SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000DB6F49 Cluster: PREDICTED: similar to CG3168-PA,...    71   3e-11
UniRef50_UPI0000D557E0 Cluster: PREDICTED: similar to CG3168-PA,...    71   3e-11
UniRef50_UPI0000DB71C1 Cluster: PREDICTED: similar to CG3690-PA;...    60   6e-08
UniRef50_UPI00015B53E2 Cluster: PREDICTED: similar to EG:BACR7A4...    55   2e-06
UniRef50_UPI00015B62A6 Cluster: PREDICTED: similar to synaptic v...    54   4e-06
UniRef50_UPI0000D555BF Cluster: PREDICTED: similar to CG3690-PA;...    54   4e-06
UniRef50_Q7QES5 Cluster: ENSANGP00000019864; n=6; Endopterygota|...    54   5e-06
UniRef50_Q171X0 Cluster: Synaptic vesicle protein; n=2; Culicida...    54   5e-06
UniRef50_UPI0000D555C0 Cluster: PREDICTED: similar to CG14691-PB...    52   1e-05
UniRef50_Q9W3W9 Cluster: CG3168-PA, isoform A; n=8; Endopterygot...    52   1e-05
UniRef50_Q293R0 Cluster: GA13180-PA; n=1; Drosophila pseudoobscu...    52   2e-05
UniRef50_Q9V3J5 Cluster: EG:BACR7A4.13 protein; n=1; Drosophila ...    51   4e-05
UniRef50_Q9VGX6 Cluster: CG31272-PA; n=3; Sophophora|Rep: CG3127...    49   1e-04
UniRef50_Q7QA97 Cluster: ENSANGP00000013027; n=6; Endopterygota|...    49   1e-04
UniRef50_Q16HW1 Cluster: Synaptic vesicle protein; n=3; Culicida...    49   1e-04
UniRef50_Q6U1H1 Cluster: SV2-like protein 2; n=1; Ctenocephalide...    49   2e-04
UniRef50_UPI00015B5826 Cluster: PREDICTED: similar to synaptic v...    48   2e-04
UniRef50_UPI0000D557DE Cluster: PREDICTED: similar to CG15221-PA...    48   2e-04
UniRef50_Q1DH26 Cluster: Synaptic vesicle protein; n=1; Aedes ae...    48   4e-04
UniRef50_Q4SLU3 Cluster: Chromosome 13 SCAF14555, whole genome s...    47   5e-04
UniRef50_UPI0000DB6C4B Cluster: PREDICTED: similar to CG3690-PA;...    47   6e-04
UniRef50_UPI0000D557DF Cluster: PREDICTED: similar to CG31106-PA...    46   0.001
UniRef50_Q9VGX7 Cluster: CG14691-PA, isoform A; n=2; Drosophila ...    46   0.001
UniRef50_Q13MY9 Cluster: Major facilitator superfamily (MFS) met...    45   0.003
UniRef50_Q17M95 Cluster: Synaptic vesicle protein; n=4; Culicida...    45   0.003
UniRef50_UPI0000E46F01 Cluster: PREDICTED: similar to ankyrin 2,...    44   0.003
UniRef50_Q1AUV3 Cluster: Major facilitator superfamily MFS_1; n=...    44   0.003
UniRef50_Q7XPE1 Cluster: OSJNBa0060N03.20 protein; n=3; Liliopsi...    43   0.008
UniRef50_Q8N4V2 Cluster: Synaptic vesicle 2-related protein; n=3...    43   0.008
UniRef50_Q2C3U3 Cluster: L-fucose permease; n=2; Vibrionaceae|Re...    43   0.010
UniRef50_Q04H25 Cluster: Permease of the major facilitator super...    43   0.010
UniRef50_Q16U92 Cluster: Putative uncharacterized protein; n=1; ...    43   0.010
UniRef50_P30638 Cluster: Putative transporter ZK637.1; n=3; Bila...    43   0.010
UniRef50_UPI0000DB7CA4 Cluster: PREDICTED: similar to CG3168-PA,...    42   0.013
UniRef50_Q4RSX3 Cluster: Chromosome 12 SCAF14999, whole genome s...    42   0.024
UniRef50_UPI00015A542A Cluster: Synaptic vesicle glycoprotein 2B...    41   0.031
UniRef50_A6SWT4 Cluster: Transporter of the MFS superfamily; n=3...    41   0.041
UniRef50_Q0KDB6 Cluster: MFS transporter, AAHS family; n=2; Bact...    40   0.054
UniRef50_Q8IMT7 Cluster: CG31106-PA; n=2; Drosophila melanogaste...    40   0.054
UniRef50_A4QYX5 Cluster: Putative uncharacterized protein; n=1; ...    40   0.072
UniRef50_Q8SYM5 Cluster: RE53026p; n=5; Endopterygota|Rep: RE530...    40   0.095
UniRef50_Q7L0J3 Cluster: Synaptic vesicle glycoprotein 2A; n=74;...    40   0.095
UniRef50_UPI0000E463D0 Cluster: PREDICTED: hypothetical protein;...    39   0.13 
UniRef50_Q9LSH7 Cluster: Transporter-like protein; n=3; core eud...    39   0.13 
UniRef50_Q940M4 Cluster: AT3g13050/MGH6_16; n=11; Magnoliophyta|...    39   0.13 
UniRef50_Q16LN8 Cluster: Synaptic vesicle protein; n=3; Aedes ae...    39   0.13 
UniRef50_A7S8U6 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.13 
UniRef50_Q17HA7 Cluster: Synaptic vesicle protein; n=2; Aedes ae...    39   0.17 
UniRef50_Q62CI0 Cluster: Major facilitator family transporter; n...    38   0.22 
UniRef50_Q1GSZ9 Cluster: Major facilitator superfamily MFS_1; n=...    38   0.29 
UniRef50_A2WN94 Cluster: Putative uncharacterized protein; n=2; ...    38   0.29 
UniRef50_Q9VBV9 Cluster: CG31103-PA; n=2; Sophophora|Rep: CG3110...    38   0.29 
UniRef50_Q0UI23 Cluster: Putative uncharacterized protein; n=2; ...    38   0.29 
UniRef50_Q21QS4 Cluster: Major facilitator superfamily MFS_1; n=...    38   0.38 
UniRef50_Q8IHA7 Cluster: AT19445p; n=3; Sophophora|Rep: AT19445p...    38   0.38 
UniRef50_UPI0000DB77DF Cluster: PREDICTED: similar to synaptic v...    37   0.51 
UniRef50_Q04DE2 Cluster: D-xylose proton-symporter; n=2; Oenococ...    37   0.51 
UniRef50_Q9FKI8 Cluster: Transporter-like protein; n=4; core eud...    37   0.67 
UniRef50_Q8RWN2 Cluster: Transporter-like protein; n=39; Magnoli...    37   0.67 
UniRef50_Q2TXH4 Cluster: Predicted transporter; n=2; Eurotiomyce...    37   0.67 
UniRef50_Q18WV9 Cluster: Major facilitator superfamily MFS_1; n=...    36   0.89 
UniRef50_Q6FBB3 Cluster: Putative benzoate transport protein; n=...    36   1.2  
UniRef50_Q1MR37 Cluster: Permeases of the major facilitator supe...    36   1.2  
UniRef50_Q5KES1 Cluster: Membrane transporter, putative; n=1; Fi...    36   1.2  
UniRef50_A3H9U8 Cluster: Major facilitator superfamily MFS_1; n=...    36   1.2  
UniRef50_P39352 Cluster: Putative metabolite transport protein y...    36   1.2  
UniRef50_Q4S265 Cluster: Chromosome undetermined SCAF14764, whol...    36   1.5  
UniRef50_A1G7D6 Cluster: Major facilitator superfamily MFS_1; n=...    36   1.5  
UniRef50_Q2QY47 Cluster: Major facilitator superfamily antiporte...    36   1.5  
UniRef50_Q2RAW1 Cluster: Major facilitator superfamily antiporte...    35   2.0  
UniRef50_Q010B9 Cluster: Synaptic vesicle transporter SVOP and r...    35   2.0  
UniRef50_A3C1G7 Cluster: Putative uncharacterized protein; n=2; ...    35   2.0  
UniRef50_Q01QX5 Cluster: Major facilitator superfamily MFS_1 pre...    35   2.7  
UniRef50_A7QAK9 Cluster: Chromosome undetermined scaffold_71, wh...    35   2.7  
UniRef50_Q5C1K3 Cluster: SJCHGC03275 protein; n=1; Schistosoma j...    35   2.7  
UniRef50_A4IYD6 Cluster: Sugar transporter, MFS family; n=8; Fra...    34   3.6  
UniRef50_Q55CP7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.6  
UniRef50_A7S4N1 Cluster: Predicted protein; n=1; Nematostella ve...    34   3.6  
UniRef50_Q0V3Q6 Cluster: Putative uncharacterized protein; n=1; ...    34   3.6  
UniRef50_Q8N434 Cluster: Putative transporter SVOPL; n=20; Tetra...    34   3.6  
UniRef50_A6T5G3 Cluster: General substrate transporter; n=1; Kle...    34   4.7  
UniRef50_A5FUB9 Cluster: General substrate transporter; n=2; Aci...    34   4.7  
UniRef50_Q0UV31 Cluster: Putative uncharacterized protein; n=2; ...    34   4.7  
UniRef50_A7EFW7 Cluster: Putative uncharacterized protein; n=2; ...    34   4.7  
UniRef50_UPI00015B613F Cluster: PREDICTED: similar to conserved ...    33   6.2  
UniRef50_UPI0000510225 Cluster: COG0477: Permeases of the major ...    33   6.2  
UniRef50_A3K375 Cluster: Major facilitator family transporter; n...    33   6.2  
UniRef50_A0C0D9 Cluster: Chromosome undetermined scaffold_14, wh...    33   6.2  
UniRef50_P94131 Cluster: Cis,cis-muconate transport protein; n=1...    33   6.2  
UniRef50_UPI0000382FC8 Cluster: COG0477: Permeases of the major ...    33   8.3  
UniRef50_Q4T8G6 Cluster: Chromosome undetermined SCAF7793, whole...    33   8.3  
UniRef50_Q39AY6 Cluster: Major facilitator superfamily (MFS_1) t...    33   8.3  
UniRef50_Q7KV86 Cluster: CG33234-PA; n=2; Drosophila melanogaste...    33   8.3  
UniRef50_A0DIL7 Cluster: Chromosome undetermined scaffold_52, wh...    33   8.3  
UniRef50_A6R1F2 Cluster: Predicted protein; n=1; Ajellomyces cap...    33   8.3  

>UniRef50_UPI0000DB6F49 Cluster: PREDICTED: similar to CG3168-PA,
           isoform A, partial; n=1; Apis mellifera|Rep: PREDICTED:
           similar to CG3168-PA, isoform A, partial - Apis
           mellifera
          Length = 488

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 29/57 (50%), Positives = 41/57 (71%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           F   G QN I +Y+LP+A C+L LT+ Q GL+N++F+ GGV S+ FWGI  D +GR+
Sbjct: 49  FLCVGCQNGINAYILPSAECDLNLTSEQKGLLNVSFLLGGVISSLFWGIFADAYGRR 105



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R +NGF IG P +LV+TYL +    K+R   +  VG  +            ++IP
Sbjct: 135 RGLNGFFIGAPGSLVYTYLGEFHAQKQRAKAICYVGFFWTLSWLILPGLAWIIIP 189


>UniRef50_UPI0000D557E0 Cluster: PREDICTED: similar to CG3168-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG3168-PA, isoform A - Tribolium castaneum
          Length = 520

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 28/66 (42%), Positives = 44/66 (66%)
 Frame = +2

Query: 230 ECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVG 409
           E F +  +   + G QN + +Y+LPAA+CEL LT++Q  L+N+ F+ GG  S+F WG++ 
Sbjct: 27  EAFTACAICIISVGFQNGLSAYILPAAQCELDLTSFQLSLLNVCFLVGGALSSFLWGVLA 86

Query: 410 DVFGRK 427
           D  GR+
Sbjct: 87  DARGRR 92



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 16/58 (27%), Positives = 29/58 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIPFKI 687
           R +NGF+IG P +++F+YL++    K R   +   G+ F            +++P  I
Sbjct: 122 RFLNGFLIGAPGSIIFSYLAEFQPPKYRSAIICYSGIFFTSSWLLLPLLAWLILPIDI 179


>UniRef50_UPI0000DB71C1 Cluster: PREDICTED: similar to CG3690-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG3690-PA -
           Apis mellifera
          Length = 541

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 25/56 (44%), Positives = 37/56 (66%)
 Frame = +2

Query: 260 FASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           F+S   +  +SYVLP+A C+L LT +  GL+N    +G + ++FFWG + D FGRK
Sbjct: 58  FSSIFSSSAISYVLPSAECDLGLTMFDKGLLNSMTFAGMICTSFFWGFMTDTFGRK 113


>UniRef50_UPI00015B53E2 Cluster: PREDICTED: similar to
           EG:BACR7A4.13; n=3; Nasonia vitripennis|Rep: PREDICTED:
           similar to EG:BACR7A4.13 - Nasonia vitripennis
          Length = 544

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 25/64 (39%), Positives = 40/64 (62%)
 Frame = +2

Query: 236 FRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDV 415
           F +V    +AS + +  MS +LP+A C+LQL+ +  G++N    +G V+SA  WG + DV
Sbjct: 45  FLAVIPASWASVLDSSNMSMILPSAECDLQLSLFHKGILNGITYAGMVSSALIWGFIADV 104

Query: 416 FGRK 427
            GR+
Sbjct: 105 MGRR 108


>UniRef50_UPI00015B62A6 Cluster: PREDICTED: similar to synaptic
           vesicle protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to synaptic vesicle protein - Nasonia
           vitripennis
          Length = 470

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 21/56 (37%), Positives = 33/56 (58%)
 Frame = +2

Query: 260 FASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           ++S       S ++P+  C+L LT +Q G++N    +G V+SA  WG + D FGRK
Sbjct: 55  WSSSFDTSTTSMIIPSTECDLNLTLFQKGVLNAIVYAGMVSSALMWGFIADAFGRK 110


>UniRef50_UPI0000D555BF Cluster: PREDICTED: similar to CG3690-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG3690-PA - Tribolium castaneum
          Length = 533

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 41/182 (22%), Positives = 72/182 (39%), Gaps = 3/182 (1%)
 Frame = +2

Query: 260 FASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXX 439
           ++S  +   MSYV PAA+C+L LT    G +N     G ++SAF WG + D  GRK    
Sbjct: 59  WSSIFETTTMSYVFPAAQCDLSLTLENKGFLNAITYIGMISSAFVWGYLCDTLGRKKLLA 118

Query: 440 XXXXXXXXXXXXQSTVPDYRLLLQLEPSMGSL*EVQLHWSSRIYQT*LELRRDNSILAWW 619
                        ++  +  +L+ +   +G         +   Y +     R  + +   
Sbjct: 119 IGLFLDGIFVLMSASSQNATILM-IAKFLGGFIINGPFAALTTYLSEFHCARHRARIQMM 177

Query: 620 E*VLLRPGYFCLHSPGW---*FHLKSRTIQRSCQFTPWRLFLAWGSLPGFMRESGVLYLP 790
             ++   G   L    W     +L  +    S +F  W L+L   + P  +     +++P
Sbjct: 178 LGIVFSLGTVILPFVAWAVLPLNLSVKIFNDSVEFHSWNLYLCLCAFPALISSIAFIFMP 237

Query: 791 ES 796
           ES
Sbjct: 238 ES 239


>UniRef50_Q7QES5 Cluster: ENSANGP00000019864; n=6;
           Endopterygota|Rep: ENSANGP00000019864 - Anopheles
           gambiae str. PEST
          Length = 517

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 43/174 (24%), Positives = 68/174 (39%), Gaps = 3/174 (1%)
 Frame = +2

Query: 284 IMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXX 463
           +MS+VLP+A C+ ++T+   G +  A M G V  ++FWG + D  GR+            
Sbjct: 45  VMSFVLPSATCDFRMTSEDKGWLTAAPMLGMVVGSYFWGCLADTKGRRIVLIAALLLDGT 104

Query: 464 XXXXQSTVPDYRLLLQLEPSMGSL*EVQLHWSSRIYQT*LELRRDNSILAWWE*VLLRPG 643
                +T   + + + L    G      +                  IL W E +    G
Sbjct: 105 VGLLSTTAQIFPIFMFLRFINGFAITGAMGICFPYLGEFQPTAYREKILCWME-LFWTLG 163

Query: 644 YFCLHSPGW---*FHLKSRTIQRSCQFTPWRLFLAWGSLPGFMRESGVLYLPES 796
              L    W      L+  T     +F+ W LF+A  S+P  +    +LY PES
Sbjct: 164 IVVLPCIAWLIIPLPLQFGTADGGIKFSSWNLFVALCSIPSLLLGLWLLYFPES 217


>UniRef50_Q171X0 Cluster: Synaptic vesicle protein; n=2;
           Culicidae|Rep: Synaptic vesicle protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 685

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +SYVLP+A C+L L+    G +N     G ++SAF WG + D++GRK
Sbjct: 171 ISYVLPSAECDLHLSLVDKGTLNAVTYGGMISSAFLWGFLSDMYGRK 217


>UniRef50_UPI0000D555C0 Cluster: PREDICTED: similar to CG14691-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG14691-PB, isoform B - Tribolium castaneum
          Length = 138

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +2

Query: 242 SVRVP-FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVF 418
           SV  P   +S ++   +S+V P ARC+L ++    G++N    +G + S F WG + DVF
Sbjct: 40  SVATPSVLSSQLETSSLSFVFPVARCDLDISLEARGVVNATIYTGMITSCFMWGSLVDVF 99

Query: 419 GRK 427
           GR+
Sbjct: 100 GRR 102


>UniRef50_Q9W3W9 Cluster: CG3168-PA, isoform A; n=8;
           Endopterygota|Rep: CG3168-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 632

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           MS++LP+A C+L L T   G +N     G +  A+FWG + D FGRK
Sbjct: 171 MSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRK 217


>UniRef50_Q293R0 Cluster: GA13180-PA; n=1; Drosophila
           pseudoobscura|Rep: GA13180-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 474

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           MSYV+P A C+L+LT    GL+N    +G + SA  WG + D  GR+
Sbjct: 49  MSYVMPTAECDLKLTPLDKGLLNAVTFAGMIISAIPWGFIADTMGRR 95


>UniRef50_Q9V3J5 Cluster: EG:BACR7A4.13 protein; n=1; Drosophila
           melanogaster|Rep: EG:BACR7A4.13 protein - Drosophila
           melanogaster (Fruit fly)
          Length = 558

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 19/48 (39%), Positives = 33/48 (68%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           MSY+LP+A C+L+L+    G++N    +G ++SA  WG + D+ GR++
Sbjct: 66  MSYILPSAECDLKLSLLDKGILNAITYAGMISSAVLWGYLADIKGRRN 113



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = +1

Query: 484 RSRLQTSAAARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXX 663
           +SR+Q     + + GF + GP  ++ TYL++L G K RQ  + MVG+ F           
Sbjct: 133 QSRIQLMVF-KYLGGFCMSGPFAVLMTYLTELHGRKHRQRIMMMVGIMFSIATLTLPGLA 191

Query: 664 XMVIP 678
            +++P
Sbjct: 192 MLILP 196


>UniRef50_Q9VGX6 Cluster: CG31272-PA; n=3; Sophophora|Rep:
           CG31272-PA - Drosophila melanogaster (Fruit fly)
          Length = 563

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +2

Query: 245 VRVPFFASGV-QNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFG 421
           V +P  ++ + ++  MSY+LP A C+L+LT    G++N    +G   SA  WG + D  G
Sbjct: 64  VSIPAQSAAIFESSSMSYILPIAECDLRLTLEDKGVLNAVAYAGMTISAIAWGYLADTKG 123

Query: 422 RK 427
           RK
Sbjct: 124 RK 125



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +1

Query: 520 INGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGM 624
           + G ++ GPA ++FTYL+++ G K R   L +VGM
Sbjct: 157 LGGLVVNGPAAVLFTYLTEMHGPKHRSSVLMIVGM 191


>UniRef50_Q7QA97 Cluster: ENSANGP00000013027; n=6;
           Endopterygota|Rep: ENSANGP00000013027 - Anopheles
           gambiae str. PEST
          Length = 570

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           +SYVLP A C+L LTT + G+++    +G ++S+  WG + D  GR++
Sbjct: 87  ISYVLPVAECDLMLTTKEKGILSAISFAGIISSSHLWGFLADTRGRRT 134


>UniRef50_Q16HW1 Cluster: Synaptic vesicle protein; n=3;
           Culicidae|Rep: Synaptic vesicle protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 544

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           M +++ AA C+LQLT    G++N A   G V S+ FWG + D +GR+
Sbjct: 87  MGFIISAAECDLQLTFSDKGMLNGAAFCGVVISSHFWGFLSDTWGRR 133


>UniRef50_Q6U1H1 Cluster: SV2-like protein 2; n=1; Ctenocephalides
           felis|Rep: SV2-like protein 2 - Ctenocephalides felis
           (Cat flea)
          Length = 773

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 41/176 (23%), Positives = 70/176 (39%), Gaps = 6/176 (3%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXX 466
           MS++LP+A+C+L+L T+  G +N     G +  A+ WG + D  GRK             
Sbjct: 235 MSFILPSAQCDLKLNTHTKGWLNSIIFIGMMFGAYLWGSLADSVGRKRVLIAISFMNALC 294

Query: 467 XXXQSTVPDYRLLLQLE----PSMGSL*EVQLHWSSRIYQT*LELRRDNSILAWWE*VLL 634
               S    Y L +        ++G    V   + +            +S+ A+W     
Sbjct: 295 IVASSFSQSYGLFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSSMAAFW----- 349

Query: 635 RPGYFCLHSPGW*FHLKSRTIQRSCQFT--PWRLFLAWGSLPGFMRESGVLYLPES 796
             G  C+    W    ++        FT   WR+FL+  ++P  +    + +LPES
Sbjct: 350 TLGNLCVAGLAWAVIPQASLGYHGVHFTYNSWRIFLSLCAVPSLIVAVLLFFLPES 405



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = +3

Query: 180 ADYETALDKAGYGRFSRSALGACVCLSSHQE 272
           AD+ETA+D  GYG+F  + L  C  +S+ +E
Sbjct: 199 ADFETAIDMTGYGKFHYALLAVCGFVSTSEE 229


>UniRef50_UPI00015B5826 Cluster: PREDICTED: similar to synaptic
           vesicle protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to synaptic vesicle protein - Nasonia
           vitripennis
          Length = 546

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 2/74 (2%)
 Frame = +2

Query: 281 CIMS--YVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXX 454
           CI S  +V+P A C+ Q+TT   G IN A M G V  +  WG   D+ GR+S        
Sbjct: 38  CITSVGFVVPTAACDFQMTTIDKGRINAAPMLGMVVGSCAWGYYADLKGRRSALLIALFV 97

Query: 455 XXXXXXXQSTVPDY 496
                   S VP Y
Sbjct: 98  QFIVDAISSVVPSY 111


>UniRef50_UPI0000D557DE Cluster: PREDICTED: similar to CG15221-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG15221-PA - Tribolium castaneum
          Length = 512

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 272 VQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           V+  +M +++PAA+C+L L+  + GL++     G V S++ WG + D  GRK
Sbjct: 45  VETMMMMFIVPAAQCDLDLSLSEKGLLSSVSFIGVVVSSYMWGYLADTKGRK 96


>UniRef50_Q1DH26 Cluster: Synaptic vesicle protein; n=1; Aedes
           aegypti|Rep: Synaptic vesicle protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 563

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 42/176 (23%), Positives = 77/176 (43%), Gaps = 2/176 (1%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXX 442
           AS  ++  M  +LPA++C+L+L   + G+++ A   G + S ++WG   DV GRK+    
Sbjct: 99  ASANESMGMGIILPASQCDLELDLSRKGVVSGAVFMGIMVSTYYWGYQTDVRGRKAVLKV 158

Query: 443 XXXXXXXXXXXQSTVPDYRLLLQLEPSMGSL*EVQLHWSSRIYQT*LELRRDNSILAWWE 622
                       + V  + +L+ L   +G         ++ +Y            +  + 
Sbjct: 159 TLLAAAACSFVATFVNQFEVLVVLRFIVGLFISAPAS-AAIVYLGEFCPSTKRGQMIGYA 217

Query: 623 *VLLRPGYFCLHSPGW*FHLKSRTIQRSCQFT--PWRLFLAWGSLPGFMRESGVLY 784
             L   G+  +   GW       TI+ +  FT  PWR+     +LPGF+  SG+++
Sbjct: 218 CALGGMGFGYVAVFGWWILSYKWTIEVTEFFTIRPWRMLFLVNTLPGFV--SGLVF 271


>UniRef50_Q4SLU3 Cluster: Chromosome 13 SCAF14555, whole genome
           shotgun sequence; n=6; Clupeocephala|Rep: Chromosome 13
           SCAF14555, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 540

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 45/184 (24%), Positives = 72/184 (39%), Gaps = 6/184 (3%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXX 442
           +  V+   +S++LP ARC+L+L++   GL+  +   G +   + WG + D  GR++    
Sbjct: 80  SDAVEILCVSFLLPTARCDLRLSSSDMGLLTASIFLGMMVGGYMWGYLADRRGRRNILVV 139

Query: 443 XXXXXXXXXXXQSTVPDYRLLLQLE----PSMGSL*EVQLHWSSRIYQT*LELRRDNSIL 610
                       S  P + L L L       +G    V   + S        LRR   I 
Sbjct: 140 SLTINGVFGGLASLAPTFWLFLLLRFISGIGVGGSIPVIFSYFSEFMP---RLRRGAMIS 196

Query: 611 AWWE*VLLRPGYFCLHSPGW*FHLKSRTIQR--SCQFTPWRLFLAWGSLPGFMRESGVLY 784
           A         G        W    +S +  R  S  F  WR+F+A  S+P        ++
Sbjct: 197 ALA--TFWMAGNILAAGLAWMVIPRSGSFFRLGSLGFQSWRMFVALCSIPSLTSAFIFVF 254

Query: 785 LPES 796
           +PES
Sbjct: 255 MPES 258


>UniRef50_UPI0000DB6C4B Cluster: PREDICTED: similar to CG3690-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG3690-PA
           - Apis mellifera
          Length = 545

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +2

Query: 260 FASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           +++ +    +  +LP+A C+LQ+T YQ G++      G V S   WG + DV GR++
Sbjct: 63  WSTSLNTSSVGIILPSAECDLQITFYQKGVLTAIVYIGMVCSGPLWGYIADVKGRRT 119


>UniRef50_UPI0000D557DF Cluster: PREDICTED: similar to CG31106-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31106-PA - Tribolium castaneum
          Length = 507

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/48 (39%), Positives = 27/48 (56%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           + YVLP+A C+L+L TY  G++      G   +   WG + D  GRKS
Sbjct: 58  VGYVLPSAECDLELDTYMKGILTSTNFIGITGTCCIWGYLSDTKGRKS 105


>UniRef50_Q9VGX7 Cluster: CG14691-PA, isoform A; n=2; Drosophila
           melanogaster|Rep: CG14691-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 522

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +SYV+P+A C+L L+    G+++    +G + SA  WG + D  GR+
Sbjct: 49  LSYVMPSAECDLDLSIVDKGMLHAVTYAGMIISAVPWGFIADTIGRR 95


>UniRef50_Q13MY9 Cluster: Major facilitator superfamily (MFS)
           metabolite/H+ symporter; n=8; Bacteria|Rep: Major
           facilitator superfamily (MFS) metabolite/H+ symporter -
           Burkholderia xenovorans (strain LB400)
          Length = 468

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           F    +   I++++LP  R +  LT+++ GL+  +   G +  A F G++GD FGR+
Sbjct: 28  FMFEAIDAAIIAFILPVVRTKWHLTSFETGLLGSSTYVGFLVGALFAGLLGDRFGRR 84


>UniRef50_Q17M95 Cluster: Synaptic vesicle protein; n=4;
           Culicidae|Rep: Synaptic vesicle protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 543

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 41/172 (23%), Positives = 66/172 (38%), Gaps = 2/172 (1%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXX 466
           +S +LPA++C+L L   + G+I  A   G +AS++FWG   D  GR+             
Sbjct: 93  LSIILPASQCDLGLDPGEKGMIGGAIFLGIMASSYFWGYQADTRGRQVVLKYALIVTSIC 152

Query: 467 XXXQSTVPDYRLLLQLEPSMGSL*EVQLHWSSRIYQT*LELRRDNSILAWWE*VLLRPGY 646
               S   D+  L+ L    G                     R   ++++   V+   G 
Sbjct: 153 SFASSFANDFASLMVLRFITGLCIAAPAATIYAYLGEFCTPSRRVQLISYAS-VMPSVGI 211

Query: 647 FCLHSPGW--*FHLKSRTIQRSCQFTPWRLFLAWGSLPGFMRESGVLYLPES 796
             +   GW    +  S  I  S  + PWRL     ++PG +      + PES
Sbjct: 212 IYVALVGWLTLSYDWSFAITDSITYKPWRLLFILYTIPGLLAGITFFFFPES 263


>UniRef50_UPI0000E46F01 Cluster: PREDICTED: similar to ankyrin
            2,3/unc44; n=3; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ankyrin 2,3/unc44 -
            Strongylocentrotus purpuratus
          Length = 1367

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/68 (32%), Positives = 34/68 (50%)
 Frame = +2

Query: 227  PECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIV 406
            P C         A  ++  I+S + P  RCE +L+++Q  LI      G   S+  WG++
Sbjct: 1283 PHCALVTAPNKMADAMEMMILSILSPILRCEWRLSSWQEALITTVVFIGMFFSSTVWGMI 1342

Query: 407  GDVFGRKS 430
             D FGR+S
Sbjct: 1343 CDKFGRRS 1350


>UniRef50_Q1AUV3 Cluster: Major facilitator superfamily MFS_1; n=1;
           Rubrobacter xylanophilus DSM 9941|Rep: Major facilitator
           superfamily MFS_1 - Rubrobacter xylanophilus (strain DSM
           9941 / NBRC 16129)
          Length = 459

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 251 VPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           V + A   +  ++ + LP+   E  ++  QAGLI  A  +G +  A+FWG V D  GR++
Sbjct: 32  VTWVADSAEILMLGFALPSIIAEFAISPAQAGLIATATFAGMLVGAWFWGTVSDYIGRRT 91


>UniRef50_Q7XPE1 Cluster: OSJNBa0060N03.20 protein; n=3;
           Liliopsida|Rep: OSJNBa0060N03.20 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 588

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +2

Query: 251 VPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           V   A  ++  ++S+V P+ + E +LT++Q  +I      G +  A+ WG+V D +GR+
Sbjct: 96  VGLIAEAMEMMLLSFVGPSVQLEWKLTSHQESMITSIVFVGMLIGAYTWGVVSDNYGRR 154


>UniRef50_Q8N4V2 Cluster: Synaptic vesicle 2-related protein; n=33;
           Coelomata|Rep: Synaptic vesicle 2-related protein - Homo
           sapiens (Human)
          Length = 548

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 22/91 (24%), Positives = 40/91 (43%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           + A  ++  I+S + P   CE +L ++Q  L+      G ++S+  WG + D +GRK+  
Sbjct: 94  WMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGL 153

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                         +  P Y  +L L   +G
Sbjct: 154 KISVLWTLYYGILSAFAPVYSWILVLRGLVG 184


>UniRef50_Q2C3U3 Cluster: L-fucose permease; n=2; Vibrionaceae|Rep:
           L-fucose permease - Photobacterium sp. SKA34
          Length = 430

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 23/64 (35%), Positives = 33/64 (51%)
 Frame = +2

Query: 236 FRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDV 415
           F ++ V FFA G+ N + + +LP  +   QL+  Q G I+ AF  G        GIV + 
Sbjct: 23  FATLCVMFFAWGIPNALQNVILPQFQIGFQLSNLQTGFIDSAFYFGYFFVPIIAGIVSNK 82

Query: 416 FGRK 427
           FG K
Sbjct: 83  FGFK 86


>UniRef50_Q04H25 Cluster: Permease of the major facilitator
           superfamily; n=1; Oenococcus oeni PSU-1|Rep: Permease of
           the major facilitator superfamily - Oenococcus oeni
           (strain BAA-331 / PSU-1)
          Length = 418

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 25/73 (34%), Positives = 36/73 (49%)
 Frame = +2

Query: 206 SRVRPLQPECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVAS 385
           S V   Q +   S  + +   G+   ++S+VLP    +  LTT QAG I+   M G V  
Sbjct: 16  SGVASYQKQTLWSSIIGYAMDGLDMMLLSFVLPLIMADFHLTTAQAGGISTITMFGVVIG 75

Query: 386 AFFWGIVGDVFGR 424
              +GI+ D FGR
Sbjct: 76  GTVFGILADHFGR 88


>UniRef50_Q16U92 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 148

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 21/76 (27%), Positives = 37/76 (48%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXX 466
           +S ++PA++C++ ++T   GL++ A   G V S++ WG + D  GR+             
Sbjct: 66  ISVIIPASKCDISISTGNRGLLSGATFLGIVLSSYVWGYLSDTQGRRKMMQYGLYATGIC 125

Query: 467 XXXQSTVPDYRLLLQL 514
               S   D+  LL L
Sbjct: 126 ALLSSFANDFASLLVL 141


>UniRef50_P30638 Cluster: Putative transporter ZK637.1; n=3;
           Bilateria|Rep: Putative transporter ZK637.1 -
           Caenorhabditis elegans
          Length = 520

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + A  ++  ++S + PA  CE  +++ Q  L+     SG + S+ FWG + D FGR+
Sbjct: 93  WMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRR 149


>UniRef50_UPI0000DB7CA4 Cluster: PREDICTED: similar to CG3168-PA,
           isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG3168-PA, isoform A - Apis mellifera
          Length = 556

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 21/77 (27%), Positives = 37/77 (48%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXX 466
           + ++LP+A C+ ++TT   G ++ A M G +A ++ WG    + GR+             
Sbjct: 54  IGFILPSAACDFRMTTMDKGRLSAAPMLGMLAGSYIWGCYAAIKGRRLSLLVALFLHGIS 113

Query: 467 XXXQSTVPDYRLLLQLE 517
               S VP Y + L L+
Sbjct: 114 ELLASVVPLYWVFLFLK 130


>UniRef50_Q4RSX3 Cluster: Chromosome 12 SCAF14999, whole genome
           shotgun sequence; n=2; Euteleostomi|Rep: Chromosome 12
           SCAF14999, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 720

 Score = 41.5 bits (93), Expect = 0.024
 Identities = 22/91 (24%), Positives = 39/91 (42%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           + A  ++  I+S + P   CE +L + +  L+  A   G + S+  WG + D +GRK+  
Sbjct: 93  WMADAMEMMILSILAPQLHCEWRLPSLEVALLTSAVFIGMMISSSLWGNISDKYGRKTGL 152

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                         +  P Y  +L L   +G
Sbjct: 153 KMSVLWTMFYGLMSAFAPVYGWILVLRALVG 183


>UniRef50_UPI00015A542A Cluster: Synaptic vesicle glycoprotein 2B.;
           n=3; Danio rerio|Rep: Synaptic vesicle glycoprotein 2B.
           - Danio rerio
          Length = 502

 Score = 41.1 bits (92), Expect = 0.031
 Identities = 40/186 (21%), Positives = 77/186 (41%), Gaps = 8/186 (4%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXX 442
           A  V+  +++ VLP+A  ++ L+  + G++ +    G +  AF WG + D  GR+     
Sbjct: 27  ADSVECFVVALVLPSAEKDMCLSHAEKGMLGLIVFLGMMFGAFIWGGLADKVGRRKCLII 86

Query: 443 XXXXXXXXXXXQSTVPDYR--LLLQLEPSMGSL*EVQLHWSSRIYQT*LELRRDNSILAW 616
                       S    Y   L  +L   +G    V + +S   +   L++ +    L+W
Sbjct: 87  VLAMNCISAFFSSFAQGYGFFLFFRLFSGIGIGGSVPIVYS--YFSEFLQMDKRGEHLSW 144

Query: 617 WE*VLLRPGYFCLHS-----PGW*FHLK-SRTIQRSCQFTPWRLFLAWGSLPGFMRESGV 778
                +  G +   +     P +  H     ++    QF  WR+F+   +LP      G+
Sbjct: 145 LCMFWMMGGIYASFTAWGIIPRYGTHKSWGFSMGTEFQFHSWRVFVLVCALPAIAAFVGL 204

Query: 779 LYLPES 796
           +++PES
Sbjct: 205 MFMPES 210


>UniRef50_A6SWT4 Cluster: Transporter of the MFS superfamily; n=3;
           Burkholderiales|Rep: Transporter of the MFS superfamily
           - Janthinobacterium sp. (strain Marseille)
           (Minibacterium massiliensis)
          Length = 460

 Score = 40.7 bits (91), Expect = 0.041
 Identities = 23/68 (33%), Positives = 34/68 (50%)
 Frame = +2

Query: 224 QPECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGI 403
           Q   F  +   +F   +   IM++VL + + E  LTT QAGL+  +   G    A   G+
Sbjct: 26  QRSLFGIIATAWFFDSMDLGIMTFVLGSIKAEFALTTTQAGLLASSSFLGMFLGAAIAGM 85

Query: 404 VGDVFGRK 427
           + D FGRK
Sbjct: 86  LADKFGRK 93


>UniRef50_Q0KDB6 Cluster: MFS transporter, AAHS family; n=2;
           Bacteria|Rep: MFS transporter, AAHS family - Ralstonia
           eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier
           337)(Cupriavidus necator (strain ATCC 17699 / H16 / DSM
           428 / Stanier337))
          Length = 477

 Score = 40.3 bits (90), Expect = 0.054
 Identities = 22/77 (28%), Positives = 32/77 (41%)
 Frame = +2

Query: 278 NCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXX 457
           N I +Y  P  +    L+T Q GLI+ AF  G +  A   G + D +GR+S         
Sbjct: 47  NAIFAYASPTIKAHTNLSTEQIGLISSAFFIGMIVGALVGGRLSDRWGRRSVLVWTTVLY 106

Query: 458 XXXXXXQSTVPDYRLLL 508
                  +  P Y  +L
Sbjct: 107 SLGALATAFAPTYETIL 123


>UniRef50_Q8IMT7 Cluster: CG31106-PA; n=2; Drosophila
           melanogaster|Rep: CG31106-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 515

 Score = 40.3 bits (90), Expect = 0.054
 Identities = 17/81 (20%), Positives = 37/81 (45%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXX 466
           MSY+   ++C+ ++ +    +++ A   G   S++FWG + D  GR+             
Sbjct: 60  MSYITIVSQCDFEMNSMDKAVMSAASFIGIFCSSYFWGYLSDTIGRRPVLIYTTIAGNFL 119

Query: 467 XXXQSTVPDYRLLLQLEPSMG 529
               + +P+Y L + +   +G
Sbjct: 120 SLCSTVIPNYWLYVFIRFGVG 140


>UniRef50_A4QYX5 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 544

 Score = 39.9 bits (89), Expect = 0.072
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           +LP+ + E   +   +G ++ AF +G  A A FWG+V D+ GR
Sbjct: 86  ILPSIKQEFGFSAVDSGNLSTAFNAGLTAGALFWGVVTDIIGR 128


>UniRef50_Q8SYM5 Cluster: RE53026p; n=5; Endopterygota|Rep: RE53026p
           - Drosophila melanogaster (Fruit fly)
          Length = 478

 Score = 39.5 bits (88), Expect = 0.095
 Identities = 22/91 (24%), Positives = 38/91 (41%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           + +  ++  I+S + P+  CE  +T +Q   +      G + S+ FW  + + +GRKS  
Sbjct: 66  WMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSAL 125

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                         S  P Y  LL L   +G
Sbjct: 126 TLFGVLLVLYSILSSVAPSYAWLLTLRGLVG 156


>UniRef50_Q7L0J3 Cluster: Synaptic vesicle glycoprotein 2A; n=74;
           Gnathostomata|Rep: Synaptic vesicle glycoprotein 2A -
           Homo sapiens (Human)
          Length = 742

 Score = 39.5 bits (88), Expect = 0.095
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 178 ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 232


>UniRef50_UPI0000E463D0 Cluster: PREDICTED: hypothetical protein;
           n=3; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 555

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 16/55 (29%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +  V+   +SY+LP A  ++ +++ Q GL+      G +   +FWG + D+ GR+
Sbjct: 45  SDAVEILSVSYLLPNASRDMHVSSPQKGLLTSIIFVGMLVGGYFWGSLADIQGRR 99


>UniRef50_Q9LSH7 Cluster: Transporter-like protein; n=3; core
           eudicotyledons|Rep: Transporter-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 470

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 23/89 (25%), Positives = 38/89 (42%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXX 442
           A  ++  ++S+V PA +    L+  Q  LI     +G +  A+ WGIV D  GR+     
Sbjct: 36  AEAMEMMLLSFVGPAVQSLWNLSARQESLITSVVFAGMLIGAYSWGIVSDKHGRRKGFII 95

Query: 443 XXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                       +  P+Y  L+ L   +G
Sbjct: 96  TAVVTFVAGFLSAFSPNYMWLIILRCLVG 124


>UniRef50_Q940M4 Cluster: AT3g13050/MGH6_16; n=11;
           Magnoliophyta|Rep: AT3g13050/MGH6_16 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 500

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 23/89 (25%), Positives = 38/89 (42%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXX 442
           A  ++  ++S+V PA +    L+  Q  LI     +G +  A+ WGIV D  GR+     
Sbjct: 36  AEAMEMMLLSFVGPAVQSLWNLSARQESLITSVVFAGMLIGAYSWGIVSDKHGRRKGFII 95

Query: 443 XXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                       +  P+Y  L+ L   +G
Sbjct: 96  TAVVTFVAGFLSAFSPNYMWLIILRCLVG 124


>UniRef50_Q16LN8 Cluster: Synaptic vesicle protein; n=3; Aedes
           aegypti|Rep: Synaptic vesicle protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 527

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +SY++P    +L +TT + G+++    +G + S+  WG + D  GR+
Sbjct: 52  VSYIIPVIGQDLDVTTKEKGVLSAVGFAGVIVSSHLWGFLADTHGRR 98


>UniRef50_A7S8U6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 327

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           Y AGLI  A+  G   S +FWG++ D FGR+
Sbjct: 62  YSAGLIASAYFMGRAVSGYFWGMLSDKFGRR 92


>UniRef50_Q17HA7 Cluster: Synaptic vesicle protein; n=2; Aedes
           aegypti|Rep: Synaptic vesicle protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 486

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           +S ++PA+ C+L L+    G++     +G + ++  WG V D  GRK+
Sbjct: 51  ISILIPASHCDLNLSATDKGVLTGVSFAGIILTSHLWGYVADTKGRKN 98


>UniRef50_Q62CI0 Cluster: Major facilitator family transporter;
           n=43; Bacteria|Rep: Major facilitator family transporter
           - Burkholderia mallei (Pseudomonas mallei)
          Length = 478

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 22/64 (34%), Positives = 33/64 (51%)
 Frame = +2

Query: 236 FRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDV 415
           F  + + FF   V    M++VL + + E  L+T  AGL+  A   G V  A   G++ D 
Sbjct: 33  FVIIAIAFFFDSVDLGTMTFVLGSIKREFGLSTATAGLVASASFFGMVLGAAVAGLLADR 92

Query: 416 FGRK 427
           FGR+
Sbjct: 93  FGRR 96


>UniRef50_Q1GSZ9 Cluster: Major facilitator superfamily MFS_1; n=2;
           Alphaproteobacteria|Rep: Major facilitator superfamily
           MFS_1 - Sphingopyxis alaskensis (Sphingomonas
           alaskensis)
          Length = 519

 Score = 37.9 bits (84), Expect = 0.29
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           + +V+P    E  L+     L+  A ++G V  +  WG V DV+GRK+
Sbjct: 116 LGFVIPGMMDEYGLSRETVSLVPFAALAGTVTGSIVWGAVADVYGRKA 163


>UniRef50_A2WN94 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 506

 Score = 37.9 bits (84), Expect = 0.29
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = +2

Query: 260 FASGVQNCIMSYV--LPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           F  G+ +C  S +  L  A+ E  +  Y AG +  ++M G   S+  WGIV D +GRK
Sbjct: 110 FTFGLNSCAGSVIRDLHIAKQEEDIGFY-AGFVGASYMFGRALSSVIWGIVADKYGRK 166


>UniRef50_Q9VBV9 Cluster: CG31103-PA; n=2; Sophophora|Rep:
           CG31103-PA - Drosophila melanogaster (Fruit fly)
          Length = 360

 Score = 37.9 bits (84), Expect = 0.29
 Identities = 15/47 (31%), Positives = 28/47 (59%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           MS ++ A++CE + T  + G++  A ++G   S + WG + D  GR+
Sbjct: 51  MSIIVIASQCEFETTQAEKGVMMAASVTGIFLSTYIWGYISDDIGRR 97


>UniRef50_Q0UI23 Cluster: Putative uncharacterized protein; n=2;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Phaeosphaeria nodorum (Septoria nodorum)
          Length = 791

 Score = 37.9 bits (84), Expect = 0.29
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           VL   + EL     Q G +++AF SG  A AF WG++ D+ GR+
Sbjct: 122 VLSPMQQELGFGVDQTGNLSIAFSSGLTAGAFVWGVLVDIIGRQ 165


>UniRef50_Q21QS4 Cluster: Major facilitator superfamily MFS_1; n=1;
           Rhodoferax ferrireducens T118|Rep: Major facilitator
           superfamily MFS_1 - Rhodoferax ferrireducens (strain DSM
           15236 / ATCC BAA-621 / T118)
          Length = 381

 Score = 37.5 bits (83), Expect = 0.38
 Identities = 19/53 (35%), Positives = 24/53 (45%)
 Frame = +2

Query: 266 SGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           S VQ C+ SY++      L  T   AG       SGGV     WG V D+ G+
Sbjct: 212 SAVQMCLSSYLVTYLNASLGWTLVAAGAGLAVAQSGGVVGRILWGAVADMTGK 264


>UniRef50_Q8IHA7 Cluster: AT19445p; n=3; Sophophora|Rep: AT19445p -
           Drosophila melanogaster (Fruit fly)
          Length = 471

 Score = 37.5 bits (83), Expect = 0.38
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           M  + PAA C+L++   Q   +  A   G + S++FWG + D  GR+
Sbjct: 10  MGIIGPAAVCDLRMNEAQLASLTAAGFMGIICSSYFWGYITDKKGRR 56


>UniRef50_UPI0000DB77DF Cluster: PREDICTED: similar to synaptic
           vesicle glycoprotein 2 b; n=1; Apis mellifera|Rep:
           PREDICTED: similar to synaptic vesicle glycoprotein 2 b
           - Apis mellifera
          Length = 590

 Score = 37.1 bits (82), Expect = 0.51
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A  V+  ++ Y+LP+A  EL +   + G ++   + G      FWG +GD  GR+
Sbjct: 47  ADTVEFFVVPYILPSAEVELCIEDNEKGWLSNITLMGLALGGLFWGGLGDRIGRR 101


>UniRef50_Q04DE2 Cluster: D-xylose proton-symporter; n=2; Oenococcus
           oeni|Rep: D-xylose proton-symporter - Oenococcus oeni
           (strain BAA-331 / PSU-1)
          Length = 464

 Score = 37.1 bits (82), Expect = 0.51
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +2

Query: 260 FASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           + +GV N  +S++  A   EL L+ +  GL+  + + G    A  WG + D +GRKS
Sbjct: 33  YDTGVINGSLSFM--ARGDELNLSPFMEGLVTSSLLFGAAIGAVIWGRLADRYGRKS 87


>UniRef50_Q9FKI8 Cluster: Transporter-like protein; n=4; core
           eudicotyledons|Rep: Transporter-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 515

 Score = 36.7 bits (81), Expect = 0.67
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++ FWGIV D +GRK
Sbjct: 78  FYAGFVGCSFMLGRALTSVFWGIVADRYGRK 108


>UniRef50_Q8RWN2 Cluster: Transporter-like protein; n=39;
           Magnoliophyta|Rep: Transporter-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 460

 Score = 36.7 bits (81), Expect = 0.67
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++ FWGIV D +GRK
Sbjct: 52  FYAGFVGCSFMLGRALTSVFWGIVADRYGRK 82


>UniRef50_Q2TXH4 Cluster: Predicted transporter; n=2;
           Eurotiomycetidae|Rep: Predicted transporter -
           Aspergillus oryzae
          Length = 585

 Score = 36.7 bits (81), Expect = 0.67
 Identities = 17/41 (41%), Positives = 24/41 (58%)
 Frame = +1

Query: 508 AARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSF 630
           AAR + G   GG   LVF  +SDL  ++ R  YL M+G ++
Sbjct: 144 AARALQGAAGGGLMQLVFIVISDLFSIRTRALYLGMMGFTW 184


>UniRef50_Q18WV9 Cluster: Major facilitator superfamily MFS_1; n=4;
           Desulfitobacterium hafniense|Rep: Major facilitator
           superfamily MFS_1 - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 435

 Score = 36.3 bits (80), Expect = 0.89
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +2

Query: 284 IMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           I    LP+   EL L   Q GL+  A M G +  A  +G++ DV GRK
Sbjct: 39  IYGVTLPSVMKELNLNATQTGLLASAGMFGMMFGALLFGMLSDVIGRK 86


>UniRef50_Q6FBB3 Cluster: Putative benzoate transport protein; n=1;
           Acinetobacter sp. ADP1|Rep: Putative benzoate transport
           protein - Acinetobacter sp. (strain ADP1)
          Length = 450

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 20/53 (37%), Positives = 26/53 (49%)
 Frame = +2

Query: 269 GVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           G    I   VLP    +  LT+ QAG++    M G +  A   GI+ D FGRK
Sbjct: 36  GYDLVIYGVVLPRLMEQWSLTSVQAGMLASTAMCGMLVGALSCGILADKFGRK 88


>UniRef50_Q1MR37 Cluster: Permeases of the major facilitator
           superfamily; n=1; Lawsonia intracellularis
           PHE/MN1-00|Rep: Permeases of the major facilitator
           superfamily - Lawsonia intracellularis (strain
           PHE/MN1-00)
          Length = 384

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           VLPA      LTT Q   + +A+ S G+  A   G++ D  GRK+
Sbjct: 25  VLPAIAQRFMLTTEQVSWVTVAYTSPGIIMALIAGVLADRLGRKA 69


>UniRef50_Q5KES1 Cluster: Membrane transporter, putative; n=1;
           Filobasidiella neoformans|Rep: Membrane transporter,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 648

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +2

Query: 281 CIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           CI + +LP  +    L++   GL++ + M+G +  A  WG+V D+ GR
Sbjct: 108 CI-AVILPRVQVHFNLSSKVVGLLSASTMAGMMIGAVGWGVVSDLLGR 154


>UniRef50_A3H9U8 Cluster: Major facilitator superfamily MFS_1; n=1;
           Caldivirga maquilingensis IC-167|Rep: Major facilitator
           superfamily MFS_1 - Caldivirga maquilingensis IC-167
          Length = 458

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 20/57 (35%), Positives = 27/57 (47%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           FFA       +S  L   +    L+     LI+ A + G V   F +G +GDVFGRK
Sbjct: 30  FFADAYDLFAISIALVFLKQVWSLSASDVSLISSAALFGAVIGPFIFGRIGDVFGRK 86


>UniRef50_P39352 Cluster: Putative metabolite transport protein
           yjhB; n=4; Enterobacteriaceae|Rep: Putative metabolite
           transport protein yjhB - Escherichia coli (strain K12)
          Length = 405

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = +2

Query: 197 AGQSRVRPLQPECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLIN-MAFMSG 373
           A   +V P Q +   S  + +   G    ++ Y+L   + +L +T  QA LI  +AF++ 
Sbjct: 4   AWYKQVNPPQRKALFSAWLGYVFDGFDFMMIFYILHIIKADLGITDIQATLIGTVAFIAR 63

Query: 374 GVASAFFWGIVGDVFGRK 427
            +   FF G + D +GRK
Sbjct: 64  PIGGGFF-GAMADKYGRK 80


>UniRef50_Q4S265 Cluster: Chromosome undetermined SCAF14764, whole
           genome shotgun sequence; n=5; Clupeocephala|Rep:
           Chromosome undetermined SCAF14764, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 760

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 45/201 (22%), Positives = 78/201 (38%), Gaps = 10/201 (4%)
 Frame = +2

Query: 224 QPECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAG-LINMAFMSGGVASAFFWG 400
           Q + F  + +   + GV+  ++ +VLP+A  ++ +    AG         G +  AF+WG
Sbjct: 159 QWQLFFVLGLALMSDGVEVFVVGFVLPSAEMDMCVPNSGAGWCAGSVVYLGMMLGAFYWG 218

Query: 401 IVGDVFGRKSXXXXXXXXXXXXXXXQSTVPDYR--LLLQLEPSMGSL*EVQLHWSSRIYQ 574
            + D  GRK                 S V  Y   +L +L    G    V + +S   + 
Sbjct: 219 GLSDKVGRKQCLLISMTVNGFFAFLSSFVQGYSMFILCRLVSGFGIGGAVPIVFS--YFA 276

Query: 575 T*LELRRDNSILAWWE*VLLRPGYFC-------LHSPGW*FHLKSRTIQRSCQFTPWRLF 733
             L   +    L+W     +  G +        +   GW F + S     + QF  WR+F
Sbjct: 277 EVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFSMGS-----AYQFHSWRVF 331

Query: 734 LAWGSLPGFMRESGVLYLPES 796
           +   +LP       + ++PES
Sbjct: 332 VVVCALPCVSAVVALTFMPES 352



 Score = 33.1 bits (72), Expect = 8.3
 Identities = 16/55 (29%), Positives = 30/55 (54%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++GF IGG   +VF+Y ++++  +KR  +LS + M ++            +IP
Sbjct: 257 RLVSGFGIGGAVPIVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIP 311


>UniRef50_A1G7D6 Cluster: Major facilitator superfamily MFS_1; n=2;
           Micromonosporaceae|Rep: Major facilitator superfamily
           MFS_1 - Salinispora arenicola CNS205
          Length = 565

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 17/74 (22%), Positives = 34/74 (45%)
 Frame = +2

Query: 209 RVRPLQPECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASA 388
           R+RP+       + V      ++   + +VLP    E  +      ++ +  ++G    +
Sbjct: 119 RLRPIYWATAAVLTVALVVDVMKPLTLGFVLPGMGQEYDMPLEAVTILPLVALTGTAVGS 178

Query: 389 FFWGIVGDVFGRKS 430
             WG++GD FGR+S
Sbjct: 179 VVWGLLGDRFGRRS 192


>UniRef50_Q2QY47 Cluster: Major facilitator superfamily antiporter,
           putative; n=2; Oryza sativa|Rep: Major facilitator
           superfamily antiporter, putative - Oryza sativa subsp.
           japonica (Rice)
          Length = 465

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           Y AG +  ++M G   +A FWG+V D  GRK
Sbjct: 86  YYAGFLGASYMVGRSFAAIFWGVVADRIGRK 116


>UniRef50_Q2RAW1 Cluster: Major facilitator superfamily antiporter,
           putative; n=4; Oryza sativa|Rep: Major facilitator
           superfamily antiporter, putative - Oryza sativa subsp.
           japonica (Rice)
          Length = 424

 Score = 35.1 bits (77), Expect = 2.0
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +2

Query: 299 LPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           L  A+ E  +  Y AG +  ++M G   +A FWG+V D  GRK
Sbjct: 29  LQVAQTEEDIGNY-AGFLGASYMVGRSFAAIFWGVVADRIGRK 70


>UniRef50_Q010B9 Cluster: Synaptic vesicle transporter SVOP and
           related transporters; n=3; Ostreococcus|Rep: Synaptic
           vesicle transporter SVOP and related transporters -
           Ostreococcus tauri
          Length = 825

 Score = 35.1 bits (77), Expect = 2.0
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +2

Query: 245 VRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           V + + A  ++  ++S++ PA RCE  +     GL+     +G +  A  WG + D  GR
Sbjct: 25  VGLAWTADAMEMMLLSFLGPAMRCEFGVGKTAEGLLTSVVFAGMMIGAPSWGAMSDQRGR 84

Query: 425 K 427
           +
Sbjct: 85  R 85


>UniRef50_A3C1G7 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 436

 Score = 35.1 bits (77), Expect = 2.0
 Identities = 15/55 (27%), Positives = 29/55 (52%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +  ++  ++S+V  + + E +L+     LI      G +  A+ WGIV D +GR+
Sbjct: 60  SEAMEMMLLSFVGQSVQAEWELSAQAESLITSVVFVGMLVGAYSWGIVSDNYGRR 114


>UniRef50_Q01QX5 Cluster: Major facilitator superfamily MFS_1
           precursor; n=1; Solibacter usitatus Ellin6076|Rep: Major
           facilitator superfamily MFS_1 precursor - Solibacter
           usitatus (strain Ellin6076)
          Length = 402

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           V P  + E+ L+  Q G +  +FM    A+A F G+ GD F RKS
Sbjct: 30  VFPLLKAEMHLSDVQLGYVASSFMWVYAAAAPFAGLAGDRFRRKS 74


>UniRef50_A7QAK9 Cluster: Chromosome undetermined scaffold_71, whole
           genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_71, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 548

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           Y AG +  AFM G   ++  WG+V D +GRK
Sbjct: 138 YYAGYVGSAFMLGRALTSVAWGMVADRYGRK 168


>UniRef50_Q5C1K3 Cluster: SJCHGC03275 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC03275 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 217

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           A  ++  ++S + PA RC   L++ Q   +     +G +  A  WG + D FGR
Sbjct: 84  ADAMEMLLLSVLGPALRCYWLLSSGQVAALTTVVFAGFLFGAPLWGFIADRFGR 137


>UniRef50_A4IYD6 Cluster: Sugar transporter, MFS family; n=8;
           Francisella tularensis|Rep: Sugar transporter, MFS
           family - Francisella tularensis subsp. tularensis
           (strain WY96-3418)
          Length = 467

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +2

Query: 284 IMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           I+   LP  + EL +T  Q   +  + + GG  +    G++ D+FGRK+
Sbjct: 38  IIGGALPFIKYELGMTAAQESFLGGSVLFGGAFAILIGGVLADIFGRKN 86


>UniRef50_Q55CP7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 665

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +2

Query: 323 QLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +L  Y AG I  +F +    S+FFWG + D  GRK
Sbjct: 54  ELVGYYAGFIASSFSAAQFLSSFFWGKMADRLGRK 88


>UniRef50_A7S4N1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 471

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A  ++  ++S + P  RC  +++ ++   I      G +  +  WG + D FGRK
Sbjct: 47  ADALEMMLLSILAPTIRCIFRISAWKEAWITTVVFIGMMVGSSTWGWIADNFGRK 101


>UniRef50_Q0V3Q6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 524

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = +1

Query: 499 TSAAARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVG 621
           T  A R + GF  GG   LV   +SD+  ++ R  YL +VG
Sbjct: 116 TLVAGRVVQGFGGGGVVVLVHVCVSDIFPIRDRSLYLGIVG 156


>UniRef50_Q8N434 Cluster: Putative transporter SVOPL; n=20;
           Tetrapoda|Rep: Putative transporter SVOPL - Homo sapiens
           (Human)
          Length = 492

 Score = 34.3 bits (75), Expect = 3.6
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +2

Query: 284 IMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           +++ V P  RCE QL  +Q  L+      G +  +  +G++ D +GR
Sbjct: 67  LIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGR 113


>UniRef50_A6T5G3 Cluster: General substrate transporter; n=1;
           Klebsiella pneumoniae subsp. pneumoniae MGH 78578|Rep:
           General substrate transporter - Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578
          Length = 454

 Score = 33.9 bits (74), Expect = 4.7
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +2

Query: 269 GVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           G    IM ++ P  + E  ++ +Q GL+  A + G    A F G + D  GRK
Sbjct: 37  GFDIAIMGFIAPTLKLEWGVSNHQLGLVISAALIGLALGAIFSGPLADWLGRK 89


>UniRef50_A5FUB9 Cluster: General substrate transporter; n=2;
           Acidiphilium cryptum JF-5|Rep: General substrate
           transporter - Acidiphilium cryptum (strain JF-5)
          Length = 469

 Score = 33.9 bits (74), Expect = 4.7
 Identities = 19/58 (32%), Positives = 26/58 (44%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           FFAS     I+   L   + E  L+     LI    ++     AF +G   D+FGRKS
Sbjct: 38  FFASAYDLFIIGTALTLIKGEWHLSPGSVALIGSISLAATFVGAFMFGRTADIFGRKS 95


>UniRef50_Q0UV31 Cluster: Putative uncharacterized protein; n=2;
           Dothideomycetes|Rep: Putative uncharacterized protein -
           Phaeosphaeria nodorum (Septoria nodorum)
          Length = 634

 Score = 33.9 bits (74), Expect = 4.7
 Identities = 18/38 (47%), Positives = 21/38 (55%)
 Frame = +1

Query: 508 AARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVG 621
           AAR I G   GG  TLV   +SDL  V+ R  Y  M+G
Sbjct: 174 AARAIQGIGGGGLITLVNIAISDLFSVRDRGMYFGMIG 211


>UniRef50_A7EFW7 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Sclerotinia sclerotiorum 1980
          Length = 531

 Score = 33.9 bits (74), Expect = 4.7
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)
 Frame = +2

Query: 329 TTYQAGLINMAFMSGGVASAFFW-GIVGDVFGRK 427
           +TY+ GL+N ++  GG+ S FF+ G + D  GR+
Sbjct: 49  STYKIGLVNTSYNIGGIVSGFFFGGPIADRLGRR 82


>UniRef50_UPI00015B613F Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 712

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A  V+  ++ Y+LP+A  EL +   + G +    + G       WG +GD  GR+
Sbjct: 149 ADTVEFFVVPYILPSAEVELCIEDSEKGWLGNITLMGLALGGICWGGLGDRLGRR 203


>UniRef50_UPI0000510225 Cluster: COG0477: Permeases of the major
           facilitator superfamily; n=1; Brevibacterium linens
           BL2|Rep: COG0477: Permeases of the major facilitator
           superfamily - Brevibacterium linens BL2
          Length = 527

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           +++ + A + +  L+ +  GL+N + M G V  A F G + D FGR
Sbjct: 78  LAFGITAIKEQFGLSGFMTGLVNASIMVGAVIGALFGGYLVDRFGR 123


>UniRef50_A3K375 Cluster: Major facilitator family transporter; n=1;
           Sagittula stellata E-37|Rep: Major facilitator family
           transporter - Sagittula stellata E-37
          Length = 451

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 23/86 (26%), Positives = 34/86 (39%)
 Frame = +2

Query: 272 VQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXX 451
           +    +SY +     EL LT  Q GLI  AF  G + + F  G++ D FG +        
Sbjct: 35  IDRSAISYAIDPISKELSLTASQKGLILGAFGVGYMFTTFIGGVLTDRFGPRIILTVAVI 94

Query: 452 XXXXXXXXQSTVPDYRLLLQLEPSMG 529
                    +    + LLL L   +G
Sbjct: 95  LWAVSSALTAVASSFFLLLALRALLG 120


>UniRef50_A0C0D9 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 503

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 17/52 (32%), Positives = 26/52 (50%)
 Frame = +2

Query: 269 GVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           G +  +MS+++P  + E QLT+ Q   +   F  G V  +   G V D  GR
Sbjct: 41  GCELILMSFLMPILKTEWQLTSLQIQTLTSIFYLGMVLGSLLTGFVADRKGR 92


>UniRef50_P94131 Cluster: Cis,cis-muconate transport protein; n=10;
           Proteobacteria|Rep: Cis,cis-muconate transport protein -
           Acinetobacter sp. (strain ADP1)
          Length = 413

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +2

Query: 269 GVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           G    ++SY L + + E  L+T +AG++    ++G      F G   D FGR
Sbjct: 30  GADLMLLSYSLNSIKAEFNLSTVEAGMLGSFTLAGMAIGGIFGGWACDRFGR 81


>UniRef50_UPI0000382FC8 Cluster: COG0477: Permeases of the major
           facilitator superfamily; n=1; Magnetospirillum
           magnetotacticum MS-1|Rep: COG0477: Permeases of the
           major facilitator superfamily - Magnetospirillum
           magnetotacticum MS-1
          Length = 388

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 487 SRLQTSAAARTINGFIIGGPATLVFTYLSDLVGVKKR-QFYLSMVGMSFV 633
           S L +   AR ++GF IGG   LV TYL++++  ++R    ++  G+ F+
Sbjct: 59  SGLTSLTIARAVSGFAIGGFPPLVATYLAEVMPPRRRGAMLMTCAGIGFL 108


>UniRef50_Q4T8G6 Cluster: Chromosome undetermined SCAF7793, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF7793, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 725

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 19/82 (23%), Positives = 31/82 (37%)
 Frame = +2

Query: 284 IMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXX 463
           +++ + P  RCE +L  +Q  L++M    G +      G V D +GR             
Sbjct: 107 LLAVISPEIRCEWRLEDWQVALVSMMVFLGFMVCGVLAGYVADRYGRWKVLLGGFVWSSY 166

Query: 464 XXXXQSTVPDYRLLLQLEPSMG 529
                S  P Y   + L   +G
Sbjct: 167 FSLLTSFAPSYGWFIFLRSMVG 188


>UniRef50_Q39AY6 Cluster: Major facilitator superfamily (MFS_1)
           transporter; n=5; Proteobacteria|Rep: Major facilitator
           superfamily (MFS_1) transporter - Burkholderia sp.
           (strain 383) (Burkholderia cepacia (strain ATCC 17760/
           NCIB 9086 / R18194))
          Length = 449

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +2

Query: 230 ECFRSVRVPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVG 409
           +CF  V +     G+   ++ +V+PA R +    T    L+  + + G    AFF G +G
Sbjct: 28  QCFAVVAL----DGLDTALIGFVVPALRSDWHAGTTGITLLLASGLVGLAVGAFFAGPLG 83

Query: 410 DVFGRK 427
           D  GRK
Sbjct: 84  DRLGRK 89


>UniRef50_Q7KV86 Cluster: CG33234-PA; n=2; Drosophila
           melanogaster|Rep: CG33234-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 342

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 14/67 (20%), Positives = 29/67 (43%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXXXXX 475
           ++  A CE+++   +   +  A  +  + S F WG + DV+GR+                
Sbjct: 41  IIAGASCEMRIHDRRLAWLMAASFAAQMVSCFLWGELADVYGRRKIIMITSTVANIVSIL 100

Query: 476 QSTVPDY 496
            + VP++
Sbjct: 101 SACVPEF 107


>UniRef50_A0DIL7 Cluster: Chromosome undetermined scaffold_52, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_52,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1307

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%)
 Frame = +1

Query: 487 SRLQTSAAARTINGFI---IGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFV 633
           + ++ S  A+TI GFI   IG PA  V+    D  G +K Q+ L++VG  F+
Sbjct: 295 ANVKISTIAKTIKGFIIGLIGKPALQVYEIEQD--GSEKEQYVLNLVGTYFI 344


>UniRef50_A6R1F2 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 568

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +1

Query: 493 LQTSAAARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSF 630
           +Q   AAR + G   GG  +LV   +SD+  +++R  Y+S++ +++
Sbjct: 116 MQWLLAARAVKGLGAGGNLSLVSVIISDMTTLQERGSYMSLISLAW 161


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 881,434,150
Number of Sequences: 1657284
Number of extensions: 19899309
Number of successful extensions: 51966
Number of sequences better than 10.0: 95
Number of HSP's better than 10.0 without gapping: 49357
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51937
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 67908372675
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).