SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0CH36 Cluster: Chromosome undetermined scaffold_18, wh...    36   1.4  
UniRef50_Q8ZBE9 Cluster: UPF0306 protein YPO3467/y0717/YP_0616; ...    34   3.1  
UniRef50_Q91EW5 Cluster: ORF90 HELICASE; n=4; Granulovirus|Rep: ...    33   7.3  
UniRef50_A2FSI5 Cluster: Putative uncharacterized protein; n=1; ...    33   9.6  

>UniRef50_A0CH36 Cluster: Chromosome undetermined scaffold_18, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_18,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 458

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 19/96 (19%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = +1

Query: 4   HINEPFKFKIQF-VNTAISNIKAIKNHETWSLLNTLFHSMEVYVESENNVQKCIEIIIVH 180
           H N+P +  +++ +N ++   K  +NH  ++ + T   +++ Y + E   +K I+ + ++
Sbjct: 46  HNNKPLQTPLRYYINESMQQRKRSENHSDYTYIETYLEALQRYAQEEKK-KKQIQTLQIN 104

Query: 181 N--VMVGETNQEIVIKKFSFNTMKSFARY*IKKRKQ 282
           +  ++ G+  ++  IKK++    +   +Y ++K +Q
Sbjct: 105 SFPILPGQVMRD-RIKKYAEIQQREVTKYFVRKEQQ 139


>UniRef50_Q8ZBE9 Cluster: UPF0306 protein YPO3467/y0717/YP_0616;
           n=29; Enterobacteriaceae|Rep: UPF0306 protein
           YPO3467/y0717/YP_0616 - Yersinia pestis
          Length = 147

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = -3

Query: 729 PIAKIFAGPIWYANLLGKPFSNDMVSFSHKSLCHCRIEPI 610
           P+AK+ + P+W  NLL    +N+ + F  K L   R+EP+
Sbjct: 109 PVAKVSSAPLWQLNLLEIKMTNNALGFG-KKLHWSRVEPL 147


>UniRef50_Q91EW5 Cluster: ORF90 HELICASE; n=4; Granulovirus|Rep:
           ORF90 HELICASE - Cydia pomonella granulosis virus (CpGV)
           (Cydia pomonellagranulovirus)
          Length = 1131

 Score = 33.1 bits (72), Expect = 7.3
 Identities = 20/62 (32%), Positives = 30/62 (48%)
 Frame = +1

Query: 19  FKFKIQFVNTAISNIKAIKNHETWSLLNTLFHSMEVYVESENNVQKCIEIIIVHNVMVGE 198
           FKF   F NT ISN K   ++  W  ++  F    VY+      Q  +EI ++H+  +G 
Sbjct: 88  FKFVDAFNNT-ISNTKRCGDYIVWPEMSANFLGWVVYLHLNCQYQLPLEIPLIHHTRLGA 146

Query: 199 TN 204
            N
Sbjct: 147 FN 148


>UniRef50_A2FSI5 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 434

 Score = 32.7 bits (71), Expect = 9.6
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = +1

Query: 100 NTLFHSMEVY--VESENNVQKCIEIIIVHNVMVGETNQEIVIKKFSFNTMK 246
           N  F  +E Y  + S +++  CI+ I  H   + E   +++IKK  + T++
Sbjct: 25  NNCFELLEFYTDISSPDDISNCIDFISSHFYEIDEIKLKLIIKKLGYETIQ 75


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 677,452,496
Number of Sequences: 1657284
Number of extensions: 13095828
Number of successful extensions: 30224
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 29091
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30217
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59677054775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).