SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5UAT5 Cluster: 60S ribosomal protein L6; n=15; Bilater...   184   1e-45
UniRef50_Q9V9W3 Cluster: 60S ribosomal protein L6; n=6; Metazoa|...   120   2e-26
UniRef50_Q5DE99 Cluster: 60S ribosomal protein L6; n=1; Schistos...   100   2e-20
UniRef50_A3F4R4 Cluster: 60S ribosomal protein L6; n=1; Taenia a...   100   4e-20
UniRef50_Q02878 Cluster: 60S ribosomal protein L6; n=71; Euteleo...    98   1e-19
UniRef50_A7L698 Cluster: 60S ribosomal protein L6; n=1; Artemia ...    97   2e-19
UniRef50_A7S4S4 Cluster: Predicted protein; n=5; Eukaryota|Rep: ...    96   4e-19
UniRef50_Q6B8B0 Cluster: 60S ribosomal protein L6; n=1; Ixodes p...    95   7e-19
UniRef50_P47991 Cluster: 60S ribosomal protein L6; n=2; Caenorha...    94   2e-18
UniRef50_Q54D63 Cluster: 60S ribosomal protein L6; n=2; Eukaryot...    93   5e-18
UniRef50_Q5CM54 Cluster: 60S ribosomal protein L6; n=2; Cryptosp...    89   5e-17
UniRef50_Q01IK4 Cluster: 60S ribosomal protein L6; n=17; Eukaryo...    87   2e-16
UniRef50_Q9C9C6 Cluster: 60S ribosomal protein L6-2; n=11; Eukar...    87   3e-16
UniRef50_Q4N3I8 Cluster: 60S ribosomal protein L6e, putative; n=...    79   5e-14
UniRef50_Q02326 Cluster: 60S ribosomal protein L6-A; n=16; Dikar...    78   1e-13
UniRef50_A0CYT3 Cluster: 60S ribosomal protein L6; n=5; Oligohym...    77   2e-13
UniRef50_Q7XY83 Cluster: 60S ribosomal protein L6; n=1; Griffith...    77   3e-13
UniRef50_UPI0000DA1E66 Cluster: PREDICTED: similar to ribosomal ...    76   6e-13
UniRef50_Q1DRV0 Cluster: 60S ribosomal protein L6; n=15; Pezizom...    75   1e-12
UniRef50_Q7SH22 Cluster: 60S ribosomal protein L6; n=2; Sordaria...    74   2e-12
UniRef50_Q4X638 Cluster: 60S ribosomal subunit protein L6e, puta...    67   3e-10
UniRef50_A5C5P0 Cluster: 60S ribosomal protein L6; n=1; Vitis vi...    63   5e-09
UniRef50_Q4Q4D3 Cluster: 60S ribosomal protein L6, putative; n=1...    61   1e-08
UniRef50_A0N0S1 Cluster: 60S ribosomal protein L6; n=1; Strongyl...    56   5e-07
UniRef50_A2EBD1 Cluster: 60S ribosomal protein L6, putative; n=7...    54   2e-06
UniRef50_Q98RL7 Cluster: 60S ribosomal protein L6B; n=1; Guillar...    47   2e-04
UniRef50_Q8SR91 Cluster: 60S RIBOSOMAL PROTEIN L6; n=1; Encephal...    47   2e-04
UniRef50_UPI0000DC20AA Cluster: UPI0000DC20AA related cluster; n...    44   0.002
UniRef50_Q8U2L5 Cluster: 50S ribosomal protein L14e; n=5; Archae...    39   0.085
UniRef50_Q8ZYB4 Cluster: 50S ribosomal protein L14e; n=14; Archa...    38   0.11 
UniRef50_Q7QVA1 Cluster: 60S ribosomal protein L27; n=1; Giardia...    38   0.15 
UniRef50_P54054 Cluster: 50S ribosomal protein L14e; n=8; Euryar...    38   0.20 
UniRef50_A2RKU3 Cluster: Cation-transporting ATPase; n=2; Lactoc...    36   0.60 
UniRef50_A7QIH5 Cluster: Chromosome chr12 scaffold_103, whole ge...    36   0.60 
UniRef50_Q7NID4 Cluster: Gll2249 protein; n=8; Cyanobacteria|Rep...    33   5.6  
UniRef50_Q1DLT5 Cluster: Putative uncharacterized protein; n=1; ...    32   7.3  
UniRef50_UPI0000660030 Cluster: Homolog of Homo sapiens "Homo sa...    32   9.7  
UniRef50_Q2JYJ6 Cluster: Putative kinase/esterase protein; n=1; ...    32   9.7  
UniRef50_A6PPY5 Cluster: Alpha-L-rhamnosidase; n=1; Victivallis ...    32   9.7  
UniRef50_A4RKD3 Cluster: Putative uncharacterized protein; n=1; ...    32   9.7  

>UniRef50_Q5UAT5 Cluster: 60S ribosomal protein L6; n=15;
           Bilateria|Rep: 60S ribosomal protein L6 - Bombyx mori
           (Silk moth)
          Length = 273

 Score =  184 bits (448), Expect = 1e-45
 Identities = 86/88 (97%), Positives = 86/88 (97%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL 434
           LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL
Sbjct: 122 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL 181

Query: 435 GNFKLPKHFNDDYFKKNKKCVKRTVNAK 518
           GNFKLPKHFNDDYFKKNKKCVKRTV  K
Sbjct: 182 GNFKLPKHFNDDYFKKNKKCVKRTVKRK 209



 Score =  153 bits (372), Expect = 2e-36
 Identities = 74/85 (87%), Positives = 74/85 (87%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFY 180
           GVMRFSKSKMFHKKAKYKFIG           LTVVVKQIGGEKNGGTRTVPLKRRKSFY
Sbjct: 37  GVMRFSKSKMFHKKAKYKFIGKKNPKPEKPKKLTVVVKQIGGEKNGGTRTVPLKRRKSFY 96

Query: 181 PTQEKIRASSGGRPFSKHVRRIRPN 255
           PTQEKIRASSGGRPFSKHVRRIRPN
Sbjct: 97  PTQEKIRASSGGRPFSKHVRRIRPN 121


>UniRef50_Q9V9W3 Cluster: 60S ribosomal protein L6; n=6;
           Metazoa|Rep: 60S ribosomal protein L6 - Drosophila
           melanogaster (Fruit fly)
          Length = 262

 Score =  120 bits (289), Expect = 2e-26
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAGRH GKRVVL+ +L SGLLLVTGPFA NSCPLRR+ QRYVIGTS+++ LG F
Sbjct: 117 GTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAF 176

Query: 444 KLPKHFNDDYFKKNK-KCVKRTVNA 515
           K+P+H ND YF++ K K  K+T  A
Sbjct: 177 KVPEHLNDAYFRRLKAKKDKKTGEA 201



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 31/85 (36%), Positives = 47/85 (55%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFY 180
           G++R+SK++M+ ++A Y+                  VK+IGG KNGG RTV LK+ K+ Y
Sbjct: 29  GILRYSKAQMYKRRALYRLKDKKSPVVEKAKVPIKKVKKIGGPKNGGERTVFLKKSKASY 88

Query: 181 PTQEKIRASSGGRPFSKHVRRIRPN 255
           PT+  ++       FS+H R  R N
Sbjct: 89  PTKTFVKKRPSKANFSEHKRNTRRN 113


>UniRef50_Q5DE99 Cluster: 60S ribosomal protein L6; n=1; Schistosoma
           japonicum|Rep: 60S ribosomal protein L6 - Schistosoma
           japonicum (Blood fluke)
          Length = 238

 Score =  100 bits (239), Expect = 2e-20
 Identities = 45/78 (57%), Positives = 58/78 (74%)
 Frame = +3

Query: 249 TQLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRI 428
           + ++ GTV ILLAG H GKRV+ +  L SGLLLVTGPF +N  PLRR+ Q YVI TSTRI
Sbjct: 89  SSIQPGTVLILLAGPHKGKRVIFLKALKSGLLLVTGPFKYNGVPLRRVNQCYVIATSTRI 148

Query: 429 SLGNFKLPKHFNDDYFKK 482
            +  F +PKH +D+YF++
Sbjct: 149 DISKFDVPKHIDDEYFRR 166


>UniRef50_A3F4R4 Cluster: 60S ribosomal protein L6; n=1; Taenia
           asiatica|Rep: 60S ribosomal protein L6 - Taenia asiatica
           (Asian tapeworm)
          Length = 212

 Score = 99.5 bits (237), Expect = 4e-20
 Identities = 46/83 (55%), Positives = 58/83 (69%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           G V ILLAGRH  KRVV +  L SGLLLVTGPF +N  PLRR+ QRYVI T TRI + N 
Sbjct: 100 GKVLILLAGRHRAKRVVFLKSLASGLLLVTGPFKYNGVPLRRVNQRYVIATKTRIKIKNI 159

Query: 444 KLPKHFNDDYFKKNKKCVKRTVN 512
           K+P   ND++F++     K++V+
Sbjct: 160 KIPSQLNDEFFRRQDLKTKKSVD 182


>UniRef50_Q02878 Cluster: 60S ribosomal protein L6; n=71;
           Euteleostomi|Rep: 60S ribosomal protein L6 - Homo
           sapiens (Human)
          Length = 288

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>UniRef50_A7L698 Cluster: 60S ribosomal protein L6; n=1; Artemia
           franciscana|Rep: 60S ribosomal protein L6 - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 241

 Score = 97.1 bits (231), Expect = 2e-19
 Identities = 49/95 (51%), Positives = 64/95 (67%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL 434
           L+ GT+ ILLAG + GKRVVL+  L SGLLLV+GP   N  PLRR+ Q+ VI TSTRI +
Sbjct: 95  LQPGTILILLAGVNRGKRVVLLKALKSGLLLVSGPLKVNRVPLRRVHQKLVIATSTRIDI 154

Query: 435 GNFKLPKHFNDDYFKKNKKCVKRTVNAKRVMTSLP 539
            N K+P+H ND YF+++K  VK+      +  S P
Sbjct: 155 SNVKVPEHINDTYFRRHK--VKKEAKEGDIFASKP 187



 Score = 38.3 bits (85), Expect = 0.11
 Identities = 15/31 (48%), Positives = 21/31 (67%)
 Frame = +1

Query: 103 VVVKQIGGEKNGGTRTVPLKRRKSFYPTQEK 195
           V+ K+IGG+KNGGTR V  ++   FYP   +
Sbjct: 44  VIEKKIGGDKNGGTRLVSTRKPPQFYPINSR 74


>UniRef50_A7S4S4 Cluster: Predicted protein; n=5; Eukaryota|Rep:
           Predicted protein - Nematostella vectensis
          Length = 244

 Score = 96.3 bits (229), Expect = 4e-19
 Identities = 52/83 (62%), Positives = 58/83 (69%), Gaps = 2/83 (2%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAG H GKRVV +  L SGLLLVTGPF  N  PLRRIPQ YVI TST I + + 
Sbjct: 103 GTVLILLAGAHRGKRVVFLKQLNSGLLLVTGPFKINGVPLRRIPQSYVIATSTHIDVSDV 162

Query: 444 KLPKH-FNDD-YFKKNKKCVKRT 506
           KLP+H F D+ YFK   K  KR+
Sbjct: 163 KLPEHAFADESYFKGEPKKKKRS 185



 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 24/64 (37%), Positives = 36/64 (56%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFY 180
           G+ R+S+S ++ K+A YK               T   K IGG+KNGG R VP++R   +Y
Sbjct: 18  GISRYSRSAIYKKRALYKRKKTGVKKVVQDEPRTKT-KDIGGDKNGGKRVVPVQRESRYY 76

Query: 181 PTQE 192
           PT++
Sbjct: 77  PTED 80


>UniRef50_Q6B8B0 Cluster: 60S ribosomal protein L6; n=1; Ixodes
           pacificus|Rep: 60S ribosomal protein L6 - Ixodes
           pacificus (western blacklegged tick)
          Length = 268

 Score = 95.5 bits (227), Expect = 7e-19
 Identities = 46/75 (61%), Positives = 54/75 (72%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAG H GKRVV +  L +GLL VTGP+  N CPLRRI Q YVI TST++ L   
Sbjct: 123 GTVLILLAGPHRGKRVVFLKQLKTGLLPVTGPYGVNGCPLRRINQIYVIATSTKLDLSKV 182

Query: 444 KLPKHFNDDYFKKNK 488
           KLP+  +D YFK+NK
Sbjct: 183 KLPEGLDDRYFKRNK 197



 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 27/64 (42%), Positives = 37/64 (57%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFY 180
           GV  FS+SKMFHK+  +K                V VK++ GEKNGG R +PLK+ +  Y
Sbjct: 33  GVWLFSRSKMFHKRGLFKVKHAAPTKEKRKRKKRVTVKRVKGEKNGGKRVLPLKKERRSY 92

Query: 181 PTQE 192
           PT++
Sbjct: 93  PTED 96


>UniRef50_P47991 Cluster: 60S ribosomal protein L6; n=2;
           Caenorhabditis|Rep: 60S ribosomal protein L6 -
           Caenorhabditis elegans
          Length = 217

 Score = 93.9 bits (223), Expect = 2e-18
 Identities = 46/84 (54%), Positives = 57/84 (67%), Gaps = 1/84 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILP-SGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGN 440
           GTV I+LAGRH GKRVV +  LP SGLLLVTGP   N  PLRRI Q +VI TS ++++  
Sbjct: 74  GTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSG 133

Query: 441 FKLPKHFNDDYFKKNKKCVKRTVN 512
            K+P+H ND+YFK+     K   N
Sbjct: 134 VKIPEHINDEYFKRKSTAQKTGKN 157


>UniRef50_Q54D63 Cluster: 60S ribosomal protein L6; n=2;
           Eukaryota|Rep: 60S ribosomal protein L6 - Dictyostelium
           discoideum AX4
          Length = 236

 Score = 92.7 bits (220), Expect = 5e-18
 Identities = 46/84 (54%), Positives = 56/84 (66%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV I+LAGR AGKRVV +  L SGL+L+TGPF  N  PLRRI QRYVI TST+I + + 
Sbjct: 94  GTVLIILAGRFAGKRVVALKQLDSGLILITGPFKVNGVPLRRIDQRYVIATSTKIDVSSV 153

Query: 444 KLPKHFNDDYFKKNKKCVKRTVNA 515
           K+    ND YF   KK   ++  A
Sbjct: 154 KVAATINDAYFAAEKKSTTKSEGA 177


>UniRef50_Q5CM54 Cluster: 60S ribosomal protein L6; n=2;
           Cryptosporidium|Rep: 60S ribosomal protein L6 -
           Cryptosporidium hominis
          Length = 184

 Score = 89.4 bits (212), Expect = 5e-17
 Identities = 41/89 (46%), Positives = 63/89 (70%)
 Frame = +3

Query: 249 TQLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRI 428
           + L+ G VCILLAG + GKRVV++  LPSGL++VTGP+A N  P+RR+   Y+I TST++
Sbjct: 37  SSLQPGVVCILLAGPYKGKRVVMLKALPSGLVVVTGPYALNGVPVRRVNPAYIIATSTKV 96

Query: 429 SLGNFKLPKHFNDDYFKKNKKCVKRTVNA 515
            +    + K F D+YFK ++  +K++ +A
Sbjct: 97  DVSKADVSK-FTDEYFKVDRSKLKKSKDA 124


>UniRef50_Q01IK4 Cluster: 60S ribosomal protein L6; n=17;
           Eukaryota|Rep: 60S ribosomal protein L6 - Oryza sativa
           (Rice)
          Length = 222

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 46/87 (52%), Positives = 59/87 (67%), Gaps = 4/87 (4%)
 Frame = +3

Query: 243 DPTQLKI----GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVI 410
           +PT+L+     GTV ILLAGR  GKRVV +  L SGLLLVTGPF  N  P+RR+ Q YVI
Sbjct: 70  NPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVTGPFKINGVPIRRVNQPYVI 129

Query: 411 GTSTRISLGNFKLPKHFNDDYFKKNKK 491
            TST++ +    + K F+D YF ++KK
Sbjct: 130 ATSTKVDISGVNVEK-FDDKYFSRDKK 155


>UniRef50_Q9C9C6 Cluster: 60S ribosomal protein L6-2; n=11;
           Eukaryota|Rep: 60S ribosomal protein L6-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 233

 Score = 86.6 bits (205), Expect = 3e-16
 Identities = 44/73 (60%), Positives = 51/73 (69%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV I+LAGR  GKRVV +  L SGLLLVTGPF  N  PLRR+ Q YVIGTST++ +   
Sbjct: 92  GTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGV 151

Query: 444 KLPKHFNDDYFKK 482
            L K F+D YF K
Sbjct: 152 TLDK-FDDKYFGK 163


>UniRef50_Q4N3I8 Cluster: 60S ribosomal protein L6e, putative; n=3;
           Piroplasmida|Rep: 60S ribosomal protein L6e, putative -
           Theileria parva
          Length = 212

 Score = 79.4 bits (187), Expect = 5e-14
 Identities = 38/58 (65%), Positives = 44/58 (75%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRI 428
           LK G V ILL G + GKRVVL+ +L SGLLLVTGPF+FN  PLRR+  RYVI TST +
Sbjct: 44  LKPGAVLILLTGSYKGKRVVLLKVLKSGLLLVTGPFSFNGVPLRRVNSRYVIATSTNV 101


>UniRef50_Q02326 Cluster: 60S ribosomal protein L6-A; n=16;
           Dikarya|Rep: 60S ribosomal protein L6-A - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 176

 Score = 78.2 bits (184), Expect = 1e-13
 Identities = 42/84 (50%), Positives = 51/84 (60%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAGR  GKRVV +  L    LL++GPF  N  PLRR+  RYVI TST++S+   
Sbjct: 37  GTVLILLAGRFRGKRVVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGV 96

Query: 444 KLPKHFNDDYFKKNKKCVKRTVNA 515
            + K FN +YF K K   K    A
Sbjct: 97  NVEK-FNVEYFAKEKLTKKEKKEA 119


>UniRef50_A0CYT3 Cluster: 60S ribosomal protein L6; n=5;
           Oligohymenophorea|Rep: 60S ribosomal protein L6 -
           Paramecium tetraurelia
          Length = 208

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 39/75 (52%), Positives = 48/75 (64%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           G V ILL+GR  GKRVV +  L SGLLLVTGPF  N  PL+R+   YVI TST++ +   
Sbjct: 61  GQVLILLSGRFQGKRVVFLKQLKSGLLLVTGPFKINGVPLKRVNSAYVIPTSTKVDVTGV 120

Query: 444 KLPKHFNDDYFKKNK 488
                 NDDYFK+ +
Sbjct: 121 N-ANQINDDYFKRTQ 134


>UniRef50_Q7XY83 Cluster: 60S ribosomal protein L6; n=1; Griffithsia
           japonica|Rep: 60S ribosomal protein L6 - Griffithsia
           japonica (Red alga)
          Length = 216

 Score = 76.6 bits (180), Expect = 3e-13
 Identities = 42/85 (49%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL 434
           +K GT+ ILLAG   G RVV++  L SG LLVTGP+A N  PL R+ QRYVI TST I +
Sbjct: 72  IKSGTIVILLAGVFRGSRVVVLKQLDSGQLLVTGPYAVNRIPLTRVDQRYVIATSTSIDV 131

Query: 435 GNFKLPKHFNDDYFKKNKKCVKRTV 509
               + K  ++ YF+K +K  K  V
Sbjct: 132 SKVDV-KKIDNAYFRKPQKKKKTDV 155



 Score = 36.7 bits (81), Expect = 0.34
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 97  LTVVVKQIGGEKNGGTRTVPLKRRKSFYPTQEK 195
           + ++ K IGG KNGG R VP K+   +YP  +K
Sbjct: 20  IKMIKKPIGGAKNGGYRLVPEKKGPKWYPADDK 52


>UniRef50_UPI0000DA1E66 Cluster: PREDICTED: similar to ribosomal
           protein L6; n=5; Eutheria|Rep: PREDICTED: similar to
           ribosomal protein L6 - Rattus norvegicus
          Length = 112

 Score = 75.8 bits (178), Expect = 6e-13
 Identities = 39/72 (54%), Positives = 45/72 (62%)
 Frame = +3

Query: 267 TVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFK 446
           TV I+L GRH GKRVV +  L SGLLLVTGP A N  PL R+ Q  VI T T++ +   K
Sbjct: 13  TVLIILTGRHRGKRVVFLKQLGSGLLLVTGPLALNRVPLCRMHQSVVISTFTKVDICKVK 72

Query: 447 LPKHFNDDYFKK 482
             KH  D  FKK
Sbjct: 73  TSKHLTDASFKK 84


>UniRef50_Q1DRV0 Cluster: 60S ribosomal protein L6; n=15;
           Pezizomycotina|Rep: 60S ribosomal protein L6 -
           Coccidioides immitis
          Length = 206

 Score = 74.5 bits (175), Expect = 1e-12
 Identities = 40/81 (49%), Positives = 50/81 (61%), Gaps = 3/81 (3%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL 434
           L+ GT+ ILLAGR  GKRV+L+  L  G+LLVTGPF  N  PLRR+  RYVI TS+ + L
Sbjct: 58  LQPGTILILLAGRFRGKRVILLKHLGQGVLLVTGPFKLNGVPLRRVNARYVIATSSTVDL 117

Query: 435 GNF---KLPKHFNDDYFKKNK 488
                  L K    +YF + K
Sbjct: 118 NGVDQKTLEKVSQPEYFTREK 138


>UniRef50_Q7SH22 Cluster: 60S ribosomal protein L6; n=2;
           Sordariaceae|Rep: 60S ribosomal protein L6 - Neurospora
           crassa
          Length = 207

 Score = 73.7 bits (173), Expect = 2e-12
 Identities = 36/57 (63%), Positives = 41/57 (71%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL 434
           GTV ILLAGR  GKRVVL+  L  G+LLVTGPF  N  PLRR+  RYVI TS ++ L
Sbjct: 42  GTVLILLAGRFRGKRVVLLKALDQGVLLVTGPFKINGVPLRRVNARYVIATSQKVDL 98


>UniRef50_Q4X638 Cluster: 60S ribosomal subunit protein L6e,
           putative; n=5; Plasmodium|Rep: 60S ribosomal subunit
           protein L6e, putative - Plasmodium chabaudi
          Length = 241

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 28/60 (46%), Positives = 41/60 (68%)
 Frame = +3

Query: 249 TQLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRI 428
           + +++G V I+L G+H GKR ++  +L SGLL V GP+  N  PL+R+  RY+I TST I
Sbjct: 72  SSIQVGKVAIILTGKHMGKRCIIAKVLKSGLLAVVGPYEVNGVPLKRVDPRYLIVTSTNI 131


>UniRef50_A5C5P0 Cluster: 60S ribosomal protein L6; n=1; Vitis
           vinifera|Rep: 60S ribosomal protein L6 - Vitis vinifera
           (Grape)
          Length = 249

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 32/68 (47%), Positives = 43/68 (63%)
 Frame = +3

Query: 303 KRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYFKK 482
           KRVV +  L SGLLL+TG F  N  PLRR+ Q YVI TST++ +    + K F+D YF K
Sbjct: 156 KRVVFLKQLSSGLLLITGSFKINGVPLRRVNQAYVIATSTKVDIPKVNVEK-FDDKYFAK 214

Query: 483 NKKCVKRT 506
             +  +R+
Sbjct: 215 KVQKKRRS 222


>UniRef50_Q4Q4D3 Cluster: 60S ribosomal protein L6, putative; n=11;
           Trypanosomatidae|Rep: 60S ribosomal protein L6, putative
           - Leishmania major
          Length = 195

 Score = 61.3 bits (142), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 1/60 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILP-SGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGN 440
           G + I+LAGR  G+R V++  LP +G L+V+GP  +N  P+RRI  RYVI TST + + +
Sbjct: 36  GAIAIILAGRFRGRRAVILKQLPHNGPLVVSGPMKYNGVPIRRIDSRYVIATSTTVDISS 95


>UniRef50_A0N0S1 Cluster: 60S ribosomal protein L6; n=1;
           Strongyloides papillosus|Rep: 60S ribosomal protein L6 -
           Strongyloides papillosus
          Length = 127

 Score = 56.0 bits (129), Expect = 5e-07
 Identities = 23/50 (46%), Positives = 32/50 (64%)
 Frame = +3

Query: 339 LLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYFKKNK 488
           L    GPF+ N  P+RRI Q++V+ TST+I +   K+P    DDYFK+ K
Sbjct: 10  LFTFLGPFSINGVPVRRIAQKFVLPTSTKIDVSGVKIPATMTDDYFKRTK 59


>UniRef50_A2EBD1 Cluster: 60S ribosomal protein L6, putative; n=7;
           Trichomonas vaginalis G3|Rep: 60S ribosomal protein L6,
           putative - Trichomonas vaginalis G3
          Length = 151

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 4/77 (5%)
 Frame = +3

Query: 216 PSIQQACTQDPTQ----LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPL 383
           P ++ AC   P +    LK+GTV I++ G H GKR V+V    +G++ + GP      P+
Sbjct: 39  PLVKPACAAKPVETRPSLKVGTVVIVVGGEHQGKRAVVVADQGAGIVKIAGPVV----PV 94

Query: 384 RRIPQRYVIGTSTRISL 434
             I Q Y+I TST I +
Sbjct: 95  NEISQDYLIATSTSIEV 111


>UniRef50_Q98RL7 Cluster: 60S ribosomal protein L6B; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L6B - Guillardia theta
           (Cryptomonas phi)
          Length = 169

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 27/78 (34%), Positives = 41/78 (52%)
 Frame = +3

Query: 258 KIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLG 437
           KIG + I+    + GK+ V +G    G LL++G   FN     +I  +YV+ +   +   
Sbjct: 43  KIGDILIIKKRNNYGKKCVFLGHTDDGNLLLSGIMKFNGIGYLKIHWKYVVKSGVSLKGL 102

Query: 438 NFKLPKHFNDDYFKKNKK 491
           NF L KH N DY ++ KK
Sbjct: 103 NF-LTKHTNKDYLEELKK 119


>UniRef50_Q8SR91 Cluster: 60S RIBOSOMAL PROTEIN L6; n=1;
           Encephalitozoon cuniculi|Rep: 60S RIBOSOMAL PROTEIN L6 -
           Encephalitozoon cuniculi
          Length = 155

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 25/62 (40%), Positives = 35/62 (56%)
 Frame = +3

Query: 249 TQLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRI 428
           T L  G V ++L G  A +RVV +  L   + L  GP + N  PL RI +RY++ TST +
Sbjct: 25  TDLVKGMVVVVLEGVFASRRVVYLKGLEDNIALCAGPKSINGIPLFRIDERYLLATSTVL 84

Query: 429 SL 434
            L
Sbjct: 85  DL 86


>UniRef50_UPI0000DC20AA Cluster: UPI0000DC20AA related cluster; n=2;
           Rattus norvegicus|Rep: UPI0000DC20AA UniRef100 entry -
           Rattus norvegicus
          Length = 261

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/55 (45%), Positives = 34/55 (61%)
 Frame = +3

Query: 267 TVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRIS 431
           TV I++ G+H  +RVV +  L  G LL+TGP A N   L R  Q+ V+ TST I+
Sbjct: 138 TVLIIITGQH--RRVVFLKQLSRGFLLITGPLALNLVLLYRTHQKSVVITSTTIN 190



 Score = 32.3 bits (70), Expect = 7.3
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSF 177
           G  R+S   ++ +K  Y  +            +  V+K + G+KNGGT  V L++ K +
Sbjct: 56  GTGRYSIKALYERK--YSAVKSKCEKKKKEKVVATVIKTVSGDKNGGTGVVKLQKMKMY 112


>UniRef50_Q8U2L5 Cluster: 50S ribosomal protein L14e; n=5;
           Archaea|Rep: 50S ribosomal protein L14e - Pyrococcus
           furiosus
          Length = 83

 Score = 38.7 bits (86), Expect = 0.085
 Identities = 17/51 (33%), Positives = 32/51 (62%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYV 407
           + +G + +++AGR AG++VV+V I+    +LVTG    N    RR+  +++
Sbjct: 4   IDVGRIAVVIAGRRAGQKVVVVDIIDKNFVLVTGA-GLNKVKRRRMNIKHI 53


>UniRef50_Q8ZYB4 Cluster: 50S ribosomal protein L14e; n=14;
           Archaea|Rep: 50S ribosomal protein L14e - Pyrobaculum
           aerophilum
          Length = 103

 Score = 38.3 bits (85), Expect = 0.11
 Identities = 17/60 (28%), Positives = 32/60 (53%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISL 434
           + IG V + + GR AG++ V+V I+    +++TGP        RR+   ++  T  +I +
Sbjct: 5   IDIGRVVVKVLGREAGRKAVVVDIVDENYVVITGPKPITGVKRRRVNINHIEPTDKKIDI 64


>UniRef50_Q7QVA1 Cluster: 60S ribosomal protein L27; n=1; Giardia
           lamblia ATCC 50803|Rep: 60S ribosomal protein L27 -
           Giardia lamblia ATCC 50803
          Length = 135

 Score = 37.9 bits (84), Expect = 0.15
 Identities = 16/26 (61%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILP 332
           +K G VCI+L GRHAGK+ V+V  LP
Sbjct: 6   IKPGLVCIVLQGRHAGKKAVIVEALP 31


>UniRef50_P54054 Cluster: 50S ribosomal protein L14e; n=8;
           Euryarchaeota|Rep: 50S ribosomal protein L14e -
           Methanococcus jannaschii
          Length = 80

 Score = 37.5 bits (83), Expect = 0.20
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRI 392
           +++G VCI  AGR AGK  V+V IL    ++V G      C ++ +
Sbjct: 4   IEVGRVCIKTAGREAGKVCVIVDILDKNFVIVDGLVKRRRCNIKHL 49


>UniRef50_A2RKU3 Cluster: Cation-transporting ATPase; n=2;
           Lactococcus lactis subsp. cremoris|Rep:
           Cation-transporting ATPase - Lactococcus lactis subsp.
           cremoris (strain MG1363)
          Length = 841

 Score = 35.9 bits (79), Expect = 0.60
 Identities = 16/44 (36%), Positives = 29/44 (65%), Gaps = 2/44 (4%)
 Frame = +3

Query: 306 RVVLVGILPSGLLLVTGPFAFNSCPLRRIPQR--YVIGTSTRIS 431
           +++++GI+P  +L++   F F+S  L  IPQR   +IGT+  I+
Sbjct: 215 KIIVIGIIPISILVLLNQFVFSSLDLSVIPQRKTAIIGTAATIT 258


>UniRef50_A7QIH5 Cluster: Chromosome chr12 scaffold_103, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome chr12 scaffold_103, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 345

 Score = 35.9 bits (79), Expect = 0.60
 Identities = 21/39 (53%), Positives = 24/39 (61%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCP 380
           GTV I+LAGR     VV +  L SGLLL+TG F  N  P
Sbjct: 235 GTVLIILAGR-----VVFLKQLSSGLLLITGSFKINDVP 268


>UniRef50_Q7NID4 Cluster: Gll2249 protein; n=8; Cyanobacteria|Rep:
           Gll2249 protein - Gloeobacter violaceus
          Length = 544

 Score = 32.7 bits (71), Expect = 5.6
 Identities = 20/56 (35%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 KRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDD 470
           + +V  G +  GL+L      F S PL    Q + +G +T   +G   LP+HFNDD
Sbjct: 41  QEIVTCGQVLKGLIL--NGLGFVSAPLYLFEQ-FFVGKATEHLIGPGVLPEHFNDD 93


>UniRef50_Q1DLT5 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 860

 Score = 32.3 bits (70), Expect = 7.3
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = -2

Query: 305 LACMSTSEENANSSYLQLGRILRTCLLNGRPPDEAR 198
           ++CM +SE +A + YLQLG  +R  L   R   EAR
Sbjct: 226 VSCMQSSELSAEARYLQLGADIREELYKARQAREAR 261


>UniRef50_UPI0000660030 Cluster: Homolog of Homo sapiens "Homo
           sapiens mRNA related with psoriasis, complete cds; n=3;
           Clupeocephala|Rep: Homolog of Homo sapiens "Homo sapiens
           mRNA related with psoriasis, complete cds - Takifugu
           rubripes
          Length = 113

 Score = 31.9 bits (69), Expect = 9.7
 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%)
 Frame = +2

Query: 311 CTCWNSAQRSAFSYWTF-CFQFVPATPYSSALC 406
           C CW+   +  F++W F CF  + A      LC
Sbjct: 25  CDCWSDLPQCCFAFWCFPCFACITAREAGECLC 57


>UniRef50_Q2JYJ6 Cluster: Putative kinase/esterase protein; n=1;
           Rhizobium etli CFN 42|Rep: Putative kinase/esterase
           protein - Rhizobium etli (strain CFN 42 / ATCC 51251)
          Length = 588

 Score = 31.9 bits (69), Expect = 9.7
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = -1

Query: 345 KADRWAEFQQVQPSCLHVYQRGECKQFLSSVGSDPAYMLAEWTAT 211
           K+D  +EF+ ++P     Y R   + F+ + G DP ++ AEW  T
Sbjct: 96  KSDYASEFRIIRPDGAIRYLRSRARYFVDAAG-DPCFVGAEWDVT 139


>UniRef50_A6PPY5 Cluster: Alpha-L-rhamnosidase; n=1; Victivallis
           vadensis ATCC BAA-548|Rep: Alpha-L-rhamnosidase -
           Victivallis vadensis ATCC BAA-548
          Length = 763

 Score = 31.9 bits (69), Expect = 9.7
 Identities = 15/29 (51%), Positives = 17/29 (58%)
 Frame = -3

Query: 334 LGRIPTSTTLLPACLPARRMQTVPIFSWV 248
           LGR      LL  C PAR   T+PIFSW+
Sbjct: 428 LGRGIRPDGLLELCAPARVPVTIPIFSWI 456


>UniRef50_A4RKD3 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 1009

 Score = 31.9 bits (69), Expect = 9.7
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +2

Query: 170 SPSTPLRRKSVLHLVAVHSASMYAGSDPTEDRNCLHSPRW 289
           S  T L R S+L  + +  A   +G++  E +N +HSP W
Sbjct: 505 SSGTRLHRLSLLPKLMIGKARKQSGTESAESQNNVHSPEW 544


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 540,872,608
Number of Sequences: 1657284
Number of extensions: 10878143
Number of successful extensions: 28803
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 27895
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28761
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 34572633001
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).