKIL 520

Query: 441 RDPVRILV 464
            +P+ I+V
Sbjct: 521 DNPMEIVV 528


>UniRef50_Q11039 Cluster: Cold-shock DEAD box protein A homolog;
           n=31; Bacteria|Rep: Cold-shock DEAD box protein A
           homolog - Mycobacterium tuberculosis
          Length = 563

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 35/84 (41%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLN-AKCHACIGGTN 177
           GKTA F+I +L +ID + +  QAL+L PTRELA Q+ +     G +L+        GG++
Sbjct: 62  GKTAAFAIPMLSKIDITSKVPQALVLVPTRELALQVAEAFGRYGAYLSQLNVLPIYGGSS 121

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
               +  L  G  VVVGTPGR+ D
Sbjct: 122 YAVQLAGLRRGAQVVVGTPGRMID 145



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/92 (34%), Positives = 48/92 (52%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L  + +   VLDEADEML+ GF D +  +        QV L SATMP  + ++S  +
Sbjct: 149 RATLDLSRVDFLVLDEADEMLTMGFADDVERILSETPEYKQVALFSATMPPAIRKLSAKY 208

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEA 533
           + DP  +  + +    E I Q Y+   R+M+A
Sbjct: 209 LHDPFEVTCKAKTAVAENISQSYIQVARKMDA 240


>UniRef50_UPI0000499D6F Cluster: DEAD/DEAH box helicase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 585

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI--------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT  + I ++Q +        +TS     AL+LAPTRELA QIQK  + L      +  
Sbjct: 225 GKTFAYLIPLIQFVLKLPKLTEETSASGPYALVLAPTRELALQIQKETLKLATPFGLRVC 284

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            CIGG  ++  I +L +G  +VV  PGR+ D++
Sbjct: 285 CCIGGEPMQPQIEELSNGAEIVVAAPGRLKDLL 317


>UniRef50_A6QHA1 Cluster: ATP-dependent RNA helicase DEAD/DEAH box
           family protein; n=16; Staphylococcus|Rep: ATP-dependent
           RNA helicase DEAD/DEAH box family protein -
           Staphylococcus aureus (strain Newman)
          Length = 448

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GK+  F + ++Q ID+ I+E QA+++APTRELAQQ+      L            IGGT+
Sbjct: 53  GKSHAFLLPLMQLIDSEIKEPQAIVVAPTRELAQQLYDAANHLSQFKAGVSVKVFIGGTD 112

Query: 178 VREDIRQLESGVHVVVGTPGRVYDM 252
           + +D ++  +   +++GTP R+ D+
Sbjct: 113 IEKDRQRCNAQPQLIIGTPTRINDL 137



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 19/81 (23%), Positives = 38/81 (46%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           LH +     V+DEAD M+  G  + +  +   L  +  + + SAT+P  +      ++  
Sbjct: 143 LHVHLASYLVIDEADLMIDLGLIEDVDYIAARLEDNANIAVFSATIPQQLQPFLNKYLSH 202

Query: 447 PVRILVQKEELTLEGIKQFYM 509
           P  + V  ++   + I +FY+
Sbjct: 203 PEYVAVDSKKQNKKNI-EFYL 222


>UniRef50_A1G315 Cluster: DEAD/DEAH box helicase-like; n=2;
           Salinispora|Rep: DEAD/DEAH box helicase-like -
           Salinispora arenicola CNS205
          Length = 633

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 30/67 (44%), Positives = 42/67 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  + ++  VLDEAD ML  GF D +  +  IL  D Q +L SATMPD ++ +SR F
Sbjct: 249 QKHLKLDRVRALVLDEADRMLDLGFLDDVERILAILPEDRQTMLFSATMPDPIVALSRRF 308

Query: 438 MRDPVRI 458
           +R PV I
Sbjct: 309 LRRPVTI 315



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQI----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+Q+    +      QAL++ PTREL  Q+ K + A G     +     G
Sbjct: 159 GKTLGFGVPLLEQVLAPAEGGDGTPQALVVVPTRELGIQVAKDLQAAGSTRGVRVLPIYG 218

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDM 252
           G      I  L SGV ++VGTPGR+ D+
Sbjct: 219 GVAYEPQIEALRSGVEILVGTPGRLLDL 246


>UniRef50_A0KZD5 Cluster: DEAD/DEAH box helicase domain protein;
           n=19; Alteromonadales|Rep: DEAD/DEAH box helicase domain
           protein - Shewanella sp. (strain ANA-3)
          Length = 487

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE---CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA+F++ +L+Q+     +    +AL++ PTRELA Q+   +      L  K  A  GG
Sbjct: 71  GKTASFALPVLEQLSKQPNDKPLLRALVMTPTRELAIQVCANIQKYSQFLPLKTLAVYGG 130

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYDMI 255
            N+    + +E GV ++V TPGR++D+I
Sbjct: 131 ANMNPQRKGVEQGVDILVATPGRLFDII 158



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/89 (30%), Positives = 45/89 (50%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  +++   V+DEAD ML  GF   I  V ++++ + Q +L SAT  D V ++S   +  
Sbjct: 163 LDLSSVTTLVIDEADRMLDLGFVRDIEKVKRLIATEHQTMLFSATYSDAVKQLSHKMLNQ 222

Query: 447 PVRILVQKEELTLEGIKQFYMH*IRRMEA 533
           P  + V  E  T   ++Q      +R +A
Sbjct: 223 PEWVNV-AENTTASTVEQLVYRVDKRRKA 250


>UniRef50_A0T1H5 Cluster: SF2-family helicase; n=6; Plasmodium|Rep:
           SF2-family helicase - Plasmodium falciparum
          Length = 490

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 31/85 (36%), Positives = 51/85 (60%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  +  SILQ+++ ++    +LIL PTREL  QI +     G  +     +CIGG ++
Sbjct: 119 GKTICYCWSILQELNKNVYGIFSLILLPTRELVFQIIEQFHLYGSKIGVMILSCIGGFSL 178

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            E  + + +  H++VGTPGR+ D++
Sbjct: 179 IEQRKSVMTKPHIIVGTPGRISDIL 203


>UniRef50_Q5KPU1 Cluster: ATP-dependent RNA helicase DBP8; n=2;
           Filobasidiella neoformans|Rep: ATP-dependent RNA
           helicase DBP8 - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 619

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 28/85 (32%), Positives = 51/85 (60%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ I+++I        A++L PTRELA Q+ +  + +G  L       +GG ++
Sbjct: 201 GKTMAFALPIVERIARDPFGVWAVVLTPTRELAYQLSEQFLVIGKPLGLTTATIVGGMDM 260

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            +  ++LE+  H++V TPGR+ D++
Sbjct: 261 MKQAQELEARPHIIVATPGRLCDLL 285



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 4/80 (5%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR----CFMRDP 449
           ++  VLDEAD ML+  F  ++  +F  + A  Q  L +AT+ + ++E++        + P
Sbjct: 298 VRTLVLDEADRMLTPSFAPELAYLFSQIPAKRQTCLFTATVSEAIMELANKEPPAGKQRP 357

Query: 450 VRILVQKEELTLEGIKQFYM 509
               V  + LT+  +KQ Y+
Sbjct: 358 FVYRVASDTLTVSNLKQKYL 377


>UniRef50_Q9RKJ0 Cluster: ATP-dependent RNA helicase; n=2;
           Streptomyces|Rep: ATP-dependent RNA helicase -
           Streptomyces coelicolor
          Length = 740

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 36/88 (40%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQID---TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKT +F +  L  +    T   + +A+IL PTRELA Q+   +   GD L  K     GG
Sbjct: 110 GKTLSFGLPTLATLAGGRTEKHKPRAVILTPTRELAMQVADALQPYGDVLGLKMKVVCGG 169

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYDMI 255
           T++   I  LE GV V+V TPGR+ D+I
Sbjct: 170 TSMGNQIYALERGVDVLVATPGRLRDII 197



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 20/64 (31%), Positives = 37/64 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R A     +++ VLDEAD+M   GF  ++ ++   + A  Q +L SATM +++  +   +
Sbjct: 199 RGACSLENVQIAVLDEADQMSDLGFLPEVTELLDQVPAGGQRMLFSATMENEIKTLVDRY 258

Query: 438 MRDP 449
           ++DP
Sbjct: 259 LKDP 262


>UniRef50_Q87HW1 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=6; Vibrio|Rep: ATP-dependent RNA helicase,
           DEAD box family - Vibrio parahaemolyticus
          Length = 421

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F + I+Q +    R     ALIL PTRELAQQ+   +    +H + +     GGT
Sbjct: 56  GKTAAFGLPIIQAVQQKKRNGTPHALILVPTRELAQQVFDNLTQYAEHTDLRIVCVYGGT 115

Query: 175 NVREDIRQLESGVHVVVGTPGRVYD 249
           ++     +LE G  +++ TPGR+ D
Sbjct: 116 SIGVQKNKLEEGADILIATPGRLLD 140



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/71 (35%), Positives = 36/71 (50%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + VLDEAD ML  GF   +  + + L  D Q++L SAT    +  ++   M  PV + V 
Sbjct: 154 VLVLDEADRMLDMGFWPDLQRILRRLPNDKQIMLFSATFEKRIKTIAYKLMDSPVEVEVS 213

Query: 468 KEELTLEGIKQ 500
               T E +KQ
Sbjct: 214 PANTTAETVKQ 224


>UniRef50_Q2YZZ9 Cluster: Putative uncharacterized protein; n=1;
           uncultured candidate division OP8 bacterium|Rep:
           Putative uncharacterized protein - uncultured candidate
           division OP8 bacterium
          Length = 453

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 35/84 (41%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQ-IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA F + IL Q ID      +AL++ PTRELA QI + +  L  H      A  GG +
Sbjct: 50  GKTAAFLLPILHQLIDRPRGTTRALVITPTRELAAQILEDLNDLAVHTPISAAAVFGGVS 109

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           +R        GV V++GTPGR+ D
Sbjct: 110 IRPQEHAFRRGVDVLIGTPGRLLD 133



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/69 (36%), Positives = 36/69 (52%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF   I  + K + A  Q +  SATMP  +  ++R  +R+P  + + + 
Sbjct: 149 VLDEADRMLDMGFLPDIRRILKHIPARRQTLFFSATMPAPIGVLAREMLRNPATVNINRI 208

Query: 474 ELTLEGIKQ 500
                GI Q
Sbjct: 209 AAPAAGITQ 217


>UniRef50_A7BCL2 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 722

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 37/86 (43%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELA-QQIQKVVIALGDHLNAKCHACIGGTN 177
           GKTA F + +L  +D   R  QAL+LAPTRELA Q  Q +                GG+ 
Sbjct: 94  GKTAAFGLPLLAIVDADERNVQALVLAPTRELAMQSAQAIEDFAARTARLDVVPVYGGSP 153

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
               I  L+ G  VVVGTPGRV D+I
Sbjct: 154 YGPQIGALKRGAQVVVGTPGRVIDLI 179



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/81 (38%), Positives = 47/81 (58%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           AL  + +++ VLDEADEML  GF + +  +      D    L SATMP  + +V+R  ++
Sbjct: 183 ALDLSHVRMLVLDEADEMLRMGFAEDVETIASSAPDDRLTALFSATMPAAIEKVAREHLK 242

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DPV++ V  E  T++ I Q Y
Sbjct: 243 DPVKVAVSTESSTVDTIHQTY 263


>UniRef50_Q9V3C4 Cluster: CG6539-PA; n=1; Drosophila
           melanogaster|Rep: CG6539-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 1028

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL-GDHLNAKCHACIGGTN 177
           GKT  + I+++Q  + +I +  A+I+ PTRELA Q+Q     L     + KC A IGGT+
Sbjct: 74  GKTLIYVIAVVQSFNPNINQPHAMIVVPTRELAIQVQDTFFHLCKSFRDFKCSAFIGGTD 133

Query: 178 VREDIRQLESGVHVVVGTPGRV 243
           V +D +++     V++GTPGR+
Sbjct: 134 VAKDRKRMNES-RVIIGTPGRL 154



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSA---DVQVILLSATMPDDVLEVSR 431
           R    + ++L VLDEAD++     K   H V K++ A   + Q+I  SAT   ++ E   
Sbjct: 161 RVFDVSKLRLLVLDEADQLYQT--KSLQHTVSKLIEAMPKNRQIIACSATYDQNLDERLA 218

Query: 432 CFMRDPVRILVQKEELTLEGIKQF 503
             M  P+ I   +    L GI+QF
Sbjct: 219 KVMDKPMLISNSERATVLLGIRQF 242


>UniRef50_P25888 Cluster: Putative ATP-dependent RNA helicase rhlE;
           n=122; cellular organisms|Rep: Putative ATP-dependent
           RNA helicase rhlE - Escherichia coli (strain K12)
          Length = 454

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 36/90 (40%), Positives = 51/90 (56%), Gaps = 6/90 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT------SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKTA F++ +LQ + T        R  +ALIL PTRELA QI + V     +LN +    
Sbjct: 50  GKTAGFTLPLLQHLITRQPHAKGRRPVRALILTPTRELAAQIGENVRDYSKYLNIRSLVV 109

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDM 252
            GG ++   + +L  GV V+V TPGR+ D+
Sbjct: 110 FGGVSINPQMMKLRGGVDVLVATPGRLLDL 139



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + A+  + +++ VLDEAD ML  GF   I  V   L A  Q +L SAT  DD+  ++   
Sbjct: 142 QNAVKLDQVEILVLDEADRMLDMGFIHDIRRVLTKLPAKRQNLLFSATFSDDIKALAEKL 201

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           + +P+ I V +     + + Q
Sbjct: 202 LHNPLEIEVARRNTASDQVTQ 222


>UniRef50_Q4T4A9 Cluster: Chromosome undetermined SCAF9757, whole
           genome shotgun sequence; n=2; Euteleostomi|Rep:
           Chromosome undetermined SCAF9757, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 215

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/39 (79%), Positives = 35/39 (89%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 117
           GKTATF ISILQ+IDTS++E QALILAPTRELAQQ  K+
Sbjct: 79  GKTATFVISILQRIDTSLKETQALILAPTRELAQQEWKL 117



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 24/30 (80%), Positives = 27/30 (90%)
 Frame = +1

Query: 520 EEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           +EWKL TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 113 QEWKLPTLCDLYETLTITQAVIFVNTRRKV 142



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE++  +DFTVSAMHG
Sbjct: 143 DWLTENLLGKDFTVSAMHG 161


>UniRef50_Q89UH0 Cluster: Dead-box ATP-dependent RNA helicase; n=23;
           Alphaproteobacteria|Rep: Dead-box ATP-dependent RNA
           helicase - Bradyrhizobium japonicum
          Length = 530

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA+F++ IL +     I    +  + L+L+PTREL+ QI     A G H+       I
Sbjct: 65  GKTASFALPILHRLLEHRIKPQPKTTRVLVLSPTRELSGQILDSFNAYGRHIRLSSTLAI 124

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG  +   +R L  GV V+V TPGR+ D++
Sbjct: 125 GGVPMGRQVRSLMQGVEVLVATPGRLLDLV 154



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 41/78 (52%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L   +++  VLDEAD ML  GF + I  +   L    Q +  SATMP D+ E++   +RD
Sbjct: 159 LKLGSVEFLVLDEADRMLDMGFINDIRKIVAKLPIKRQTLFFSATMPKDIAELADSMLRD 218

Query: 447 PVRILVQKEELTLEGIKQ 500
           P R+ V     T E I Q
Sbjct: 219 PARVAVTPVSSTAERINQ 236


>UniRef50_Q5FNK0 Cluster: ATP-dependent RNA helicase; n=1;
           Gluconobacter oxydans|Rep: ATP-dependent RNA helicase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 393

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 33/88 (37%), Positives = 51/88 (57%), Gaps = 2/88 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS--IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F + +LQ++  +      +ALIL PTRELA Q   V   LG  L+ K     GGT
Sbjct: 69  GKTAAFVLPMLQKLTEAGPAPGPRALILEPTRELAAQTAAVCRQLGRRLSLKTRVICGGT 128

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMIL 258
           +  + ++ +  GV ++V T GR+ D+++
Sbjct: 129 SREQQVQSVSDGVDIIVATHGRLLDLVM 156



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKIL-SADVQVILLSATMPDDVLEVSRCFMRDPVRILVQK 470
           VLDEAD +L   F   +  +         Q +  SAT+P+ V+++++   R+PVR+ +  
Sbjct: 169 VLDEADRLLDEDFSASMTALTPYFPDQPPQTVFCSATLPEPVMDLAKRVTRNPVRVEIAA 228

Query: 471 EELTLEGIKQ 500
           E  T + I+Q
Sbjct: 229 ESFTPKNIRQ 238


>UniRef50_Q12QV2 Cluster: DEAD/DEAH box helicase-like protein; n=16;
           Gammaproteobacteria|Rep: DEAD/DEAH box helicase-like
           protein - Shewanella denitrificans (strain OS217 / ATCC
           BAA-1090 / DSM 15013)
          Length = 433

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ-----ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F++ ILQ++       Q     ALIL PTRELA Q+   + A   H+N       
Sbjct: 50  GKTAAFALPILQKMHERPMTVQHSNARALILTPTRELAAQVADNISAYSKHMNISVLTIY 109

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL 300
           GG  +    ++L+ G  ++V TPGR+ + I+      +   FL L
Sbjct: 110 GGMKMATQAQKLKQGADIIVATPGRLLEHIVACNLSLSNVEFLVL 154



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 23/78 (29%), Positives = 37/78 (47%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + ++  VLDEAD ML  GF   I  + + ++   Q +L SAT    V +++   +  
Sbjct: 144 LSLSNVEFLVLDEADRMLDMGFSTDIQKILQAVNKKRQNLLFSATFSTAVKKLANDMLDK 203

Query: 447 PVRILVQKEELTLEGIKQ 500
           P  I   K+  T   + Q
Sbjct: 204 PKIISADKQNTTAATVSQ 221


>UniRef50_Q0G0P8 Cluster: Superfamily II DNA and RNA helicase; n=2;
           Aurantimonadaceae|Rep: Superfamily II DNA and RNA
           helicase - Fulvimarina pelagi HTCC2506
          Length = 457

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT-----SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F++ +L  + T     + R  +ALIL+PTRELA QI + +  L +          
Sbjct: 53  GKTAAFALPLLHHLMTVGGKPTTRTTKALILSPTRELAVQIAESIADLSEGTPISHCVVF 112

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG +VR  I+ L  GV ++V TPGR+ D++
Sbjct: 113 GGVSVRPQIQALARGVDILVATPGRLLDLM 142



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/84 (34%), Positives = 47/84 (55%), Gaps = 3/84 (3%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSA---DVQVILLSATMPDDVLEVS 428
           +RA+     +  +LDEAD ML  GF   + DV KI+     D Q ++ SATMP  + ++S
Sbjct: 144 QRAIDLRETRHLILDEADRMLDMGF---VRDVMKIVGKCPDDRQSMMFSATMPKPIEDLS 200

Query: 429 RCFMRDPVRILVQKEELTLEGIKQ 500
           +  + +P ++ V    +T+E I Q
Sbjct: 201 KKILTNPQKVSVTPAVVTVEKIAQ 224


>UniRef50_A6TX49 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Firmicutes|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 387

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/85 (36%), Positives = 46/85 (54%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I IL +ID   +  QA+ILAP+ ELA QI + +       N      IGG N+
Sbjct: 59  GKTLAYLIPILHRIDPESKAVQAVILAPSHELAMQIHQTIEKWTKDNNISSEPLIGGANI 118

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           +  I  L+    ++V T GR+ ++I
Sbjct: 119 KRQIENLKKRPQIIVATTGRLLEVI 143



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 16/75 (21%), Positives = 40/75 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           + +  + +K  V+DE D +++    + +  + K    + Q++  SAT+ ++  ++    M
Sbjct: 146 KKIKMHEVKTIVVDEFDILIAEEHAENLKHIIKTTLKERQIVCFSATISENTEQIGMELM 205

Query: 441 RDPVRILVQKEELTL 485
           ++P  I +QK + +L
Sbjct: 206 KEPKIIQIQKGQSSL 220


>UniRef50_A6Q8Y9 Cluster: ATP-dependent RNA helicase, DEAD-box
           family; n=6; Bacteria|Rep: ATP-dependent RNA helicase,
           DEAD-box family - Sulfurovum sp. (strain NBC37-1)
          Length = 492

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/71 (39%), Positives = 44/71 (61%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEADEML  GF D+I ++F  L  + Q ++ SATMP+ + +++   + +P  + + K 
Sbjct: 145 VLDEADEMLDMGFLDEIKNIFTFLPKERQTLMFSATMPNGIRKLAEQILNNPKTVSITKS 204

Query: 474 ELTLEGIKQFY 506
           E T   I Q+Y
Sbjct: 205 ESTNSKITQYY 215



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 27/86 (31%), Positives = 44/86 (51%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + I+  +       + L++ PTRELA Q+   +   G     K     GGT  
Sbjct: 50  GKTAAFGLPIMSMMKAD-GSVEGLVIVPTRELAMQVSDELFRFGKLSGLKTATVYGGTAY 108

Query: 181 REDIRQLESGVHVVVGTPGRVYDMIL 258
            + I +++    +VV TPGR+ D+++
Sbjct: 109 GKQIERIKQ-ASIVVATPGRLQDLLM 133


>UniRef50_A4C6L9 Cluster: ATP-dependent RNA helicase, DEAD box
           family protein; n=1; Pseudoalteromonas tunicata D2|Rep:
           ATP-dependent RNA helicase, DEAD box family protein -
           Pseudoalteromonas tunicata D2
          Length = 416

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 6/96 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQ---IDTS---IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKTA + +  LQ+   +D S   +R  +AL L PTRELA Q+++ +   G  LN +  + 
Sbjct: 51  GKTAAYLLPTLQELSRVDNSAEQVRPVRALFLVPTRELAVQVEESIAKYGKGLNLRTISV 110

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRF 270
            GG  +   + + + G  +VV TP R+ D++ V  F
Sbjct: 111 FGGVRIPSQVNRFKRGADIVVATPRRLVDLLKVKAF 146



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSAT 401
           +A     +K FV+DEAD ++S G   ++  +   +    Q IL SAT
Sbjct: 144 KAFSLEQVKHFVMDEADRLVSMGIVAELRTILAAMPQAKQQILFSAT 190


>UniRef50_A3PFY9 Cluster: DEAD/DEAH box helicase domain protein;
           n=10; Alphaproteobacteria|Rep: DEAD/DEAH box helicase
           domain protein - Rhodobacter sphaeroides (strain ATCC
           17029 / ATH 2.4.9)
          Length = 793

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 37/91 (40%), Positives = 48/91 (52%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F I+I  QI              AL +APTRELA Q+ + +  L     A    C
Sbjct: 64  GKTVAFGIAIADQILQGADRLLFADTPIALAIAPTRELALQVARELGWLYGEAGAHIATC 123

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           +GG + R + R L+ G H+VVGTPGR+ D I
Sbjct: 124 VGGMDYRTERRALDRGAHIVVGTPGRLRDHI 154



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 41/67 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R +L  + ++  VLDEADEML  GF++ +  +      + + ++ SAT+P ++  +++ F
Sbjct: 156 RGSLDLSGLRAVVLDEADEMLDLGFREDLEFILGSAPEERRTLMFSATVPKEIEALAKEF 215

Query: 438 MRDPVRI 458
            +D VRI
Sbjct: 216 QQDAVRI 222


>UniRef50_A0KTC9 Cluster: DEAD/DEAH box helicase domain protein;
           n=132; Bacteria|Rep: DEAD/DEAH box helicase domain
           protein - Shewanella sp. (strain ANA-3)
          Length = 578

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 32/88 (36%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA F++ +L+ +    +    + +AL+L PTRELA Q+ + V   G +L  +     G
Sbjct: 50  GKTAGFTLPLLELLSKGNKAKAGQIRALVLTPTRELAAQVSESVETYGKYLPLRSAVVFG 109

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDM 252
           G  +   I++L  GV V+V TPGR+ D+
Sbjct: 110 GVPINPQIQKLRHGVDVLVATPGRLLDL 137



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/84 (32%), Positives = 46/84 (54%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           + ++A+  N +++ VLDEAD ML  GF   I  +  +L A  Q ++ SAT  D++ E+++
Sbjct: 138 EQQKAVKFNQLEVLVLDEADRMLDMGFIRDIKKILAMLPAKRQNLMFSATFSDEIRELAK 197

Query: 432 CFMRDPVRILVQKEELTLEGIKQF 503
             +  PV I V         +KQ+
Sbjct: 198 GLVNQPVEISVTPRNAAANTVKQW 221


>UniRef50_Q9GV13 Cluster: Vasa-related protein CnVAS1; n=3;
           Eumetazoa|Rep: Vasa-related protein CnVAS1 - Hydra
           magnipapillata (Hydra)
          Length = 797

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 37/95 (38%), Positives = 53/95 (55%), Gaps = 10/95 (10%)
 Frame = +1

Query: 1   GKTATFSISILQ-------QIDTSIRECQA---LILAPTRELAQQIQKVVIALGDHLNAK 150
           GKTA F I +L        ++ +S+ E QA   L++APTRELA QIQK       + + K
Sbjct: 402 GKTAAFLIPVLNTLMQFRSELTSSLSEVQAPLALVIAPTRELAVQIQKEARKFAQNTSIK 461

Query: 151 CHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
                GG  V   +RQ++   H++VGTPGR+ D +
Sbjct: 462 PVVIYGGVQVAYHLRQVQQDCHLLVGTPGRLKDFL 496



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 4/88 (4%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGF----KDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           +R +    +K  +LDEAD ML  GF    K  I+D       D   ++ SAT P ++  +
Sbjct: 498 KRKISLANLKYLILDEADRMLDMGFLPEIKAIINDFDMPPKEDRHTLMFSATFPTEIQNL 557

Query: 426 SRCFMRDPVRILVQKEELTLEGIKQFYM 509
           +  F+ + V + + K   T   I Q  M
Sbjct: 558 AAEFLNNYVYLTIGKVGGTHSDITQCIM 585


>UniRef50_Q54TF8 Cluster: DEAD-box RNA helicase; n=2; Dictyostelium
           discoideum|Rep: DEAD-box RNA helicase - Dictyostelium
           discoideum AX4
          Length = 465

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 52/205 (25%), Positives = 98/205 (47%), Gaps = 6/205 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ +L  +D SI   QA+ ++PT+ELA Q  +V+  +G   N K    I    V
Sbjct: 120 GKTAAFTLGMLNCVDPSINAPQAICISPTKELALQTFEVISKIGQFSNIKPLLYISEIEV 179

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI----LVVRF--MPTPSNFLFLMKLMKCCPEVSRTR 342
            +++        V++GTPG++ + +    L V+F  M       F++K+     +++   
Sbjct: 180 PKNVTN-----QVIIGTPGKILENVIKKQLSVKFLKMVVLDEADFIVKMKNVPNQIAMIN 234

Query: 343 SMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELE 522
            ++ S     +F + +S+    ++     D    I    L R++    K+   F     E
Sbjct: 235 RLLPSNVKVCLFSATFSMGVEELIKKIVQDPYTSI---RLKRQELSVEKIHQYFIDCGSE 291

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNT 597
           + K   L D+Y  +S+ Q+++F +T
Sbjct: 292 DNKALILSDIYGFISVGQSIVFVHT 316


>UniRef50_Q9UHL0 Cluster: ATP-dependent RNA helicase DDX25; n=111;
           Eumetazoa|Rep: ATP-dependent RNA helicase DDX25 - Homo
           sapiens (Human)
          Length = 483

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           I++FVLDEAD M+ ++GF D    + + L ++ Q++L SAT  D V   +   + DP  I
Sbjct: 241 IRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFEDSVWHFAERIIPDPNVI 300

Query: 459 LVQKEELTLEGIKQFYM 509
            ++KEELTL  I+Q+Y+
Sbjct: 301 KLRKEELTLNNIRQYYV 317



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 50/210 (23%), Positives = 94/210 (44%), Gaps = 9/210 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F +++L +++      Q L LAPT ELA Q  +VV  +G   ++ +    I G  
Sbjct: 148 GKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNR 207

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVS-------R 336
           +    R  +    +++GTPG V D    ++ +      +F++       +         R
Sbjct: 208 IP---RGTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIR 264

Query: 337 TRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCI- 513
            +  + S    L+F + +         W + + +         R++ L    +  +  + 
Sbjct: 265 IQRALPSECQMLLFSATFE-----DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLC 319

Query: 514 ELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
           E  + K + LC++Y +++I QA+IFC TRR
Sbjct: 320 EHRKDKYQALCNIYGSITIGQAIIFCQTRR 349


>UniRef50_Q81RE0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=9; Bacillus cereus group|Rep: ATP-dependent
           RNA helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 389

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 27/85 (31%), Positives = 50/85 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + + +L +I+  +++ Q ++LAPTREL  QI + V            + IGG ++
Sbjct: 47  GKTLAYLLPLLHKINPEVKQPQVVVLAPTRELVMQIHEEVQKFTAGTEISGASLIGGADI 106

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           +  + +L+    V+VG+PGR+ ++I
Sbjct: 107 KRQVEKLKKHPRVIVGSPGRILELI 131


>UniRef50_Q4IZ16 Cluster: DEAD/DEAH box helicase:Helicase,
           C-terminal:DbpA RNA binding domain; n=18;
           Pseudomonadaceae|Rep: DEAD/DEAH box helicase:Helicase,
           C-terminal:DbpA RNA binding domain - Azotobacter
           vinelandii AvOP
          Length = 575

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 34/84 (40%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F++ +L +ID + RE Q LILAPTRELA Q+          L      A  GG  
Sbjct: 72  GKTAAFALPMLSRIDPARREPQLLILAPTRELALQVATAFETYASQLPGVGVVAVYGGAP 131

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           +   ++ L  G  ++V TPGR+ D
Sbjct: 132 MGPQLKALRQGAQILVATPGRLCD 155



 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           +T+K  VLDEADEML  GF + +  +F  L    Q +L SAT+P  + E++   + +P  
Sbjct: 165 STVKHLVLDEADEMLKLGFMEDLEVIFAALPESRQTVLFSATLPHSIREIAEKHLHEPQH 224

Query: 456 ILVQKEELTLEGIKQFYM 509
           + +  +  T+  I Q ++
Sbjct: 225 VKIAAKTQTVARIDQAHL 242


>UniRef50_A6VTY7 Cluster: DEAD/DEAH box helicase domain protein;
           n=48; root|Rep: DEAD/DEAH box helicase domain protein -
           Marinomonas sp. MWYL1
          Length = 463

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 4/88 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQI----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA F++ +L+ +    +    + +AL+L PTRELA Q+ + V   G HL+ K     G
Sbjct: 54  GKTAGFTLPLLEILSKGENAQSNQVRALVLTPTRELAAQVAESVKNYGQHLSLKSTVVFG 113

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDM 252
           G  +   +  L  G  +++ TPGR+ D+
Sbjct: 114 GVKINPQMMALRRGADILIATPGRMMDL 141



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 24/82 (29%), Positives = 45/82 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A+  + +++ VLDEAD ML  GF   I  +  IL    Q +L SAT   ++ ++++  
Sbjct: 144 QKAVRFDKLEVLVLDEADRMLDMGFIHDIKKILAILPKKRQNLLFSATFSPEIRQLAKGL 203

Query: 438 MRDPVRILVQKEELTLEGIKQF 503
           + +P+ I V     T   ++Q+
Sbjct: 204 VNNPIEISVTPRNATAVSVEQW 225


>UniRef50_A4B385 Cluster: ATP-dependent RNA helicase, DEAD box
           family protein; n=2; Proteobacteria|Rep: ATP-dependent
           RNA helicase, DEAD box family protein - Alteromonas
           macleodii 'Deep ecotype'
          Length = 441

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 4/90 (4%)
 Frame = +1

Query: 1   GKTATFSIS----ILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F +     ++ Q   S ++ +ALILAPTRELA+Q+     ++   LN  C   +G
Sbjct: 50  GKTFAFLVPAINRLMAQKALSRQDPRALILAPTRELAKQVFIEAKSMCTGLNLTCSLIVG 109

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMIL 258
           G N  + ++ L    H++VGT GRV D +L
Sbjct: 110 GENYNDQVKALRRNPHIIVGTAGRVADHLL 139


>UniRef50_Q54T87 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 586

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/77 (37%), Positives = 46/77 (59%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D  R  H ++++  VLDEAD ML  GF  QI  +   +  + Q ++ SAT P +V  ++ 
Sbjct: 247 DLLRKHHLSSVQYLVLDEADRMLDMGFMPQIESLIDQIPKERQTLMFSATWPKEVKLLAS 306

Query: 432 CFMRDPVRILVQKEELT 482
            F++DP++I V  +ELT
Sbjct: 307 KFLKDPIKITVGSQELT 323



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/62 (40%), Positives = 38/62 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L++APTRELAQQI++V        + +     GG    +  R L +GV +V+GTPGR+ D
Sbjct: 188 LVMAPTRELAQQIEEVCKTSIRGTSIRQLCAYGGLGKIDQSRILRNGVDIVIGTPGRLND 247

Query: 250 MI 255
           ++
Sbjct: 248 LL 249


>UniRef50_Q4N9Q9 Cluster: DEAD box RNA helicase, putative; n=3;
           Piroplasmida|Rep: DEAD box RNA helicase, putative -
           Theileria parva
          Length = 501

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 52/207 (25%), Positives = 97/207 (46%), Gaps = 7/207 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF++++L +++ ++   QAL + PTRELA Q  +V+  LG     KC   +     
Sbjct: 149 GKTATFALAMLSKVNVNVPLVQALCICPTRELATQNVQVIQKLGQFTQIKCFLGVPQCPR 208

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            ED  Q     H+ VGTPG+  D  L  R M   +    +M ++    E+   ++ M  +
Sbjct: 209 YEDNDQ----YHLYVGTPGKTMD-FLKKRIMNVTN---VVMLVLDEADELINQQNNMGPQ 260

Query: 361 FCQL--MFKSYYSLLPCLMMY----WKYLDAL*EILYAYLYRRKSLPWKVLN-NFTCIEL 519
             Q+   F+    ++     +    + +   +    +    +R+ L    ++  +     
Sbjct: 261 VLQIRNFFRGPVQIVLFSATFSDNVYNFATKIAPRAHVIQVKREQLTLDCIDQRYMICND 320

Query: 520 EEWKLETLCDLYDTLSIAQAVIFCNTR 600
           +E K   L ++Y ++ + Q+VIF N+R
Sbjct: 321 DEDKFNKLSEIYSSMIVGQSVIFVNSR 347



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 2/114 (1%)
 Frame = +3

Query: 174 QCP*RYSPTGEWCSCGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSR--GFKDQIH 347
           QCP RY    ++    G   ++ + +  +R ++   + + VLDEADE++++      Q+ 
Sbjct: 205 QCP-RYEDNDQYHLYVGTPGKT-MDFLKKRIMNVTNVVMLVLDEADELINQQNNMGPQVL 262

Query: 348 DVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQFYM 509
            +       VQ++L SAT  D+V   +         I V++E+LTL+ I Q YM
Sbjct: 263 QIRNFFRGPVQIVLFSATFSDNVYNFATKIAPRAHVIQVKREQLTLDCIDQRYM 316


>UniRef50_Q4P7Y2 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 568

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 36/93 (38%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQID--------TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA+F I +L  I         T     QALIL PTRELAQQI+         L  +C 
Sbjct: 316 GKTASFLIPLLAYISKLPKLDEHTKALGPQALILVPTRELAQQIETETNKFAGRLGLRCV 375

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           + +GG ++ +    L  G  +V+ TPGR+ D I
Sbjct: 376 SIVGGRDMNDQAYALRDGAEIVIATPGRLKDCI 408


>UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3;
           Methanosarcinaceae|Rep: DEAD-box RNA helicase -
           Methanococcoides burtonii
          Length = 522

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 35/85 (41%), Positives = 46/85 (54%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F   I+Q+I+      +AL+L PTRELA+Q+Q  +     H   +     GG  +
Sbjct: 51  GKTLAFGCGIIQKIEKG-NGIRALVLTPTRELAEQVQNSLKEFSRHKQLRVAPIYGGVAI 109

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
              IRQLE    VVV TPGR+ D I
Sbjct: 110 NPQIRQLER-ADVVVATPGRLLDHI 133



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 26/91 (28%), Positives = 50/91 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  +    +++ VLDEAD ML  GF D + ++     +D Q ++ SAT+  D+  +S  +
Sbjct: 135 RGTIDLGDVEILVLDEADRMLDMGFIDDVEEIIDECPSDRQTMMFSATVSKDIQYLSSKY 194

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRME 530
           M +P ++   K  +  + +KQ Y+   ++M+
Sbjct: 195 MNNPSKVFA-KAYVDSDKLKQVYIDVPKKMK 224


>UniRef50_Q9LUW5 Cluster: DEAD-box ATP-dependent RNA helicase 53;
           n=14; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 53 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 616

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 38/91 (41%), Positives = 51/91 (56%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F I I+ +I          R    L+LAPTRELA+Q++K        L+  C   
Sbjct: 153 GKTLAFGIPIIDKIIKYNAKHGRGRNPLCLVLAPTRELARQVEKEFRESAPSLDTIC--L 210

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT + + +RQL+ GV V VGTPGRV D++
Sbjct: 211 YGGTPIGQQMRQLDYGVDVAVGTPGRVIDLM 241



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/67 (31%), Positives = 41/67 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL+ + ++  VLDEAD+ML  GF + +  + + L    Q ++ SATMP  +  +++ +
Sbjct: 243 RGALNLSEVQFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKY 302

Query: 438 MRDPVRI 458
           + +P+ +
Sbjct: 303 LNNPLTV 309


>UniRef50_Q8YH70 Cluster: ATP-DEPENDENT RNA HELICASE RHLE; n=10;
           Rhizobiales|Rep: ATP-DEPENDENT RNA HELICASE RHLE -
           Brucella melitensis
          Length = 535

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 53/90 (58%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA FS+ ILQ+I         +  +ALILAPTRELA QI++ +  +    +      +
Sbjct: 136 GKTAAFSLPILQKIIGLGDKRRPKTARALILAPTRELAVQIEQTIRNVSKSAHISTALVL 195

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG +    I+++  G+ V++ TPGR+ D++
Sbjct: 196 GGVSKLSQIKRIAPGIDVLIATPGRLTDLM 225



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/69 (40%), Positives = 39/69 (56%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF + +  + K   A+ Q  L SATMP ++  ++   +RDPVR+ V  +
Sbjct: 239 VLDEADRMLDMGFINDVKRIAKATHAERQTALFSATMPKEIASLAERLLRDPVRVEVAPQ 298

Query: 474 ELTLEGIKQ 500
             T   I Q
Sbjct: 299 GATASEITQ 307


>UniRef50_Q41F45 Cluster: Helicase, C-terminal:DEAD/DEAH box
           helicase, N-terminal; n=1; Exiguobacterium sibiricum
           255-15|Rep: Helicase, C-terminal:DEAD/DEAH box helicase,
           N-terminal - Exiguobacterium sibiricum 255-15
          Length = 391

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 31/85 (36%), Positives = 46/85 (54%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I  L+ ID +    Q +I APTREL  QI +V+         K  A IGG  +
Sbjct: 46  GKTLAYVIPALELIDENEPHIQVVITAPTRELVMQIHQVIQLFSQGSGIKSGAFIGGVEL 105

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           +    +L+    ++VGTPGR+ ++I
Sbjct: 106 KRQHERLKKKPQIIVGTPGRLVELI 130



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR-CF 437
           + +  + +KL VLDEAD++   G       +      D Q+  +SAT+P+   E  +  F
Sbjct: 133 KKMKMHKVKLIVLDEADQIYESGMSASATRIANSALRDRQLAFISATLPERTAEWGKTLF 192

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRME 530
             +P RI V++   T   +K  Y+   RR++
Sbjct: 193 ANEPERIKVERVMST--QVKFGYIEMSRRLK 221


>UniRef50_Q1FMF9 Cluster: Helicase-like:DbpA, RNA-binding:DEAD/DEAH
           box helicase-like; n=1; Clostridium phytofermentans
           ISDg|Rep: Helicase-like:DbpA, RNA-binding:DEAD/DEAH box
           helicase-like - Clostridium phytofermentans ISDg
          Length = 483

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 34/83 (40%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I I + I       QAL+L PTRELA Q++  +  +G     K     GG   
Sbjct: 53  GKTAAFAIPICESIVWEENLPQALVLEPTRELAYQVKDEIFNVGRMKRVKVPVVFGGFPF 112

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
            +    L+   H+VVGTPGRV D
Sbjct: 113 DKQALTLKQKSHIVVGTPGRVLD 135



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  + +K  ++DEAD ML  GF D +  +   L  ++ ++L SATM + +  ++  FM  
Sbjct: 142 LKCSNVKYVIIDEADLMLDMGFLDDVKRILSYLPENITIMLFSATMGEALYALTDEFMNS 201

Query: 447 PVRILVQKEELTLEGIKQ 500
           PV + ++    T++ I+Q
Sbjct: 202 PVEVKLEDGTETVDSIEQ 219


>UniRef50_A0VLH7 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Rhodobacteraceae|Rep: DEAD/DEAH box helicase domain
           protein - Dinoroseobacter shibae DFL 12
          Length = 508

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 32/90 (35%), Positives = 50/90 (55%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + +L  +       + R C+ LILAPTREL  QI + + A  +  + K    +
Sbjct: 120 GKTAAFGLPLLDALMKAGTKPAPRTCRGLILAPTRELVSQICESLRAFTEGSHLKLQVIV 179

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG  +   I++ E G  ++V TPGR+ D++
Sbjct: 180 GGVAIGPQIKRAERGADLIVATPGRLIDLL 209



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 29/69 (42%), Positives = 43/69 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+AL  +  +  VLDEAD+ML  GF   +  +  +L A+ Q +L SATMP  + E+SR +
Sbjct: 211 RKALRLSETRFLVLDEADQMLDLGFIHALRKIAPLLPAERQTMLFSATMPKQMEELSRAY 270

Query: 438 MRDPVRILV 464
           + DP R+ V
Sbjct: 271 LTDPARVEV 279


>UniRef50_A4RYJ1 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 407

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 39/95 (41%), Positives = 50/95 (52%), Gaps = 10/95 (10%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL--------GDHLNAKCH 156
           GKT TF +  L+++D   R  QAL LAPTRE A Q  +  + +        GD       
Sbjct: 86  GKTMTFVVIALERVDAGRRRTQALALAPTRECAVQTHECFVEMIEKFKDMDGD-ARGGIE 144

Query: 157 AC--IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            C  +GG  V+ED  +L S  HVVVGTPGR   M+
Sbjct: 145 TCLLVGGLPVKEDRARLASQPHVVVGTPGRTRQML 179



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/74 (32%), Positives = 40/74 (54%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           +L +LDEAD +LS  F+  +   + +L    QV   SAT    +L      MR P ++++
Sbjct: 190 RLLILDEADALLSGTFERDVLFAYSMLPERKQVCAFSATYSKTLLGDLERLMRAPQKVML 249

Query: 465 QKEELTLEGIKQFY 506
            +    L+G++QFY
Sbjct: 250 CESTTALQGVRQFY 263


>UniRef50_Q4QC38 Cluster: RNA helicase, putative; n=7;
           Trypanosomatidae|Rep: RNA helicase, putative -
           Leishmania major
          Length = 435

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +A     +K FV+DE D  L     +  + ++F  L  + QV++ SATM D++ +V++ F
Sbjct: 178 KAFDTTHVKWFVVDEFDRCLEDVKMRRDVQEIFMKLPKEKQVMMFSATMTDELRDVAKKF 237

Query: 438 MRDPVRILV-QKEELTLEGIKQFYMH 512
           M+D   I V Q+ +LTL G+ QFYM+
Sbjct: 238 MKDATEIYVDQRAKLTLHGLAQFYMN 263



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 12/211 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE----CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACI 165
           GKTA F  ++L+Q++   +     CQA++L   RELA QI++       +L  A      
Sbjct: 85  GKTAVFVFALLEQVEKVPQGQKPYCQAVVLVHARELAYQIEQEFKRFSKYLPYATTGVFF 144

Query: 166 GGTNVREDIRQLESGV-HVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTR 342
           GG    E+++QL+  V  ++VGTPGR+  +I    F  T   +  + +  +C  +V   R
Sbjct: 145 GGIPEDENVKQLKKEVPAIIVGTPGRMKALIQNKAFDTTHVKWFVVDEFDRCLEDVKMRR 204

Query: 343 SMMSSRFCQLMFKSYYSLLPCLM------MYWKYLDAL*EILYAYLYRRKSLPWKVLNNF 504
            +    F +L  +    +    M      +  K++    EI   Y+ +R  L    L  F
Sbjct: 205 DVQEI-FMKLPKEKQVMMFSATMTDELRDVAKKFMKDATEI---YVDQRAKLTLHGLAQF 260

Query: 505 TCIELEEWKLETLCDLYDTLSIAQAVIFCNT 597
                E  K   L ++ D +   QA+IF ++
Sbjct: 261 YMNVTEPEKTRRLAEILDVVEFNQAIIFTSS 291


>UniRef50_A2EVI2 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 598

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 29/76 (38%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +   VLDEAD+ML  GF+ QI  +   +S D Q ++ SAT P ++ +++  F+ DPV 
Sbjct: 271 NRVNFLVLDEADQMLDMGFEPQIRKIIGHISKDRQTMMFSATWPKEIQQLAADFLVDPVH 330

Query: 456 ILVQKEELTL-EGIKQ 500
           +++  ++LT    IKQ
Sbjct: 331 MIIGNKDLTTNSNIKQ 346



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 36/105 (34%), Positives = 46/105 (43%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQA-----LILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F I  +  I       +      L+L+PTRELAQQI +V     D+L  +     
Sbjct: 174 GKTAAFLIPAMVHIGLQEPMYRGDGPIVLVLSPTRELAQQIAEVAKGFCDNLMIRQTCLF 233

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL 300
           GG         L     +VV TPGR+ D I   +      NFL L
Sbjct: 234 GGAGRGPQANDLRHLPSLVVATPGRLIDFIEGGQCPMNRVNFLVL 278


>UniRef50_Q27268 Cluster: ATP-dependent RNA helicase WM6; n=82;
           Eukaryota|Rep: ATP-dependent RNA helicase WM6 -
           Drosophila melanogaster (Fruit fly)
          Length = 424

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGT 174
           GKTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG 
Sbjct: 90  GKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGM 149

Query: 175 NVREDIRQLESGV-HVVVGTPGRVYDMI 255
            +++D   L+SG  H+VVGTPGR+  +I
Sbjct: 150 AIQKDEETLKSGTPHIVVGTPGRILALI 177



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L+   +K FVLDE D+ML +   +  + ++F+      QV++ SAT+  D+  V + F
Sbjct: 180 KKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKF 239

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYMH 512
           M+DP+ + V  E +LTL G++Q Y++
Sbjct: 240 MQDPMEVYVDDEAKLTLHGLQQHYVN 265


>UniRef50_Q5T1V6 Cluster: Probable ATP-dependent RNA helicase DDX59;
           n=34; Euteleostomi|Rep: Probable ATP-dependent RNA
           helicase DDX59 - Homo sapiens (Human)
          Length = 619

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 26/76 (34%), Positives = 48/76 (63%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ V+DEAD ML  GF+ Q+ D+ + +  D Q IL+SAT+P  + +++   + +PVRI+
Sbjct: 347 VKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRII 406

Query: 462 VQKEELTLEGIKQFYM 509
             ++ L    ++Q  +
Sbjct: 407 TGEKNLPCANVRQIIL 422



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + ++ +     +   ALIL PTRELA QI++    L   L   K    +GG  
Sbjct: 252 GKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLP 311

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   + +L+  V V++ TPGR+ D+I
Sbjct: 312 LPPQLYRLQQHVKVIIATPGRLLDII 337


>UniRef50_Q7RYZ7 Cluster: ATP-dependent RNA helicase dbp-8; n=15;
           Pezizomycotina|Rep: ATP-dependent RNA helicase dbp-8 -
           Neurospora crassa
          Length = 626

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 35/85 (41%), Positives = 46/85 (54%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ ILQQ   +      +IL PTRELA QI + VIAL      K     GG ++
Sbjct: 244 GKTVAFAVPILQQWAANPSAIFGVILTPTRELALQIMEQVIALSQPHVLKAVLITGGADM 303

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           R+    L    H+V+ TPGR+ D I
Sbjct: 304 RKQAIDLAKRPHLVIATPGRLADHI 328


>UniRef50_UPI0000DB7226 Cluster: PREDICTED: similar to Probable
           ATP-dependent RNA helicase DDX20 (DEAD box protein 20)
           (DEAD box protein DP 103) (Component of gems 3)
           (Gemin-3); n=1; Apis mellifera|Rep: PREDICTED: similar
           to Probable ATP-dependent RNA helicase DDX20 (DEAD box
           protein 20) (DEAD box protein DP 103) (Component of gems
           3) (Gemin-3) - Apis mellifera
          Length = 648

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 34/86 (39%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKT  F I  L+ ID  I   Q LILAPTRE+A QI +V  ++G  + + K    IGG  
Sbjct: 45  GKTLVFCIISLEMIDIDISSVQVLILAPTREIAVQIAQVFSSVGCEIKDLKVEVFIGGLA 104

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +  D +++ +   + VG PGR+  +I
Sbjct: 105 IENDKKKV-NNCQIAVGAPGRIRHLI 129



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/79 (36%), Positives = 43/79 (54%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L    ++LFVLDEAD+++   F+  I+ +F  L    QVI  SAT P D+    + +M  
Sbjct: 134 LKVENVRLFVLDEADKLMETSFQKDINYIFSKLPLSKQVIASSATYPGDLEIFLQTYMCS 193

Query: 447 PVRILVQKEELTLEGIKQF 503
           PV +     E  L G++QF
Sbjct: 194 PVLVSPNNNEPILIGLRQF 212


>UniRef50_Q44NG9 Cluster: Helicase, C-terminal:DEAD/DEAH box
           helicase, N-terminal; n=9; Bacteroidetes/Chlorobi
           group|Rep: Helicase, C-terminal:DEAD/DEAH box helicase,
           N-terminal - Chlorobium limicola DSM 245
          Length = 499

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT-----SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F+I +LQ ++        R+ ++LI+ PTRELA QI +   A G H         
Sbjct: 131 GKTAAFAIPVLQLLNAVKTNEKKRKIRSLIITPTRELAIQIGESFKAYGRHTGLTSTVIF 190

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG N       L+ G+ +++ TPGR+ D++
Sbjct: 191 GGVNQNPQTASLQKGIDILIATPGRLLDLM 220



 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS---ADVQVILLSATMPDDVLEVSRCF 437
           LH   I+ FVLDEAD ML  GF   IHD+ KIL+      Q +  SATMP ++  ++   
Sbjct: 225 LHLRNIEFFVLDEADRMLDMGF---IHDIRKILAELPKKKQSLFFSATMPPEITRLAASI 281

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           + +PV + V     T+E I Q
Sbjct: 282 LHNPVEVSVTPVSSTVEIINQ 302


>UniRef50_Q1IMK6 Cluster: DEAD/DEAH box helicase-like; n=1;
           Acidobacteria bacterium Ellin345|Rep: DEAD/DEAH box
           helicase-like - Acidobacteria bacterium (strain
           Ellin345)
          Length = 423

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 36/84 (42%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKT  F I  L+ + DT     Q LIL PTRELA Q+  V   L           +GGT+
Sbjct: 76  GKTLAFIIPALEMLRDTEPCGVQVLILVPTRELAMQVHGVYEQLKGKKLKSAALVMGGTS 135

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
            R  I+ + SG  VVV TPGR+ D
Sbjct: 136 ERNQIQSIRSGARVVVATPGRLED 159



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 249 YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVS 428
           Y  RR +  + +++ VLDEAD M+  GF   I  + + L  D Q +  SATM   V  + 
Sbjct: 160 YMGRRLVDLSQVEMLVLDEADRMMDMGFLPAIKRILRALPRDKQTLCFSATMGPAVSGIV 219

Query: 429 RCFMRDPVRI 458
           +  + + VR+
Sbjct: 220 QDCLYNAVRV 229


>UniRef50_A0UX17 Cluster: DEAD/DEAH box helicase-like; n=5;
           Clostridium|Rep: DEAD/DEAH box helicase-like -
           Clostridium cellulolyticum H10
          Length = 437

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQI--QKVVIALGDHLNAKCHACIGGT 174
           GKT  + + +  ++    +E QALIL PT ELA Q+  Q  +++    + A     IG  
Sbjct: 52  GKTLAYLLPLFMKLSAEKKEMQALILVPTHELAIQVVRQIELLSQNSEIKATSTPIIGDV 111

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
           N+   I +L+   H++VGTPGR+ ++I
Sbjct: 112 NIMRQIDKLKLKPHIIVGTPGRILELI 138



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/83 (27%), Positives = 44/83 (53%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +R + A+TIK  ++DEAD +L     D I  + K    + Q+++ SAT+    +E +   
Sbjct: 140 KRKISAHTIKTIIIDEADRLLDDYNLDNIKAIIKTTLKERQIVMCSATISKKTVERAMPL 199

Query: 438 MRDPVRILVQKEELTLEGIKQFY 506
           M++P+ I  + +    + I+  Y
Sbjct: 200 MKEPLVIESKADMGVPDAIEHLY 222


>UniRef50_A3AD37 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 552

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQA-------LILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT  F +  L  +   + E  A       L+L+PTRELAQQI  V+   G         
Sbjct: 141 GKTIAFGVPALMHVRRKMGEKSAKKGVPRVLVLSPTRELAQQIADVLCEAGAPCGISSVC 200

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
             GGT+    I  L+SGV +V+GTPGR+ D+I
Sbjct: 201 LYGGTSKGPQISALKSGVDIVIGTPGRMKDLI 232



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/69 (31%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPV 452
           N +   VLDEAD ML  GF+ ++  +    ++  Q ++ SAT P  V ++++ FM  +P+
Sbjct: 303 NDVSFVVLDEADRMLDMGFEPEVRAILSQTASVRQTVMFSATWPPAVHQLAQEFMDPNPI 362

Query: 453 RILVQKEEL 479
           ++++  E+L
Sbjct: 363 KVVIGSEDL 371



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = +1

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT+    I  L+SGV +V+GTPGR+ D+I
Sbjct: 266 GGTSKGPQISALKSGVDIVIGTPGRMKDLI 295


>UniRef50_Q22308 Cluster: Putative uncharacterized protein; n=7;
            Bilateria|Rep: Putative uncharacterized protein -
            Caenorhabditis elegans
          Length = 1022

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 59/214 (27%), Positives = 99/214 (46%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1    GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
            GKTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N
Sbjct: 669  GKTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGN 728

Query: 178  VREDIRQLESGVHVVVGTPGRVYDMILVVRFM-PTPSNFLFL-----MKLMKCCPEVSRT 339
            +   +R  +    +V+GTPG   D +   + + P+    L L     M   +   ++S T
Sbjct: 729  MAA-MRGRKLTEQIVIGTPGITRDYLQKYKCIDPSKIRCLVLDEADVMIYHQGFTDISTT 787

Query: 340  RSMM----SSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFT 507
               M    S     ++F + Y   P +    K +      +   L R +     +   + 
Sbjct: 788  IYNMVEDASDSVQSMLFSATYD-EPVINFATKIIK---NAIVVMLKREEQALPNIKQFYV 843

Query: 508  CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
                 + K   + +LY  L++A +VIFC+T+  V
Sbjct: 844  QCACRDSKYAAIVNLYSGLAVASSVIFCHTKASV 877



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 4/87 (4%)
 Frame = +3

Query: 261  RALHANTIKLFVLDEADEML-SRGFKD---QIHDVFKILSADVQVILLSATMPDDVLEVS 428
            + +  + I+  VLDEAD M+  +GF D    I+++ +  S  VQ +L SAT  + V+  +
Sbjct: 757  KCIDPSKIRCLVLDEADVMIYHQGFTDISTTIYNMVEDASDSVQSMLFSATYDEPVINFA 816

Query: 429  RCFMRDPVRILVQKEELTLEGIKQFYM 509
               +++ + +++++EE  L  IKQFY+
Sbjct: 817  TKIIKNAIVVMLKREEQALPNIKQFYV 843


>UniRef50_Q56XG6 Cluster: DEAD-box ATP-dependent RNA helicase 15;
           n=27; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           15 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 427

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 37/84 (44%), Positives = 50/84 (59%), Gaps = 3/84 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N
Sbjct: 95  GKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVN 154

Query: 178 VR--EDIRQLESGVHVVVGTPGRV 243
           ++  +D+ + E   H+VVGTPGRV
Sbjct: 155 IKIHKDLLKNEC-PHIVVGTPGRV 177



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L    ++ F+LDE D+ML S   +  + ++FK+   D QV++ SAT+  ++  V + FM+
Sbjct: 186 LSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQ 245

Query: 444 DPVRILVQKE-ELTLEGIKQFYM 509
           DP+ I V  E +LTL G+ Q Y+
Sbjct: 246 DPMEIYVDDEAKLTLHGLVQHYI 268


>UniRef50_Q5KME7 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Filobasidiella neoformans|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 1072

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 52/90 (57%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI----DTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + +L+ +      S  E   A++++PTRELA QI K        LN +   C+
Sbjct: 452 GKTVAFLLPMLRHVRDQRPVSGSEGPIAVVMSPTRELASQIYKECQPFLKVLNIRASCCV 511

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG+++ EDI  ++ G  VV+ TPGR+ D++
Sbjct: 512 GGSSISEDIAAMKKGAEVVICTPGRMIDLL 541



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 24/95 (25%), Positives = 39/95 (41%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  +  R  +       V+DEAD M   GF+ Q+  +   +    Q +L S
Sbjct: 532 CTPGRMIDLLTANNGRVTNVRRTTYIVMDEADRMFDMGFEPQVMKIINNVRPSAQKVLFS 591

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  +  P+ I V    +    I Q
Sbjct: 592 ATFPKTMESLARRILVKPLEITVGGRSVVAPEIDQ 626


>UniRef50_Q9K7L3 Cluster: RNA helicase; n=2; Bacillus|Rep: RNA
           helicase - Bacillus halodurans
          Length = 389

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + + +L + +    + QALILAPT+ELA QI +V   L    +      IGG N+
Sbjct: 51  GKTLAYLLPMLTKTEELPEQTQALILAPTQELAMQIVEVAKQLTATTSITVLPLIGGANI 110

Query: 181 REDIRQL-ESGVHVVVGTPGRVYDMI 255
           +  + +L +   HV VGTPGR+ +++
Sbjct: 111 KRQVEKLKKKKPHVAVGTPGRILELM 136


>UniRef50_Q7VFA9 Cluster: ATP-dependent RNA helicase DeaD; n=6;
           Helicobacteraceae|Rep: ATP-dependent RNA helicase DeaD -
           Helicobacter hepaticus
          Length = 530

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 31/83 (37%), Positives = 48/83 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F+I IL  ++ + ++ +ALI+ PTRELA QI + ++ LG     K     GG ++
Sbjct: 94  GKTAAFAIPILNTLNRN-KDIEALIITPTRELAMQISEEILKLGRFGRIKTICMYGGQSI 152

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
           +     LE     ++ TPGR+ D
Sbjct: 153 KRQCDLLEKKPKAMIATPGRLLD 175



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 27/74 (36%), Positives = 45/74 (60%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           ++ VLDE+DEML  GF D I ++FK L    Q +L SATMP+ +  ++   + +P  + +
Sbjct: 188 QIVVLDESDEMLDMGFLDDIEEIFKFLPNTRQTLLFSATMPEPIKALAMKILNEPAFVKI 247

Query: 465 QKEELTLEGIKQFY 506
              ++T + I+Q Y
Sbjct: 248 TPTDVTNQDIEQQY 261


>UniRef50_Q62IF8 Cluster: ATP-dependent RNA helicase RhlE; n=59;
           Betaproteobacteria|Rep: ATP-dependent RNA helicase RhlE
           - Burkholderia mallei (Pseudomonas mallei)
          Length = 482

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQ----QIDTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA+FS+ I+Q    Q +TS    +    ALIL PTRELA Q+   V A   H   +  
Sbjct: 60  GKTASFSLPIIQRLLPQANTSASPARHPVRALILTPTRELADQVAANVHAYAKHTPLRSA 119

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              GG ++   + +L  GV +++ TPGR+ D +
Sbjct: 120 VVFGGVDMNPQMAELRRGVEILIATPGRLLDHV 152



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/81 (25%), Positives = 42/81 (51%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++  +   +++ VLDEAD ML  GF   +  +  +L  + Q +L SAT   ++ +++  +
Sbjct: 154 QKTANLGQVQILVLDEADRMLDMGFLPDLQRILNLLPKERQTLLFSATFSPEIKKLASTY 213

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           +R+P  I V +       + Q
Sbjct: 214 LRNPQTIEVARSNAAASTVTQ 234


>UniRef50_Q4AEL1 Cluster: Helicase, C-terminal:DEAD/DEAH box
           helicase, N-terminal; n=1; Chlorobium phaeobacteroides
           BS1|Rep: Helicase, C-terminal:DEAD/DEAH box helicase,
           N-terminal - Chlorobium phaeobacteroides BS1
          Length = 356

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDV-LEVSRC 434
           R  L  + +K  VLDEADEM++ GFK +I ++ K     +  +L +ATMP DV L +   
Sbjct: 37  RGVLSLDDLKYLVLDEADEMINMGFKAEIDEILKSCKPAITKLLFTATMPKDVKLLIEEY 96

Query: 435 FMRDPVRILVQKEELTLEGIKQFYM 509
            + D   I + KEEL  E I+ + +
Sbjct: 97  LVADASEIRINKEELVNEKIQHYLL 121



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +1

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           A  GG  + + I++L+   HVVV TPGR+ D++
Sbjct: 3   AVYGGAPIDDQIQKLKRATHVVVATPGRLIDLL 35


>UniRef50_Q41FS1 Cluster: IMP dehydrogenase/GMP reductase:Helicase,
           C-terminal:DEAD/DEAH box helicase, N-terminal; n=1;
           Exiguobacterium sibiricum 255-15|Rep: IMP
           dehydrogenase/GMP reductase:Helicase,
           C-terminal:DEAD/DEAH box helicase, N-terminal -
           Exiguobacterium sibiricum 255-15
          Length = 450

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 31/88 (35%), Positives = 54/88 (61%), Gaps = 4/88 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQI----QKVVIALGDHLNAKCHACIG 168
           GKT +F + I+Q ++  ++E QA+I+APTRELA QI    + +++   D++  K     G
Sbjct: 51  GKTLSFLLPIVQNVNPELQEMQAIIVAPTRELAWQIHEELKSILVKQPDYI--KTSLITG 108

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDM 252
           G +    I +++    +V+GTPGR+ D+
Sbjct: 109 GMDRERQIGRVKVSPQIVIGTPGRILDL 136



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/78 (28%), Positives = 46/78 (58%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           +AL  + +K +++DEAD+ML  GF  ++  + + L   +Q+++ SAT+P+ +    + +M
Sbjct: 140 QALKPHFVKHYIIDEADQMLDMGFLPEVDRIAQALPEKLQMMVFSATIPEKLQPFLKKYM 199

Query: 441 RDPVRILVQKEELTLEGI 494
            +P    V  ++ T + I
Sbjct: 200 NNPRYAHVDPKQQTAKKI 217


>UniRef50_Q0M1B5 Cluster: Helicase-like:DEAD/DEAH box helicase-like;
           n=11; Alphaproteobacteria|Rep: Helicase-like:DEAD/DEAH
           box helicase-like - Caulobacter sp. K31
          Length = 678

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/73 (38%), Positives = 42/73 (57%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++  V+DEAD ML  GF   I  +FK+     Q +  SATMP ++  +++ F++DPVRI 
Sbjct: 148 VQFLVVDEADRMLDMGFIPDIERIFKMTPPKKQTLFFSATMPPEITRLTKQFLKDPVRIE 207

Query: 462 VQKEELTLEGIKQ 500
             +   T E I Q
Sbjct: 208 ASRPATTNENITQ 220



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 8/136 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ ++ ++       R  +AL++APTRELA Q+                  IGG
Sbjct: 51  GKTAAFTLPLIDKLMNGRAKARMPRALVIAPTRELADQVASSFEKYAKGTKLSWALLIGG 110

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCCPEVSR 336
            +  +  ++L+ GV V++ TPGR+ D     + + T   FL +     M  M   P++ R
Sbjct: 111 VSFGDQEKKLDRGVDVLIATPGRLLDHFERGKLLMTGVQFLVVDEADRMLDMGFIPDIER 170

Query: 337 TRSMMSSRFCQLMFKS 384
              M   +   L F +
Sbjct: 171 IFKMTPPKKQTLFFSA 186


>UniRef50_A6NSW7 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 400

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 34/84 (40%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGTN 177
           GKT  F I +++ ID      QAL+LAPTRELA QIQ  +  L +        C+ GG  
Sbjct: 61  GKTFAFGIPMVEHIDPESDAVQALVLAPTRELALQIQDELRDLCEFKEGVRSVCLYGGAP 120

Query: 178 VREDIRQLESGVHVVVGTPGRVYD 249
           + + I  L+    +VV TPGR+ D
Sbjct: 121 IEKQITTLKKHPQIVVATPGRLMD 144



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 3/85 (3%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL---SADVQVILLSATMPDDVLEVS 428
           RR +  + ++  VLDEAD ML  GF   IHDV +IL    +   + L SAT+  +V+++S
Sbjct: 148 RRTVKLDKVETVVLDEADRMLDMGF---IHDVTRILDQIKSRKNLGLFSATISREVMDIS 204

Query: 429 RCFMRDPVRILVQKEELTLEGIKQF 503
             + RDPV I+V+ +E     I+Q+
Sbjct: 205 WVYQRDPVEIVVRPDEENKPDIQQY 229


>UniRef50_A6GPV2 Cluster: Helicase; n=1; Limnobacter sp. MED105|Rep:
           Helicase - Limnobacter sp. MED105
          Length = 539

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 55/213 (25%), Positives = 92/213 (43%), Gaps = 13/213 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE--------CQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA FS+ IL ++     E         +ALIL PTRELA Q+   V         +  
Sbjct: 69  GKTAGFSLPILNRLMPLATENTSPARHPVRALILTPTRELADQVAANVHTYAKFTPLRST 128

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL-----MKLMKCC 321
              GG ++   I+ L  GV +V+ TPGR+ D +            L L     M  M   
Sbjct: 129 VVYGGVDINPQIQTLRRGVELVIATPGRLLDHVQQKSINLGQVQVLVLDEADRMLDMGFL 188

Query: 322 PEVSRTRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN 501
           P++ R  +++      L+F + +S  P +    K       ++   + RR +    +   
Sbjct: 189 PDLQRIINLLPKTRQNLLFSATFS--PEIQKLAKSFMVSPTLI--EVARRNATSENIKQV 244

Query: 502 FTCIELEEWKLETLCDLYDTLSIAQAVIFCNTR 600
              ++ EE K   +C L  + +++Q ++F NT+
Sbjct: 245 IFALDSEEDKRMAVCHLIQSKALSQVIVFSNTK 277



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 26/81 (32%), Positives = 45/81 (55%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           +++++   +++ VLDEAD ML  GF   +  +  +L    Q +L SAT   ++ ++++ F
Sbjct: 163 QKSINLGQVQVLVLDEADRMLDMGFLPDLQRIINLLPKTRQNLLFSATFSPEIQKLAKSF 222

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           M  P  I V +   T E IKQ
Sbjct: 223 MVSPTLIEVARRNATSENIKQ 243


>UniRef50_Q4QJG6 Cluster: ATP-dependent RNA helicase, putative; n=3;
           Leishmania|Rep: ATP-dependent RNA helicase, putative -
           Leishmania major
          Length = 625

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 32/87 (36%), Positives = 46/87 (52%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ ILQ +        AL+L P+RELA QI    IA G  L  +    +GG   
Sbjct: 51  GKTAAFALPILQTLAADAYGVFALVLTPSRELAYQIIDQFIAFGAPLRVRTMLAVGGVPT 110

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILV 261
              +  L++  H+V  TPGR+  ++ V
Sbjct: 111 ETQVDALKARPHIVAATPGRLRHLLEV 137


>UniRef50_Q2LZJ8 Cluster: GA19670-PA; n=1; Drosophila
           pseudoobscura|Rep: GA19670-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1007

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  + ++ LQ    S +  + L++ PTRELA Q+  +   LG+ L + K  + +GGT+
Sbjct: 74  GKTLIYVVTALQMCSLSTQHPEVLVILPTRELALQVHDIFRFLGEKLRSFKVSSFMGGTD 133

Query: 178 VREDIRQLESGVHVVVGTPGRVYDM 252
           V  D  +L +  HV +GTPGR+  +
Sbjct: 134 VTRDREKLRN-CHVAIGTPGRLLQL 157



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEM-LSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+ + +KL VLDEAD++ ++   +  ++ +  +L    QVI  SAT   ++ E     M 
Sbjct: 163 LNMSMVKLLVLDEADQLYVTASLQKTVNALIAVLPLQRQVIACSATFDQNLDEKIAKMME 222

Query: 444 DPVRILVQKEELTLEGIKQF 503
            PV I   +    L GI+QF
Sbjct: 223 KPVLISNSERATVLLGIRQF 242


>UniRef50_Q9ZRZ8 Cluster: DEAD-box ATP-dependent RNA helicase 28;
           n=5; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 28 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 789

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++  L+++      +   + LIL PTRELA QI  ++  L    + KC   +GG
Sbjct: 216 GKTAAFALPTLERLLFRPKRVFATRVLILTPTRELAVQIHSMIQNLAQFTDIKCGLIVGG 275

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +VRE    L S   +VV TPGR+ D
Sbjct: 276 LSVREQEVVLRSMPDIVVATPGRMID 301



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/86 (27%), Positives = 44/86 (51%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           + + +LDEAD +L  GF  +I ++ ++     Q +L SATM ++V E+ +  +  P+R+ 
Sbjct: 314 LAVLILDEADRLLQTGFATEITELVRLCPKRRQTMLFSATMTEEVKELVKLSLNKPLRLS 373

Query: 462 VQKEELTLEGIKQFYMH*IRRMEAGN 539
                    G+ +  +  IRR    N
Sbjct: 374 ADPSARRPPGLTEEVVR-IRRTREAN 398


>UniRef50_Q5KNF8 Cluster: Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28; n=1; Filobasidiella neoformans|Rep:
           Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 738

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 37/93 (39%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI--------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA F I +L  I        D       ALI+APTRELAQQI+         L  KC 
Sbjct: 364 GKTAAFVIPMLDYIGHLPPLNDDNRHLGPYALIMAPTRELAQQIETETRRFALPLGYKCV 423

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           + +GG +V E    L  G  +++ TPGR+ DM+
Sbjct: 424 SIVGGRSVEEQQFALRDGAEIIIATPGRLKDMV 456


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 833,952,092
Number of Sequences: 1657284
Number of extensions: 17983823
Number of successful extensions: 49906
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 45775
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49256
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63792713725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).