SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q16RN6 Cluster: Adp,atp carrier protein; n=1; Aedes aeg...   142   7e-33
UniRef50_P12235 Cluster: ADP/ATP translocase 1; n=108; Eukaryota...   118   2e-25
UniRef50_P12236 Cluster: ADP/ATP translocase 3; n=11; Euteleosto...   115   1e-24
UniRef50_P05141 Cluster: ADP/ATP translocase 2; n=61; Eukaryota|...   113   3e-24
UniRef50_Q9H0C2 Cluster: ADP/ATP translocase 4; n=17; Eukaryota|...   103   6e-21
UniRef50_Q8LFZ1 Cluster: ADP/ATP translocase-like protein; n=10;...    85   2e-15
UniRef50_Q21809 Cluster: Putative uncharacterized protein; n=2; ...    74   3e-12
UniRef50_P91270 Cluster: Putative uncharacterized protein F25B4....    72   1e-11
UniRef50_Q22HD2 Cluster: Mitochondrial carrier protein; n=1; Tet...    68   2e-10
UniRef50_Q76KG1 Cluster: ADP/ATP carrier protein; n=1; Penicilli...    67   5e-10
UniRef50_A0E0L6 Cluster: Chromosome undetermined scaffold_71, wh...    66   7e-10
UniRef50_P04710 Cluster: ADP,ATP carrier protein 1; n=163; Eukar...    64   4e-09
UniRef50_A5BXJ8 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_Q18683 Cluster: Putative uncharacterized protein; n=2; ...    56   1e-06
UniRef50_A0BYX2 Cluster: Chromosome undetermined scaffold_138, w...    54   5e-06
UniRef50_UPI00006D001E Cluster: Mitochondrial carrier protein; n...    53   9e-06
UniRef50_Q7RGQ7 Cluster: Mitochondrial carrier protein, putative...    53   9e-06
UniRef50_A7SPF1 Cluster: Predicted protein; n=2; Nematostella ve...    53   9e-06
UniRef50_Q8ID23 Cluster: Mitochondrial carrier protein, putative...    52   1e-05
UniRef50_Q23PQ2 Cluster: Mitochondrial carrier protein; n=2; Tet...    51   3e-05
UniRef50_UPI0000DB7B77 Cluster: PREDICTED: similar to ADP/ATP tr...    49   1e-04
UniRef50_UPI00006CC149 Cluster: Mitochondrial carrier protein; n...    49   1e-04
UniRef50_UPI00015B491F Cluster: PREDICTED: similar to mitochondr...    48   2e-04
UniRef50_Q014S0 Cluster: Mitochondrial fatty acid anion carrier ...    48   3e-04
UniRef50_Q4MZZ5 Cluster: Mitochondrial carrier protein, putative...    48   3e-04
UniRef50_Q4D533 Cluster: Mitochondrial carrier protein, putative...    48   3e-04
UniRef50_P43617 Cluster: Putative mitochondrial carrier YFR045W;...    46   0.001
UniRef50_A2DUD3 Cluster: Mitochondrial carrier protein; n=1; Tri...    45   0.002
UniRef50_Q176S5 Cluster: Mitochondrial carrier protein; n=3; Cul...    44   0.003
UniRef50_Q4WGJ2 Cluster: Mitochondrial carrier protein, putative...    44   0.003
UniRef50_UPI0000D55AE5 Cluster: PREDICTED: similar to solute car...    44   0.004
UniRef50_Q581R5 Cluster: Mitochondrial carrier protein, putative...    44   0.004
UniRef50_Q4UC09 Cluster: Mitochondrial carrier, putative; n=2; T...    44   0.006
UniRef50_UPI000150A0E5 Cluster: Mitochondrial carrier protein; n...    43   0.007
UniRef50_A2FII9 Cluster: Mitochondrial carrier protein; n=1; Tri...    43   0.007
UniRef50_Q5AL11 Cluster: Potential mitochondrial aspartate-gluta...    43   0.007
UniRef50_Q4PBZ8 Cluster: Putative uncharacterized protein; n=4; ...    43   0.010
UniRef50_UPI00015B635C Cluster: PREDICTED: similar to mitochondr...    42   0.013
UniRef50_Q3EAC3 Cluster: Uncharacterized protein At4g03115.1; n=...    42   0.013
UniRef50_Q10MX0 Cluster: Mitochondrial carrier protein, expresse...    42   0.013
UniRef50_Q54EV4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_Q6FN66 Cluster: Similar to tr|Q12482 Saccharomyces cere...    42   0.017
UniRef50_UPI00015B5307 Cluster: PREDICTED: similar to folate car...    42   0.022
UniRef50_Q4SFU1 Cluster: Chromosome 7 SCAF14601, whole genome sh...    42   0.022
UniRef50_A7P3C4 Cluster: Chromosome chr1 scaffold_5, whole genom...    42   0.022
UniRef50_A4RHI3 Cluster: Putative uncharacterized protein; n=2; ...    42   0.022
UniRef50_Q9FK00 Cluster: Similarity to peroxisomal membrane carr...    41   0.030
UniRef50_A4S3P4 Cluster: MC family transporter; n=2; Ostreococcu...    41   0.030
UniRef50_A4RUV7 Cluster: MC family transporter: aspartate/glutam...    41   0.030
UniRef50_Q55A24 Cluster: Putative uncharacterized protein; n=2; ...    41   0.030
UniRef50_Q4P222 Cluster: Putative uncharacterized protein; n=1; ...    41   0.030
UniRef50_P38152 Cluster: Tricarboxylate transport protein; n=14;...    41   0.030
UniRef50_Q84UC7 Cluster: Mitochondrial basic amino acid carrier;...    41   0.039
UniRef50_Q6AVS9 Cluster: Mitochondrial carrier protein-like prot...    41   0.039
UniRef50_A7PU03 Cluster: Chromosome chr7 scaffold_31, whole geno...    41   0.039
UniRef50_Q5E9L8 Cluster: Solute carrier family 25 (Mitochondrial...    41   0.039
UniRef50_Q54BM3 Cluster: Putative uncharacterized protein; n=1; ...    41   0.039
UniRef50_A2DCW8 Cluster: Hydrogenosomal membrane protein 31; n=3...    41   0.039
UniRef50_Q54MZ4 Cluster: Putative uncharacterized protein; n=1; ...    40   0.052
UniRef50_Q0P491 Cluster: Zgc:153273; n=3; Coelomata|Rep: Zgc:153...    40   0.068
UniRef50_Q4A3J5 Cluster: Mitochondrial carrier like protein; n=6...    40   0.068
UniRef50_Q60K80 Cluster: Putative uncharacterized protein CBG241...    40   0.068
UniRef50_Q4DMB4 Cluster: Mitochondrial carrier protein, putative...    40   0.068
UniRef50_Q24GE6 Cluster: Mitochondrial carrier protein; n=1; Tet...    40   0.068
UniRef50_Q57VM4 Cluster: Mitochondrial carrier protein, putative...    40   0.091
UniRef50_Q9BQT8 Cluster: Mitochondrial 2-oxodicarboxylate carrie...    40   0.091
UniRef50_Q8N8R3 Cluster: Mitochondrial carnitine/acylcarnitine c...    40   0.091
UniRef50_UPI00015B5580 Cluster: PREDICTED: similar to mitochondr...    39   0.12 
UniRef50_O95258-3 Cluster: Isoform 3 of O95258 ; n=4; Eutheria|R...    39   0.12 
UniRef50_Q9SUV1 Cluster: Adenylate translocator (Brittle-1)-like...    39   0.12 
UniRef50_O65623 Cluster: Plant uncoupling mitochondrial protein;...    39   0.12 
UniRef50_Q5KE65 Cluster: Tricarboxylate transport protein (Ctp),...    39   0.12 
UniRef50_A7TQ47 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_O95258 Cluster: Brain mitochondrial carrier protein 1; ...    39   0.12 
UniRef50_Q7Q9Q0 Cluster: ENSANGP00000009911; n=4; Culicidae|Rep:...    39   0.16 
UniRef50_Q55BF4 Cluster: Putative uncharacterized protein; n=1; ...    39   0.16 
UniRef50_Q6CCV8 Cluster: Similar to KLLA0B11319g Kluyveromyces l...    39   0.16 
UniRef50_Q2UTE7 Cluster: Mitochondrial tricarboxylate/dicarboxyl...    39   0.16 
UniRef50_Q8I4M0 Cluster: Putative uncharacterized protein; n=3; ...    38   0.21 
UniRef50_P55916 Cluster: Mitochondrial uncoupling protein 3; n=1...    38   0.21 
UniRef50_Q4S8T7 Cluster: Chromosome 7 SCAF14703, whole genome sh...    38   0.28 
UniRef50_Q2R5V9 Cluster: Mitochondrial carrier protein, expresse...    38   0.28 
UniRef50_Q01BW9 Cluster: Mitochondrial solute carrier protein; n...    38   0.28 
UniRef50_Q9GPR5 Cluster: RIM; n=2; Dictyostelium discoideum|Rep:...    38   0.28 
UniRef50_Q54RA3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.28 
UniRef50_P53007 Cluster: Tricarboxylate transport protein, mitoc...    38   0.28 
UniRef50_Q12482 Cluster: Mitochondrial aspartate-glutamate trans...    38   0.28 
UniRef50_UPI0000E4A38B Cluster: PREDICTED: similar to mitochondr...    38   0.37 
UniRef50_A5C1E5 Cluster: Putative uncharacterized protein; n=1; ...    38   0.37 
UniRef50_Q1MVR0 Cluster: Similar to mitochondrial carrier protei...    38   0.37 
UniRef50_Q4PC12 Cluster: Putative uncharacterized protein; n=1; ...    38   0.37 
UniRef50_Q12251 Cluster: Probable mitochondrial carrier YPR011C;...    38   0.37 
UniRef50_Q10248 Cluster: Putative mitochondrial carrier C4G9.20c...    37   0.48 
UniRef50_Q4RRK6 Cluster: Chromosome 16 SCAF15002, whole genome s...    37   0.64 
UniRef50_Q24D15 Cluster: Mitochondrial carrier protein; n=1; Tet...    37   0.64 
UniRef50_P39953 Cluster: Probable mitochondrial carrier YEL006W;...    37   0.64 
UniRef50_Q8WUT9 Cluster: Solute carrier family 25 member 43; n=1...    37   0.64 
UniRef50_Q67Z63 Cluster: Mitochondrial carrier like protein; n=1...    36   0.84 
UniRef50_Q5KGS0 Cluster: Succinate:fumarate antiporter, putative...    36   0.84 
UniRef50_P38127 Cluster: Mitochondrial carrier protein RIM2; n=1...    36   0.84 
UniRef50_Q75AH6 Cluster: Mitochondrial aspartate-glutamate trans...    36   0.84 
UniRef50_Q9VKZ5 Cluster: CG4995-PA, isoform A; n=3; Drosophila m...    36   1.1  
UniRef50_A1Z7S4 Cluster: CG8026-PA, isoform A; n=6; Endopterygot...    36   1.1  
UniRef50_A0D6F3 Cluster: Chromosome undetermined scaffold_4, who...    36   1.1  
UniRef50_A0BLZ2 Cluster: Chromosome undetermined scaffold_115, w...    36   1.1  
UniRef50_A2R479 Cluster: Function: OAC1 of S. cerevisiae is an o...    36   1.1  
UniRef50_Q1ECW7 Cluster: Hepatocellular carcinoma down-regulated...    36   1.1  
UniRef50_Q0E2M9 Cluster: Os02g0226300 protein; n=5; Magnoliophyt...    36   1.5  
UniRef50_Q57UM4 Cluster: Mitochondrial carrier protein, putative...    36   1.5  
UniRef50_Q54DU1 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_Q16YM1 Cluster: Mitochondrial carrier protein ymc; n=1;...    36   1.5  
UniRef50_A7SDS4 Cluster: Predicted protein; n=1; Nematostella ve...    36   1.5  
UniRef50_A0C2U9 Cluster: Chromosome undetermined scaffold_145, w...    36   1.5  
UniRef50_Q750J8 Cluster: AGL047Cp; n=1; Eremothecium gossypii|Re...    36   1.5  
UniRef50_Q01DN6 Cluster: Mitochondrial carnitine-acylcarnitine c...    35   1.9  
UniRef50_Q9VMK1 Cluster: CG9064-PA; n=2; Sophophora|Rep: CG9064-...    35   1.9  
UniRef50_Q9VC40 Cluster: CG5805-PA; n=6; Endopterygota|Rep: CG58...    35   1.9  
UniRef50_Q8N413-4 Cluster: Isoform 4 of Q8N413 ; n=3; Eutheria|R...    35   2.6  
UniRef50_Q8LDF6 Cluster: Putative mitochondrial dicarboxylate ca...    35   2.6  
UniRef50_Q9VLF1 Cluster: CG9582-PA; n=2; Sophophora|Rep: CG9582-...    35   2.6  
UniRef50_A7S9U9 Cluster: Predicted protein; n=1; Nematostella ve...    35   2.6  
UniRef50_A4H8E6 Cluster: Mitochondrial ornithine carrier protein...    35   2.6  
UniRef50_Q8N413 Cluster: Solute carrier family 25 member 45; n=2...    35   2.6  
UniRef50_UPI00015B4EB4 Cluster: PREDICTED: similar to SLC25A35 p...    34   3.4  
UniRef50_UPI000150A9DC Cluster: Mitochondrial carrier protein; n...    34   3.4  
UniRef50_Q9MA27 Cluster: T5E21.6; n=9; Magnoliophyta|Rep: T5E21....    34   3.4  
UniRef50_O04619 Cluster: A_IG002N01.16 protein; n=9; Magnoliophy...    34   3.4  
UniRef50_Q54PY7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.4  
UniRef50_Q38BB0 Cluster: Mitochondrial carrier protein, putative...    34   3.4  
UniRef50_O01883 Cluster: Uncoupling protein (Mitochondrial subst...    34   3.4  
UniRef50_A7RL60 Cluster: Predicted protein; n=1; Nematostella ve...    34   3.4  
UniRef50_A0EEK4 Cluster: Chromosome undetermined scaffold_91, wh...    34   3.4  
UniRef50_Q4PEG8 Cluster: Putative uncharacterized protein; n=1; ...    34   3.4  
UniRef50_Q4P2S5 Cluster: Putative uncharacterized protein; n=1; ...    34   3.4  
UniRef50_O94502 Cluster: Mitochondrial carrier, calcium binding ...    34   3.4  
UniRef50_UPI00006CFCC1 Cluster: hypothetical protein TTHERM_0059...    34   4.5  
UniRef50_UPI00006CC3DC Cluster: Mitochondrial carrier protein; n...    34   4.5  
UniRef50_A7PP43 Cluster: Chromosome chr8 scaffold_23, whole geno...    34   4.5  
UniRef50_Q86AV5 Cluster: Similar to Mus musculus (Mouse). Calciu...    34   4.5  
UniRef50_O14281 Cluster: Iron ion transporter; n=13; Dikarya|Rep...    34   4.5  
UniRef50_O95847 Cluster: Mitochondrial uncoupling protein 4; n=3...    34   4.5  
UniRef50_UPI0000ECBAAF Cluster: Hepatocellular carcinoma-downreg...    33   5.9  
UniRef50_A3CI14 Cluster: Putative uncharacterized protein; n=3; ...    33   5.9  
UniRef50_O77304 Cluster: LA-MSC; n=3; Oxytrichidae|Rep: LA-MSC -...    33   5.9  
UniRef50_Q6Q0C1 Cluster: Hepatocellular carcinoma down-regulated...    33   5.9  
UniRef50_Q4S893 Cluster: Chromosome 3 SCAF14707, whole genome sh...    33   7.9  
UniRef50_Q3KNJ4 Cluster: Expressed sequence AU042651; n=4; Murin...    33   7.9  
UniRef50_Q9XI74 Cluster: F7A19.22 protein; n=10; Magnoliophyta|R...    33   7.9  
UniRef50_A5BXC7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  
UniRef50_A4S8E6 Cluster: MC family transporter; n=2; Ostreococcu...    33   7.9  
UniRef50_Q9VMK0 Cluster: CG18340-PA, isoform A; n=2; Drosophila ...    33   7.9  
UniRef50_Q54W11 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  
UniRef50_A1Z9M0 Cluster: CG18324-PB, isoform B; n=7; Sophophora|...    33   7.9  
UniRef50_Q6C107 Cluster: Yarrowia lipolytica chromosome F of str...    33   7.9  
UniRef50_Q5KKK6 Cluster: Mitochondrial inner membrane protein, p...    33   7.9  
UniRef50_Q4P843 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  
UniRef50_A7TIY4 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  
UniRef50_O75746 Cluster: Calcium-binding mitochondrial carrier p...    33   7.9  

>UniRef50_Q16RN6 Cluster: Adp,atp carrier protein; n=1; Aedes
           aegypti|Rep: Adp,atp carrier protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 257

 Score =  142 bits (345), Expect = 7e-33
 Identities = 65/73 (89%), Positives = 70/73 (95%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGRAK++I+YK+TIHCWATIAK EGT  FFKGAFSNVLRGTGGA
Sbjct: 185 IVSYPFDTVRRRMMMQSGRAKTEIIYKSTIHCWATIAKQEGTGAFFKGAFSNVLRGTGGA 244

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 245 FVLVLYDEIKKVL 257


>UniRef50_P12235 Cluster: ADP/ATP translocase 1; n=108;
           Eukaryota|Rep: ADP/ATP translocase 1 - Homo sapiens
           (Human)
          Length = 298

 Score =  118 bits (283), Expect = 2e-25
 Identities = 53/71 (74%), Positives = 59/71 (83%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IAK EG   FFKGA+SNVLRG GGA
Sbjct: 226 LVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296


>UniRef50_P12236 Cluster: ADP/ATP translocase 3; n=11;
           Euteleostomi|Rep: ADP/ATP translocase 3 - Homo sapiens
           (Human)
          Length = 298

 Score =  115 bits (277), Expect = 1e-24
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298


>UniRef50_P05141 Cluster: ADP/ATP translocase 2; n=61;
           Eukaryota|Rep: ADP/ATP translocase 2 - Homo sapiens
           (Human)
          Length = 298

 Score =  113 bits (273), Expect = 3e-24
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 226 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296


>UniRef50_Q9H0C2 Cluster: ADP/ATP translocase 4; n=17;
           Eukaryota|Rep: ADP/ATP translocase 4 - Homo sapiens
           (Human)
          Length = 315

 Score =  103 bits (246), Expect = 6e-21
 Identities = 50/71 (70%), Positives = 57/71 (80%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSG AK    YK T+ C+  I + EG S FF+GAFSNVLRGTGGA
Sbjct: 238 ILSYPFDTVRRRMMMQSGEAKRQ--YKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGA 295

Query: 181 FVLVLYDEIKK 213
            VLVLYD+IK+
Sbjct: 296 LVLVLYDKIKE 306


>UniRef50_Q8LFZ1 Cluster: ADP/ATP translocase-like protein; n=10;
           Eukaryota|Rep: ADP/ATP translocase-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 330

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 37/73 (50%), Positives = 52/73 (71%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRR+MMQSG      +Y++T+ CW  I ++EG + F++GA SN+ R TG A
Sbjct: 255 LASYPLDTVRRRIMMQSGMEHP--MYRSTLDCWKKIYRSEGLASFYRGALSNMFRSTGSA 312

Query: 181 FVLVLYDEIKKVL 219
            +LV YDE+K+ L
Sbjct: 313 AILVFYDEVKRFL 325


>UniRef50_Q21809 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 298

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 33/73 (45%), Positives = 46/73 (63%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++ YP DTVRR MMMQSG+      Y +T  CW T+ K +G + F++GA +N LR TGGA
Sbjct: 228 MVCYPLDTVRRSMMMQSGKQIKQ--YTSTKDCWKTLYKKDGINGFYRGALTNSLRSTGGA 285

Query: 181 FVLVLYDEIKKVL 219
            ++  Y E  K +
Sbjct: 286 LIITFYYEFSKYM 298


>UniRef50_P91270 Cluster: Putative uncharacterized protein F25B4.7;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein F25B4.7 - Caenorhabditis elegans
          Length = 306

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 35/71 (49%), Positives = 45/71 (63%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           SYP DTVRRR+MM +G  K  + + NTI C   I   EG   FF GA  N +RGTG A V
Sbjct: 238 SYPLDTVRRRLMMGAG--KKTLPFNNTISCIKYIYTKEGPKAFFHGALVNAIRGTGAALV 295

Query: 187 LVLYDEIKKVL 219
           L +Y+E++K +
Sbjct: 296 LAIYNELQKYM 306



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           YP D +R R+ +  G+ KSD  +     C   I K++G    +KG
Sbjct: 142 YPLDFIRTRLAIDLGKRKSDREFTGMFDCAKKIIKSDGVPGLYKG 186


>UniRef50_Q22HD2 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 263

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 34/68 (50%), Positives = 43/68 (63%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           ISYP DT++R+MMMQS R +   LYKN+I C   + K  G   FF G  SN+ R  G + 
Sbjct: 186 ISYPTDTLKRKMMMQSARGEK--LYKNSIDCSIKLYKQGGIKIFFSGNASNIFRSFGSSL 243

Query: 184 VLVLYDEI 207
            LV+YDEI
Sbjct: 244 CLVVYDEI 251


>UniRef50_Q76KG1 Cluster: ADP/ATP carrier protein; n=1; Penicillium
           chrysogenum|Rep: ADP/ATP carrier protein - Penicillium
           chrysogenum (Penicillium notatum)
          Length = 430

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 34/73 (46%), Positives = 45/73 (61%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRRMMM SG A   + Y +++     I   EG    FKGA +N+LRG  GA
Sbjct: 356 VASYPLDTVRRRMMMTSGEA---VKYNSSMDAARQIVAKEGVKSLFKGAGANILRGVAGA 412

Query: 181 FVLVLYDEIKKVL 219
            VL +YD+ + +L
Sbjct: 413 GVLSIYDKAQMLL 425


>UniRef50_A0E0L6 Cluster: Chromosome undetermined scaffold_71, whole
           genome shotgun sequence; n=3; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_71, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 304

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 33/71 (46%), Positives = 44/71 (61%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           ISYP DT++R++MMQ+   +    YKN   C+  I KTEG     KG  SN+ R  G + 
Sbjct: 228 ISYPTDTLKRKLMMQTAGVQRK--YKNAFDCFNQILKTEGFRGLMKGNASNMARAIGSSL 285

Query: 184 VLVLYDEIKKV 216
            LVLYDE+K+V
Sbjct: 286 CLVLYDEMKRV 296


>UniRef50_P04710 Cluster: ADP,ATP carrier protein 1; n=163;
           Eukaryota|Rep: ADP,ATP carrier protein 1 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 309

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 31/71 (43%), Positives = 42/71 (59%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           SYP DTVRRRMMM SG+    I Y   + C   I + EG    FKG  +N+ RG   A V
Sbjct: 236 SYPLDTVRRRMMMTSGQT---IKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGV 292

Query: 187 LVLYDEIKKVL 219
           + LYD+++ ++
Sbjct: 293 ISLYDQLQLIM 303


>UniRef50_A5BXJ8 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 342

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/72 (38%), Positives = 46/72 (63%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + +YPFDT+RRRMM+ SG+    + Y +T+H    I + EG +  ++G  +N+L G  GA
Sbjct: 260 VCAYPFDTLRRRMMLTSGQP---LKYSSTMHAVLEIVRLEGFTALYRGVTANMLLGMAGA 316

Query: 181 FVLVLYDEIKKV 216
            VL  YD++ ++
Sbjct: 317 GVLAGYDQLHRI 328


>UniRef50_Q18683 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 306

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/70 (40%), Positives = 38/70 (54%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           ++YP+DTVRRRMM+     K  +           I   EG    +KGA +N+ R  GGA 
Sbjct: 240 LTYPWDTVRRRMMV-----KGQLSTSKAFSAARKIVHEEGVRGLYKGALANIFRSAGGAL 294

Query: 184 VLVLYDEIKK 213
           V+ LY+EI K
Sbjct: 295 VMALYEEIHK 304


>UniRef50_A0BYX2 Cluster: Chromosome undetermined scaffold_138,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_138,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 216

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/73 (38%), Positives = 45/73 (61%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I++ P DTVRR +M+Q+G+ K+++ Y   I C+A I    G + F++    N  +    +
Sbjct: 140 ILASPLDTVRRMLMIQAGQ-KTNVEYSGAIDCFAKILSNRGPTVFYRHLSYN-WKYISPS 197

Query: 181 FVLVLYDEIKKVL 219
            VLVLYDE KK++
Sbjct: 198 LVLVLYDEFKKLV 210


>UniRef50_UPI00006D001E Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 295

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 26/70 (37%), Positives = 41/70 (58%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SY  DTV+RRMMM SG+    + Y+ +I C+  I K EG    F G    +++    A
Sbjct: 229 MVSYTVDTVKRRMMMTSGQP---VKYRGSIDCFRYIIKNEGFKHLFNGFSLTLIKSITSA 285

Query: 181 FVLVLYDEIK 210
            +LV+YD+ +
Sbjct: 286 GLLVIYDQFQ 295


>UniRef50_Q7RGQ7 Cluster: Mitochondrial carrier protein, putative;
           n=4; Plasmodium|Rep: Mitochondrial carrier protein,
           putative - Plasmodium yoelii yoelii
          Length = 497

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GG 177
           II +P DTVR+RMM  +G   ++ +YKNT HC   I   EG   F+ G F ++L+    G
Sbjct: 422 IIVFPGDTVRKRMM-NNGIDNNNYIYKNTFHCIKKIYYHEGLKSFYSGLFPSILKCVPSG 480

Query: 178 AFVLVLYDEIK 210
           A   + Y+ +K
Sbjct: 481 AIQFMSYEILK 491


>UniRef50_A7SPF1 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 335

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 24/53 (45%), Positives = 35/53 (66%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +YP D VRRRM M+  RA  D  YK+T+H +++I K EG    +KG + N+L+
Sbjct: 260 TYPLDVVRRRMQMKGIRA--DFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILK 310


>UniRef50_Q8ID23 Cluster: Mitochondrial carrier protein, putative;
           n=1; Plasmodium falciparum 3D7|Rep: Mitochondrial
           carrier protein, putative - Plasmodium falciparum
           (isolate 3D7)
          Length = 576

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TGG 177
           II +P DTVR+RMM  +G    + +YKNT+HC   I   EG   F+ G F ++L+    G
Sbjct: 501 IIVFPGDTVRKRMM-NNGIDNKNYIYKNTLHCIKNIYYREGIRNFYHGLFPSMLKCIPSG 559

Query: 178 AFVLVLYDEIKKVL 219
           A   + Y+ +K ++
Sbjct: 560 AIQFMSYEILKHLI 573


>UniRef50_Q23PQ2 Cluster: Mitochondrial carrier protein; n=2;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 300

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/66 (36%), Positives = 36/66 (54%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++YPF T+  RM+M SG  +    Y  ++ C  TI K EG    ++G   N+ +  GGA
Sbjct: 228 LLTYPFYTISSRMIMSSGSTQR---YTQSLQCIQTIKKQEGLKSLYRGVSINIFKSLGGA 284

Query: 181 FVLVLY 198
              VLY
Sbjct: 285 SSFVLY 290



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKN---TIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +  P + +R R+   S   K   L KN    +     IAK EG   F+KG FS++LR
Sbjct: 25  VGSPLEVIRLRLQNSSEMVKIGYLQKNYSGIVDSVKQIAKEEGLYAFWKGNFSHILR 81


>UniRef50_UPI0000DB7B77 Cluster: PREDICTED: similar to ADP/ATP
           translocase 1 (Adenine nucleotide translocator 1) (ANT
           1) (ADP,ATP carrier protein 1) (Solute carrier family 25
           member 4) (ADP,ATP carrier protein, heart/skeletal
           muscle isoform T1) (mANC1); n=1; Apis mellifera|Rep:
           PREDICTED: similar to ADP/ATP translocase 1 (Adenine
           nucleotide translocator 1) (ANT 1) (ADP,ATP carrier
           protein 1) (Solute carrier family 25 member 4) (ADP,ATP
           carrier protein, heart/skeletal muscle isoform T1)
           (mANC1) - Apis mellifera
          Length = 344

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/70 (37%), Positives = 40/70 (57%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++YPFDT+ R+ M+ SGR  + I Y    H    I   +G   F+KG  +N++    G+
Sbjct: 262 VVAYPFDTLARQKMLWSGR--NAIEYPPMRHVMNNIIAKDGLFGFYKGVQANLMTTICGS 319

Query: 181 FVLVLYDEIK 210
            VLV YD +K
Sbjct: 320 SVLVTYDIVK 329


>UniRef50_UPI00006CC149 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 317

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           II+YP DT+RRRMM+  G    +  YKN   C   IA+ EG   ++ G F+N+++
Sbjct: 243 IITYPLDTIRRRMMVNGGIG-FEREYKNVFDCVKKIAQNEGMKGYYGGFFANLVK 296


>UniRef50_UPI00015B491F Cluster: PREDICTED: similar to mitochondrial
           carrier protein, putative; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to mitochondrial carrier protein,
           putative - Nasonia vitripennis
          Length = 316

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/55 (43%), Positives = 33/55 (60%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           + S+P DTVR R++ QS + K+   YK TIH   TI KTE    FF+G    +L+
Sbjct: 127 VTSFPLDTVRTRLIAQSSQNKA---YKGTIHSCTTIYKTESPKGFFRGLLPTLLQ 178


>UniRef50_Q014S0 Cluster: Mitochondrial fatty acid anion carrier
           protein/Uncoupling protein; n=1; Ostreococcus tauri|Rep:
           Mitochondrial fatty acid anion carrier
           protein/Uncoupling protein - Ostreococcus tauri
          Length = 359

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +I  PF+ V+ R+  Q G A   + YK T+HC  TI K EG    + GA   + R
Sbjct: 176 VIVTPFEVVKIRLQQQKGLAMDQLKYKGTVHCAQTIIKEEGVRALWNGAGPTIAR 230



 Score = 33.9 bits (74), Expect = 4.5
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           PFD  + R+M QS      + YK+ +H    I K EG    +KG    ++R   G A   
Sbjct: 282 PFDVAKTRLMAQS--KAGGVKYKSFMHALYLIPKEEGILAMWKGLLPRLMRIPPGQAVTF 339

Query: 190 VLYDEI 207
           ++ D I
Sbjct: 340 MVADAI 345


>UniRef50_Q4MZZ5 Cluster: Mitochondrial carrier protein, putative;
           n=4; Piroplasmida|Rep: Mitochondrial carrier protein,
           putative - Theileria parva
          Length = 455

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/69 (34%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TGGA 180
           I +P DTVR+RMM  +  +  + LY+++I+C   I K EG   F+ G F ++L+    GA
Sbjct: 261 IVFPGDTVRKRMM-NNAISSENRLYRDSIYCMKYIFKNEGILAFYHGLFPSMLKSLPSGA 319

Query: 181 FVLVLYDEI 207
              ++Y+ +
Sbjct: 320 IQFLMYENL 328



 Score = 33.9 bits (74), Expect = 4.5
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQ-SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-GA 180
           +YP D +  RM +  + +  S   Y     C++ I KTEG   F+KG    ++ G    A
Sbjct: 155 TYPLDLLSVRMALGINTKHLSTCTYTGIFDCFSQIFKTEGLMGFYKGFIPTMVTGVPYVA 214

Query: 181 FVLVLYDEIKKVL 219
             L  +D  +K L
Sbjct: 215 LQLSFFDFYRKAL 227


>UniRef50_Q4D533 Cluster: Mitochondrial carrier protein, putative;
           n=2; Trypanosoma cruzi|Rep: Mitochondrial carrier
           protein, putative - Trypanosoma cruzi
          Length = 327

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/52 (40%), Positives = 35/52 (67%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +P DTVRRRMM+ +   + D+ Y +++HC   I +TEG    ++GAF +++R
Sbjct: 263 HPIDTVRRRMMIAA--TEDDLRYSSSMHCVRHIMRTEGPVGLYRGAFFSLVR 312


>UniRef50_P43617 Cluster: Putative mitochondrial carrier YFR045W;
           n=3; Saccharomyces cerevisiae|Rep: Putative
           mitochondrial carrier YFR045W - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 285

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           ++ P D V+ RMM Q+ + +    YKNT++C   I   EG + F+KG+    ++ G  G 
Sbjct: 211 MTQPIDVVKTRMMSQNAKTE----YKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGG 266

Query: 181 FVLVLYDEIKKVL 219
               +Y+++  +L
Sbjct: 267 LTFTVYEQVSLLL 279


>UniRef50_A2DUD3 Cluster: Mitochondrial carrier protein; n=1;
           Trichomonas vaginalis G3|Rep: Mitochondrial carrier
           protein - Trichomonas vaginalis G3
          Length = 304

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I++PFD +RRRMM+     K   +Y + I C+ +I + EG + FFKG   N+ +
Sbjct: 219 IAFPFDVMRRRMMIVDSEGKR--IYNSYIGCFKSIWEKEGATGFFKGIHVNLFK 270


>UniRef50_Q176S5 Cluster: Mitochondrial carrier protein; n=3;
           Culicidae|Rep: Mitochondrial carrier protein - Aedes
           aegypti (Yellowfever mosquito)
          Length = 309

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 2/70 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSD-ILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFV 186
           P D V  R+  Q   AK   I Y   + C+  I KTEG +  +KG + + +R G     V
Sbjct: 229 PPDVVATRLYNQGVDAKGKGIYYNGVVDCFLKILKTEGVAGLYKGFWPHYMRIGPHSMLV 288

Query: 187 LVLYDEIKKV 216
           LV +DE+K +
Sbjct: 289 LVFFDELKAI 298


>UniRef50_Q4WGJ2 Cluster: Mitochondrial carrier protein, putative;
           n=16; Ascomycota|Rep: Mitochondrial carrier protein,
           putative - Aspergillus fumigatus (Sartorya fumigata)
          Length = 697

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-A 180
           ++ P D ++ R+ +++   K D+ Y    HC ATI + EG   FFKG  + ++R +    
Sbjct: 560 LTTPCDVIKTRLQVEA--RKGDVRYNGLRHCAATIWRDEGFRAFFKGGPARIIRSSPQFG 617

Query: 181 FVLVLYDEIKKVL 219
           F L  Y+ ++K L
Sbjct: 618 FTLAAYELLQKWL 630



 Score = 36.3 bits (80), Expect = 0.84
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           YP D V+ RM  Q      + LY N++ C+  + + EG    F G +S VL
Sbjct: 365 YPIDLVKTRMQNQRSTRVGERLYNNSLDCFRKVIRNEG----FLGLYSGVL 411


>UniRef50_UPI0000D55AE5 Cluster: PREDICTED: similar to solute
           carrier family 25, member 35; n=3; Tribolium
           castaneum|Rep: PREDICTED: similar to solute carrier
           family 25, member 35 - Tribolium castaneum
          Length = 309

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTG 174
           ++  PFD V  R+  Q+  A+   +LYK    C+  I K EG    +KG  +N +R    
Sbjct: 221 VVIAPFDIVTTRLYNQATDAQGRGLLYKGITDCFIKIYKCEGIPGLYKGIGANYMRLAPH 280

Query: 175 GAFVLVLYDEIK 210
           GA  L+L+D +K
Sbjct: 281 GALCLILWDVLK 292



 Score = 37.9 bits (84), Expect = 0.28
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS---GRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           I S PFD ++ RM +Q     R +  + YKN +H    +AKTEG     +G
Sbjct: 15  IFSNPFDMLKTRMQLQGELRARGQHTVHYKNVLHAAYVVAKTEGIRGLQRG 65


>UniRef50_Q581R5 Cluster: Mitochondrial carrier protein, putative;
           n=2; Trypanosoma|Rep: Mitochondrial carrier protein,
           putative - Trypanosoma brucei
          Length = 385

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           +SYP + VR R+  Q    ++ + YK    C+  + +T+G    F G  +N L+     A
Sbjct: 310 VSYPLNVVRTRLQTQGTNGRA-VKYKGMTDCFVKMVRTKGVGSLFSGISANYLKAVPASA 368

Query: 181 FVLVLYDEIKKVL 219
            + V++++++ +L
Sbjct: 369 SMFVVFEKVQSIL 381


>UniRef50_Q4UC09 Cluster: Mitochondrial carrier, putative; n=2;
           Theileria|Rep: Mitochondrial carrier, putative -
           Theileria annulata
          Length = 305

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 31/71 (43%), Positives = 35/71 (49%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           I+ P D V+ RMM Q G  K   +YK+T  C   IA  EGTS  FKG    V   T G F
Sbjct: 226 ITNPLDVVKTRMMTQ-GEKK---MYKSTWDCLTKIAVDEGTSSLFKGLGLRVTWLTLGGF 281

Query: 184 VLVLYDEIKKV 216
           V     E  KV
Sbjct: 282 VFFAVLEAGKV 292


>UniRef50_UPI000150A0E5 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 307

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D ++ R M Q    +  + YK+   C   + KTEG   F+KG  S  LR G   
Sbjct: 228 VCSSPVDVIKTRFMNQVS-TEGALAYKSATECGLKVLKTEGFGAFYKGFLSYFLRIGPWN 286

Query: 178 AFVLVLYDEIK 210
            F  + Y++ K
Sbjct: 287 VFFFMAYEQYK 297


>UniRef50_A2FII9 Cluster: Mitochondrial carrier protein; n=1;
           Trichomonas vaginalis G3|Rep: Mitochondrial carrier
           protein - Trichomonas vaginalis G3
          Length = 401

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           IS+PFD +R+RMM+     K   +YK+   C+A     EG + FF+G   N+++
Sbjct: 224 ISFPFDVIRKRMMVNGPDGKK--VYKSMSECFAKTWANEGVAGFFRGIGLNMVK 275


>UniRef50_Q5AL11 Cluster: Potential mitochondrial
           aspartate-glutamate transporter; n=5;
           Saccharomycetales|Rep: Potential mitochondrial
           aspartate-glutamate transporter - Candida albicans
           (Yeast)
          Length = 731

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AFVL 189
           P D ++ R+ + +G+ K++  YK  + C A+I K EG S FFKG+ + V R +    F L
Sbjct: 559 PADVIKTRLQV-AGK-KNEAKYKGILDCGASILKQEGLSAFFKGSLARVFRSSPQFGFTL 616

Query: 190 VLYDEIKKV 216
             Y+ ++ +
Sbjct: 617 ASYELLQNL 625


>UniRef50_Q4PBZ8 Cluster: Putative uncharacterized protein; n=4;
           Basidiomycota|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 333

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM     R K    Y+NT +C A   + EG   F++GA   + R    G  V 
Sbjct: 263 PLDVIKTRMQTLEARTK----YRNTFNCAAVTLREEGILAFWRGATPRLARLVLSGGIVF 318

Query: 190 VLYDEIKKVL 219
            +Y+EI  VL
Sbjct: 319 TVYEEIMSVL 328


>UniRef50_UPI00015B635C Cluster: PREDICTED: similar to mitochondrial
           oxodicarboxylate carrier; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to mitochondrial oxodicarboxylate
           carrier - Nasonia vitripennis
          Length = 318

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           ++ PFD  + R+    G       YK T+     + K EG    +KG    V+R G GGA
Sbjct: 246 LNIPFDVAKSRIQGPEGHK-----YKGTLKTIGIVYKAEGFKALYKGLLPKVIRLGPGGA 300

Query: 181 FVLVLYDEIKKVL 219
            +LV+YD + + L
Sbjct: 301 IMLVVYDYMHEYL 313


>UniRef50_Q3EAC3 Cluster: Uncharacterized protein At4g03115.1; n=2;
           Arabidopsis thaliana|Rep: Uncharacterized protein
           At4g03115.1 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 341

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D ++ R+M+Q G ++S   Y+N  HC   + + EG    +KG F+   R G   
Sbjct: 264 LITAPMDMIKTRLMLQQG-SESTKTYRNGFHCGYKVVRKEGPLALYKGGFAIFARLGPQT 322

Query: 178 AFVLVLYDEIKKV 216
               +L ++++ +
Sbjct: 323 MITFILCEKLRSL 335


>UniRef50_Q10MX0 Cluster: Mitochondrial carrier protein, expressed;
           n=8; Viridiplantae|Rep: Mitochondrial carrier protein,
           expressed - Oryza sativa subsp. japonica (Rice)
          Length = 333

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I  PF+ V+ R+  Q G +   + YK  IHC  TI   EG    + GA   V+R GT  
Sbjct: 150 LIVTPFEVVKIRLQQQKGLSPDLLRYKGPIHCARTIVTEEGLFGLWAGALPTVMRNGTNQ 209

Query: 178 A 180
           A
Sbjct: 210 A 210



 Score = 40.3 bits (90), Expect = 0.052
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           I + PFD V+ R+M Q GR   DI YK  +H   TI   EG    +KG    ++R   G 
Sbjct: 252 ICTGPFDVVKTRLMAQ-GRT-GDIKYKGMVHAIRTIYTEEGLRALWKGLLPRLMRIPPGQ 309

Query: 178 AFVLVLYDEI 207
           A +  + D++
Sbjct: 310 AIMWAVADQV 319


>UniRef50_Q54EV4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 327

 Score = 41.9 bits (94), Expect = 0.017
 Identities = 21/47 (44%), Positives = 26/47 (55%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           I YP D V+RR+M+Q        +YKN I     I KTEG S  +KG
Sbjct: 252 ILYPLDVVKRRIMLQHFDRNQLPIYKNFIDAIIKITKTEGISALYKG 298


>UniRef50_Q6FN66 Cluster: Similar to tr|Q12482 Saccharomyces
           cerevisiae YPR021c; n=1; Candida glabrata|Rep: Similar
           to tr|Q12482 Saccharomyces cerevisiae YPR021c - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 919

 Score = 41.9 bits (94), Expect = 0.017
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-A 180
           ++ PFD ++ R+ +     K + +YK  IH   TI + E    FFKG  + VLR +    
Sbjct: 757 LTTPFDVIKTRLQIDP--KKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFG 814

Query: 181 FVLVLYD 201
           F L  Y+
Sbjct: 815 FTLAAYE 821


>UniRef50_UPI00015B5307 Cluster: PREDICTED: similar to folate
           carrier protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to folate carrier protein - Nasonia
           vitripennis
          Length = 769

 Score = 41.5 bits (93), Expect = 0.022
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           I+YP+  VR R+            Y+ T+HC ++I K EG   ++KG  +N+LR T    
Sbjct: 242 ITYPYQVVRSRLQDHHHN------YQGTLHCISSIWKYEGWRGYYKGLSANLLRVTPATV 295

Query: 184 V-LVLYDEIKKVL 219
           +  V+Y+ +   L
Sbjct: 296 ITFVVYEHVSSYL 308


>UniRef50_Q4SFU1 Cluster: Chromosome 7 SCAF14601, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 7 SCAF14601, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 354

 Score = 41.5 bits (93), Expect = 0.022
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 4/73 (5%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           P D V+ RM  +S  + + +    YKNT  C   I K EG   F+KG    + R     A
Sbjct: 276 PLDVVKTRMQARSPASPTGLEAHRYKNTADCAFQILKHEGPQAFYKGTVPRLGRVCLDVA 335

Query: 181 FVLVLYDEIKKVL 219
            V V+Y+E+ K+L
Sbjct: 336 IVFVIYEEVVKLL 348


>UniRef50_A7P3C4 Cluster: Chromosome chr1 scaffold_5, whole genome
           shotgun sequence; n=6; Magnoliophyta|Rep: Chromosome
           chr1 scaffold_5, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 374

 Score = 41.5 bits (93), Expect = 0.022
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++YP + +R R+  Q     S+  Y   I C   + + EG   F++G  +N+LR T  A
Sbjct: 236 VMTYPHEVIRSRLQEQGQVRNSEKHYSGVIDCIEKVYRKEGLPGFYRGCATNLLRTTPSA 295

Query: 181 FV 186
            +
Sbjct: 296 VI 297


>UniRef50_A4RHI3 Cluster: Putative uncharacterized protein; n=2;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 693

 Score = 41.5 bits (93), Expect = 0.022
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           YP D V+ RM  Q G    + LYKN+I C+  + + EG    F G +S VL
Sbjct: 350 YPIDLVKTRMQNQRGVRPGERLYKNSIDCFQKVVRNEG----FLGLYSGVL 396


>UniRef50_Q9FK00 Cluster: Similarity to peroxisomal membrane carrier
           protein; n=5; Brassicaceae|Rep: Similarity to
           peroxisomal membrane carrier protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 310

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 21/54 (38%), Positives = 26/54 (48%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           +  D VR R  +  GR  S   YKNT H   TIA+ EG    + G F  V+  T
Sbjct: 25  HSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGST 78


>UniRef50_A4S3P4 Cluster: MC family transporter; n=2;
           Ostreococcus|Rep: MC family transporter - Ostreococcus
           lucimarinus CCE9901
          Length = 335

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           + YP DT+RRRM M+ G+      Y        TIA+TEG   FF+G  +N L+
Sbjct: 262 VCYPLDTIRRRMQMK-GKT-----YNGMYDAITTIARTEGVKGFFRGWAANTLK 309



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG--G 177
           I++P DTVR R+ + +        Y   +HC+ T+ +TEG    +KG     L G     
Sbjct: 170 ITHPLDTVRLRLALPNHG------YNGMMHCFGTVYRTEGVGALYKG-LGPTLAGIAPYA 222

Query: 178 AFVLVLYDEIKKV 216
           A     YD  KK+
Sbjct: 223 AINFASYDMAKKM 235


>UniRef50_A4RUV7 Cluster: MC family transporter:
           aspartate/glutamate; n=2; Ostreococcus|Rep: MC family
           transporter: aspartate/glutamate - Ostreococcus
           lucimarinus CCE9901
          Length = 340

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMM----MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           ++YPFD  RRR+     +Q+G      +Y     C+      EG S  F G  +N ++  
Sbjct: 255 VAYPFDVCRRRLQVSGWVQAGVQAGGPVYTGMFDCFRRTVAEEGVSALFHGLSANYIKIM 314

Query: 172 GG-AFVLVLYDEIKKVL 219
              A   V+YD++K +L
Sbjct: 315 PSIAIAFVVYDQLKIIL 331


>UniRef50_Q55A24 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 329

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 5/74 (6%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS----DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           I++YP+  V+ R+  QSG A +       YK T+     I K++G   FFKG  S +++ 
Sbjct: 234 IVTYPYLLVKSRLQSQSGNASNPESQQQQYKGTLDAIGKIFKSDGFLGFFKGMPSKMVQT 293

Query: 169 T-GGAFVLVLYDEI 207
             G AF+ ++ D++
Sbjct: 294 VIGAAFMFLVKDKV 307


>UniRef50_Q4P222 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 504

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG--G 177
           ++ P D ++ R+ +++   K    YK  + C   I   EG   FFKG+ + VLR +   G
Sbjct: 379 LTTPADVIKTRLQVEA--RKGQATYKGIVDCATKIMAEEGPKAFFKGSLARVLRSSPQFG 436

Query: 178 AFVLVLYDEIKKVL 219
           A  LV Y+ ++K L
Sbjct: 437 A-TLVAYEYLQKFL 449



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSD-ILYKNTIHCWATIAKTEGTSPFFKG 144
           YP D V+ RM  Q      + ++YKN+I C   + + EG   F+ G
Sbjct: 181 YPIDLVKTRMQNQRSSVVGEPLMYKNSIDCVKKVFRNEGLRGFYSG 226


>UniRef50_P38152 Cluster: Tricarboxylate transport protein; n=14;
           Ascomycota|Rep: Tricarboxylate transport protein -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 299

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P DTV+ RM     ++     Y +T++C+ATI K EG   F+KGA   + R    G  V 
Sbjct: 234 PLDTVKTRM-----QSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVF 288

Query: 190 VLYDEIKKVL 219
            +Y+++  +L
Sbjct: 289 TIYEKVLVML 298


>UniRef50_Q84UC7 Cluster: Mitochondrial basic amino acid carrier;
           n=3; core eudicotyledons|Rep: Mitochondrial basic amino
           acid carrier - Arabidopsis thaliana (Mouse-ear cress)
          Length = 311

 Score = 40.7 bits (91), Expect = 0.039
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           + +PFDTV+ ++   +   +  + YKN +HC + I +TEG    ++GA S+ +
Sbjct: 31  VGHPFDTVKVKLQKHNTDVQG-LRYKNGLHCASRILQTEGVKGLYRGATSSFM 82


>UniRef50_Q6AVS9 Cluster: Mitochondrial carrier protein-like
           protein; n=3; Oryza sativa|Rep: Mitochondrial carrier
           protein-like protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 318

 Score = 40.7 bits (91), Expect = 0.039
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           +P D VR R  +  GR   D+  Y+NT H   TIA++EG    + G +  VL  T
Sbjct: 34  HPLDVVRTRFQVSGGRGCYDLPPYRNTAHAVYTIARSEGLRGLYAGFYPAVLGST 88


>UniRef50_A7PU03 Cluster: Chromosome chr7 scaffold_31, whole genome
           shotgun sequence; n=3; Magnoliophyta|Rep: Chromosome
           chr7 scaffold_31, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 298

 Score = 40.7 bits (91), Expect = 0.039
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D ++ R+M+Q   +K    YKN  HC   +  TEG    +KG F+   R G   
Sbjct: 221 LITAPMDMIKTRLMLQR-ESKVAGNYKNGFHCAYQVILTEGPRALYKGGFATFARLGPQT 279

Query: 178 AFVLVLYDEIKK 213
               +L +++++
Sbjct: 280 TITFILLEKLRE 291


>UniRef50_Q5E9L8 Cluster: Solute carrier family 25 (Mitochondrial
           oxodicarboxylate carrier), member 21; n=2; Bos
           taurus|Rep: Solute carrier family 25 (Mitochondrial
           oxodicarboxylate carrier), member 21 - Bos taurus
           (Bovine)
          Length = 244

 Score = 40.7 bits (91), Expect = 0.039
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ PFD  + R+         +I YK      AT+ + EG    +KG    ++R G GG
Sbjct: 168 VINIPFDVAKSRIQGPQP-VPGEIKYKTCFKTMATVYQEEGILALYKGLLPKIMRLGPGG 226

Query: 178 AFVLVLYD 201
           A +L++Y+
Sbjct: 227 AVMLLVYE 234


>UniRef50_Q54BM3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 300

 Score = 40.7 bits (91), Expect = 0.039
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++YP D V+  M   +   KS   YKN I C + I K +G + F+KG     +R     A
Sbjct: 228 LTYPADVVKSTMQTDA-IVKSQRKYKNMIDCASKIYKQQGIAGFYKGFTPCFIRSVPANA 286

Query: 181 FVLVLYDEIKKVL 219
              VLY++ ++++
Sbjct: 287 ACFVLYEKARQIM 299


>UniRef50_A2DCW8 Cluster: Hydrogenosomal membrane protein 31; n=3;
           Trichomonas|Rep: Hydrogenosomal membrane protein 31 -
           Trichomonas vaginalis G3
          Length = 316

 Score = 40.7 bits (91), Expect = 0.039
 Identities = 16/53 (30%), Positives = 32/53 (60%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           SYPFD +R+RMM++  + K   +Y   +  ++T+   EG +  ++G   N+++
Sbjct: 223 SYPFDVIRKRMMLKDEKGKP--IYSGMMQAFSTVYAKEGVAGLYRGVGLNLIK 273


>UniRef50_Q54MZ4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 434

 Score = 40.3 bits (90), Expect = 0.052
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           ++YP D +RRR+ +Q G    DILY  T   +  I + EG    + G     L+      
Sbjct: 352 LTYPIDLIRRRLQVQ-GIGGKDILYNGTFDAFRKIIRDEGVLGLYNGMIPCYLKVIPAIS 410

Query: 184 V-LVLYDEIKKVL 219
           +   +Y+ +KK+L
Sbjct: 411 ISFCVYEVMKKIL 423


>UniRef50_Q0P491 Cluster: Zgc:153273; n=3; Coelomata|Rep: Zgc:153273
           - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 336

 Score = 39.9 bits (89), Expect = 0.068
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 3/76 (3%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG---AFSNVLRGT 171
           +++ P D V+ R M  +G+      YKN I C    A  EG + F+KG   AFS ++  +
Sbjct: 263 VVASPVDVVKTRFMNSTGK------YKNAIDCAVKTAVKEGPTAFYKGFMPAFSRLV--S 314

Query: 172 GGAFVLVLYDEIKKVL 219
               + + Y++IKKV+
Sbjct: 315 WNICMWITYEQIKKVV 330



 Score = 33.9 bits (74), Expect = 4.5
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 3/76 (3%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMM--QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT- 171
           +++ P + V+ R     +SG AK    Y +T+  +  IAK EG    ++G F NV R + 
Sbjct: 166 LVAQPTEVVKVRFQAAARSGGAK----YSSTLGAYKCIAKNEGFQGLWRGTFPNVARNSI 221

Query: 172 GGAFVLVLYDEIKKVL 219
                +V YD  K ++
Sbjct: 222 VSVAEIVCYDVFKDLI 237


>UniRef50_Q4A3J5 Cluster: Mitochondrial carrier like protein; n=6;
           Magnoliophyta|Rep: Mitochondrial carrier like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 363

 Score = 39.9 bits (89), Expect = 0.068
 Identities = 16/62 (25%), Positives = 32/62 (51%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I++YP + +R ++  Q     ++  Y   I C   + ++EG    ++G  +N+LR T  A
Sbjct: 233 ILTYPHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSA 292

Query: 181 FV 186
            +
Sbjct: 293 VI 294


>UniRef50_Q60K80 Cluster: Putative uncharacterized protein CBG24187;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG24187 - Caenorhabditis
           briggsae
          Length = 666

 Score = 39.9 bits (89), Expect = 0.068
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           YP D V+ RM  Q  SG    +++YKN++ C+  + K EG    ++G    ++
Sbjct: 395 YPIDLVKTRMQNQRTSGSFVGEVMYKNSLDCFKKVVKFEGLLGLYRGLLPQIV 447


>UniRef50_Q4DMB4 Cluster: Mitochondrial carrier protein, putative;
           n=3; Trypanosoma|Rep: Mitochondrial carrier protein,
           putative - Trypanosoma cruzi
          Length = 293

 Score = 39.9 bits (89), Expect = 0.068
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           ++ +PFDTV+   ++Q  + K    +KN + C A+I K +G    +KG  + +   G   
Sbjct: 19  LVGHPFDTVKT--LLQDAKGK----HKNALSCVASILKKDGPLALYKGVLAPMTGVGVVF 72

Query: 178 AFVLVLYDEIKKVL 219
           AF  V YD  +K +
Sbjct: 73  AFYFVAYDSCEKFI 86


>UniRef50_Q24GE6 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 307

 Score = 39.9 bits (89), Expect = 0.068
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I+S PF+ VR RMM+Q     S   Y   ++ ++ I   EG+  FF G    ++R
Sbjct: 229 ILSQPFEVVRNRMMIQDNNLPSIYRYTGLLNGFSQIYMLEGSKGFFNGLIPRLVR 283


>UniRef50_Q57VM4 Cluster: Mitochondrial carrier protein, putative;
           n=1; Trypanosoma brucei|Rep: Mitochondrial carrier
           protein, putative - Trypanosoma brucei
          Length = 334

 Score = 39.5 bits (88), Expect = 0.091
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +P DT+RRRMM+        + Y +  HC+  I  TEG + F++GA   ++R
Sbjct: 270 HPLDTMRRRMMIAV--TMDGLRYASARHCFHHILSTEGIAGFYRGAAFTMVR 319


>UniRef50_Q9BQT8 Cluster: Mitochondrial 2-oxodicarboxylate carrier;
           n=22; Euteleostomi|Rep: Mitochondrial 2-oxodicarboxylate
           carrier - Homo sapiens (Human)
          Length = 299

 Score = 39.5 bits (88), Expect = 0.091
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ PFD  + R+         +I Y+      AT+ + EG    +KG    ++R G GG
Sbjct: 223 VINIPFDVAKSRIQGPQP-VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGG 281

Query: 178 AFVLVLYD 201
           A +L++Y+
Sbjct: 282 AVMLLVYE 289


>UniRef50_Q8N8R3 Cluster: Mitochondrial carnitine/acylcarnitine
           carrier protein CACL; n=31; Eumetazoa|Rep: Mitochondrial
           carnitine/acylcarnitine carrier protein CACL - Homo
           sapiens (Human)
          Length = 303

 Score = 39.5 bits (88), Expect = 0.091
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           ++ +PFDTV+ R+ +QS        Y+ T+HC+ +I K E     +KG  S ++
Sbjct: 17  LVGHPFDTVKVRLQVQSVEKPQ---YRGTLHCFKSIIKQESVLGLYKGLGSPLM 67


>UniRef50_UPI00015B5580 Cluster: PREDICTED: similar to mitochondrial
           carrier protein ymc; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to mitochondrial carrier protein ymc
           - Nasonia vitripennis
          Length = 383

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ YP DT++  +  Q  R      YK T HC+ T+ K +  S  ++G  S+ + G    
Sbjct: 17  VVGYPLDTIKVHIQTQDHRNPK---YKGTWHCFRTLIKQDSVSGLYRG-MSSPMAGVAAI 72

Query: 175 GAFVLVLYDEIKKVL 219
            A V  +Y + +K L
Sbjct: 73  NAIVFGVYGQTQKFL 87


>UniRef50_O95258-3 Cluster: Isoform 3 of O95258 ; n=4; Eutheria|Rep:
           Isoform 3 of O95258 - Homo sapiens (Human)
          Length = 353

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 279 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 338

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 339 IIFFITYEQLKRL 351


>UniRef50_Q9SUV1 Cluster: Adenylate translocator (Brittle-1)-like
           protein; n=8; Magnoliophyta|Rep: Adenylate translocator
           (Brittle-1)-like protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 392

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           ++P +  R+ M  Q G     ++YKN +H   TI + EG   ++KG   + L+    A +
Sbjct: 316 TFPLEVARKHM--QVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGI 373

Query: 187 -LVLYDEIKKVL 219
             + Y+  KK+L
Sbjct: 374 SFMCYEACKKIL 385


>UniRef50_O65623 Cluster: Plant uncoupling mitochondrial protein;
           n=35; Viridiplantae|Rep: Plant uncoupling mitochondrial
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 306

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           I  P D V+ RMM  SG       YK TI C+    K++G   F+KG   N  R G+   
Sbjct: 231 IGSPVDVVKSRMMGDSGA------YKGTIDCFVKTLKSDGPMAFYKGFIPNFGRLGSWNV 284

Query: 181 FVLVLYDEIKK 213
            + +  ++ KK
Sbjct: 285 IMFLTLEQAKK 295


>UniRef50_Q5KE65 Cluster: Tricarboxylate transport protein (Ctp),
           putative; n=1; Filobasidiella neoformans|Rep:
           Tricarboxylate transport protein (Ctp), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 295

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           PFD V+ RM   S R      YK+T+ C     K +G   F++GA   V R    G    
Sbjct: 228 PFDVVKTRMQQSSVR------YKSTLDCLVRSLKDDGVLVFWRGASPRVARLVVSGTVTF 281

Query: 190 VLYDEIKKVL 219
           V+Y+ + K L
Sbjct: 282 VIYENVLKSL 291


>UniRef50_A7TQ47 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 927

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-A 180
           ++ PFD ++ R+ +     K +  Y   +H   TI K E    FFKG+ + VLR +    
Sbjct: 749 LTTPFDVIKTRLQIDP--RKGETKYTGIVHAAQTILKEENFRSFFKGSGARVLRSSPQFG 806

Query: 181 FVLVLYDEIK 210
           F L  Y+  K
Sbjct: 807 FTLAAYELFK 816



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           I YP D ++ RM  Q    +S   YKN I C+A I   EG    + G
Sbjct: 551 IVYPIDLIKTRMQAQ----RSVTQYKNYIDCFAKILSREGLKGLYSG 593


>UniRef50_O95258 Cluster: Brain mitochondrial carrier protein 1;
           n=65; Eumetazoa|Rep: Brain mitochondrial carrier protein
           1 - Homo sapiens (Human)
          Length = 325

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 251 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 310

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 311 IIFFITYEQLKRL 323


>UniRef50_Q7Q9Q0 Cluster: ENSANGP00000009911; n=4; Culicidae|Rep:
           ENSANGP00000009911 - Anopheles gambiae str. PEST
          Length = 330

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 7/76 (9%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILY------KNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           ++ YP D  ++R+ +Q G AKS   Y       N  +C   IAK EG    +KG +  +L
Sbjct: 227 LLVYPLDLAKKRLQIQ-GFAKSRQTYGRHFVCDNMFNCLYNIAKQEGPIGLYKGLYPALL 285

Query: 163 RGT-GGAFVLVLYDEI 207
           +     AF   +YDE+
Sbjct: 286 KACFMSAFYFAIYDEM 301


>UniRef50_Q55BF4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 306

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           PFD  R R+  Q        +YK  + C     K EG    +KG +++ LR G      L
Sbjct: 233 PFDVARTRLYFQGKGNSHGEIYKGLMDCVYKTVKKEGFGAVYKGFWAHYLRLGPHTILTL 292

Query: 190 VLYDEIKKV 216
           V +++ KK+
Sbjct: 293 VFWEQFKKL 301


>UniRef50_Q6CCV8 Cluster: Similar to KLLA0B11319g Kluyveromyces
           lactis IPF 7109.1; n=1; Yarrowia lipolytica|Rep: Similar
           to KLLA0B11319g Kluyveromyces lactis IPF 7109.1 -
           Yarrowia lipolytica (Candida lipolytica)
          Length = 337

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           +P D V  R+ +Q G    D  YK+ +  +  I K EG    + GAF + +     AF
Sbjct: 22  FPLDLVTTRLQVQKGYLDEDDQYKSLLDAFTKIVKNEGIFALYDGAFQDTISTMVSAF 79


>UniRef50_Q2UTE7 Cluster: Mitochondrial tricarboxylate/dicarboxylate
           carrier proteins; n=1; Aspergillus oryzae|Rep:
           Mitochondrial tricarboxylate/dicarboxylate carrier
           proteins - Aspergillus oryzae
          Length = 297

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           PFDT++ R+    G  +    Y+ + HC  +I  TEGT   + G    + R    GA   
Sbjct: 227 PFDTIKTRLQALDGSQR----YRGSFHCLRSIVTTEGTLALWNGTTPRLARLSISGAISF 282

Query: 190 VLYDEI 207
            +Y+ +
Sbjct: 283 AIYERV 288


>UniRef50_Q8I4M0 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 360

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           +  +P DTV+ R+  QSG       Y+ T HC+  I + EG    +KG  S +L
Sbjct: 19  LAGHPLDTVKVRLQTQSGPTPQ---YRGTFHCFKLIVQKEGFRGLYKGMSSPLL 69


>UniRef50_P55916 Cluster: Mitochondrial uncoupling protein 3; n=143;
           Eumetazoa|Rep: Mitochondrial uncoupling protein 3 - Homo
           sapiens (Human)
          Length = 312

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R       
Sbjct: 136 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCA 195

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 196 EVVTYDILKEKL 207


>UniRef50_Q4S8T7 Cluster: Chromosome 7 SCAF14703, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 7 SCAF14703, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 277

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M           Y+  ++C A++   EG S F+KG   + LR G+  
Sbjct: 206 VIASPVDVVKTRYMNSPPGQ-----YRGVLNCAASMLTKEGPSSFYKGFMPSFLRLGSWN 260

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ +
Sbjct: 261 VVMFVTYEQLKRAM 274


>UniRef50_Q2R5V9 Cluster: Mitochondrial carrier protein, expressed;
           n=1; Oryza sativa (japonica cultivar-group)|Rep:
           Mitochondrial carrier protein, expressed - Oryza sativa
           subsp. japonica (Rice)
          Length = 311

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           + +PFDTV+ ++   +  A   + Y+N  HC   I   EG    +KGA S+ +
Sbjct: 24  VGHPFDTVKVKLQAHNTTAHGKV-YRNAFHCTRRILVEEGMRGLYKGASSSFI 75


>UniRef50_Q01BW9 Cluster: Mitochondrial solute carrier protein; n=2;
           Ostreococcus|Rep: Mitochondrial solute carrier protein -
           Ostreococcus tauri
          Length = 426

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 5/51 (9%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDIL-----YKNTIHCWATIAKTEGTSPFFKG 144
           +YPF+ VRRRM MQSGR+ +D++       + +  + T+A   G    + G
Sbjct: 347 TYPFEVVRRRMQMQSGRSTTDLVIGRKALMSVVTSFRTVASATGWKSLYAG 397


>UniRef50_Q9GPR5 Cluster: RIM; n=2; Dictyostelium discoideum|Rep:
           RIM - Dictyostelium discoideum (Slime mold)
          Length = 365

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSG--RAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG 174
           I + P   ++ RM +Q+          Y+   HC  +I + EG   F+KG  ++++  + 
Sbjct: 172 ITTSPIWLIKTRMQLQTSLKNFNEGTQYRGMFHCCLSILREEGPLGFYKGLGASLISVSE 231

Query: 175 GAFVLVLYDEIK 210
            AF  VLY+  K
Sbjct: 232 SAFQFVLYEGFK 243


>UniRef50_Q54RA3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 510

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTG 174
           I + P D V+ R+M Q   +    ++YK++  C+    ++EG S  +KG   N  R G  
Sbjct: 431 ITTSPVDLVKTRIMNQPFDSNGVGLIYKSSYDCFKKTFQSEGISGLYKGFLPNWFRIGPH 490

Query: 175 GAFVLVLYDEIKKV 216
                +LY+ ++KV
Sbjct: 491 TIVTFILYEYLRKV 504


>UniRef50_P53007 Cluster: Tricarboxylate transport protein,
           mitochondrial precursor; n=49; Eukaryota|Rep:
           Tricarboxylate transport protein, mitochondrial
           precursor - Homo sapiens (Human)
          Length = 311

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM  Q   A     Y+NT  C   I K EG   F+KG    + R     A V 
Sbjct: 240 PLDVIKTRM--QGLEAHK---YRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVF 294

Query: 190 VLYDEIKKVL 219
           V+YDE+ K+L
Sbjct: 295 VIYDEVVKLL 304


>UniRef50_Q12482 Cluster: Mitochondrial aspartate-glutamate
           transporter AGC1; n=3; Saccharomycetaceae|Rep:
           Mitochondrial aspartate-glutamate transporter AGC1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 902

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-A 180
           ++ PFD ++ R+ +     K +  Y    H   TI K E    FFKG  + VLR +    
Sbjct: 744 LTTPFDVIKTRLQIDP--RKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFG 801

Query: 181 FVLVLYDEIK 210
           F L  Y+  K
Sbjct: 802 FTLAAYELFK 811


>UniRef50_UPI0000E4A38B Cluster: PREDICTED: similar to mitochondrial
           solute carrier family 25 member 19; n=5;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           mitochondrial solute carrier family 25 member 19 -
           Strongylocentrotus purpuratus
          Length = 417

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQ----SGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           YP D +++R+ +Q    + R    +  Y   +HC ATIAK EG    FKG   ++L+
Sbjct: 243 YPLDVIKKRLQVQGFEEARRPFGHVTHYTGFLHCIATIAKQEGMKGLFKGLSPSLLK 299



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQ----SGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           YP D +++R+ +Q    + R    +  Y   +HC ATIAK EG    FKG   ++L+
Sbjct: 337 YPLDVIKKRLQVQGFEEARRPFGHVTHYTGFLHCIATIAKQEGMKGLFKGLSPSLLK 393


>UniRef50_A5C1E5 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 387

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-A 180
           ++YP D VRR+M +Q   A      K T+    +IA+T+G    F G   N L+     A
Sbjct: 289 LTYPLDVVRRQMQVQRLSASHIGDVKGTMETLVSIAQTQGWKQLFSGLSINYLKVVPSVA 348

Query: 181 FVLVLYDEIKKVL 219
               +YD +K  L
Sbjct: 349 IGFTVYDIMKSWL 361


>UniRef50_Q1MVR0 Cluster: Similar to mitochondrial carrier protein
           family; protein id: At1g14560.1 [Arabidopsis thaliana];
           n=2; Dictyostelium discoideum|Rep: Similar to
           mitochondrial carrier protein family; protein id:
           At1g14560.1 [Arabidopsis thaliana] - Dictyostelium
           discoideum (Slime mold)
          Length = 443

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 19/47 (40%), Positives = 25/47 (53%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           + YP D +RRRMM+Q G   + +LYKN       I   EG   F+ G
Sbjct: 365 VCYPLDVLRRRMMIQ-GIGGNKVLYKNGWDATKKILSNEGLVAFYHG 410


>UniRef50_Q4PC12 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 495

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +1

Query: 4   ISYPFDTVRRRMM---MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           ++YP D +RRRM    M+  + K     KN I+    I K EG +  ++G   N+L+
Sbjct: 403 LTYPLDVLRRRMQVAGMKDSQEKLGYKDKNAINAIQNIIKAEGVTGLYRGLLPNLLK 459


>UniRef50_Q12251 Cluster: Probable mitochondrial carrier YPR011C;
           n=10; Saccharomycetales|Rep: Probable mitochondrial
           carrier YPR011C - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 326

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRR-MMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I+YPFD +RRR  ++  G  +    Y +      TI + EG S ++KG  +N+ +
Sbjct: 250 ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304


>UniRef50_Q10248 Cluster: Putative mitochondrial carrier C4G9.20c;
           n=1; Schizosaccharomyces pombe|Rep: Putative
           mitochondrial carrier C4G9.20c - Schizosaccharomyces
           pombe (Fission yeast)
          Length = 302

 Score = 37.1 bits (82), Expect = 0.48
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           ++  PFD V+ R+  QS  +    +Y N + C   I+K EG + F+KG
Sbjct: 33  LVGQPFDCVKVRLQSQSNVSP---IYNNALDCVKKISKNEGLAAFYKG 77


>UniRef50_Q4RRK6 Cluster: Chromosome 16 SCAF15002, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 16
           SCAF15002, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 310

 Score = 36.7 bits (81), Expect = 0.64
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDIL--YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R   Q     S +   Y  T+  + TIA+ EG    +KG   N+ R       
Sbjct: 135 PTDVVKVRFQAQVCLPNSSVTKRYNGTMDAYKTIARVEGVRGLWKGCLPNIARNAIVNCC 194

Query: 184 VLVLYDEIKKVL 219
            LV YD IK+++
Sbjct: 195 ELVTYDMIKELI 206


>UniRef50_Q24D15 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 339

 Score = 36.7 bits (81), Expect = 0.64
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 4/75 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++ YP DTV+RR  +Q      + +YK T  C+  I   EG    ++G     ++  G A
Sbjct: 262 LVVYPLDTVKRR--LQINGYNGNFMYKGTWDCFKKIWDKEGALSLYRGITITSVKFLGSA 319

Query: 181 ----FVLVLYDEIKK 213
                ++  Y ++KK
Sbjct: 320 ALQTILVAYYSQLKK 334


>UniRef50_P39953 Cluster: Probable mitochondrial carrier YEL006W;
           n=3; Saccharomycetales|Rep: Probable mitochondrial
           carrier YEL006W - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 335

 Score = 36.7 bits (81), Expect = 0.64
 Identities = 20/70 (28%), Positives = 32/70 (45%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + + P   V+ R+M+Q+G  K    YK TI  +  I + EG    + G    +L     A
Sbjct: 154 VATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVA 213

Query: 181 FVLVLYDEIK 210
               LY+ +K
Sbjct: 214 IQFPLYENLK 223


>UniRef50_Q8WUT9 Cluster: Solute carrier family 25 member 43; n=16;
           Euteleostomi|Rep: Solute carrier family 25 member 43 -
           Homo sapiens (Human)
          Length = 341

 Score = 36.7 bits (81), Expect = 0.64
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS----GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +S+PF+TV+R+M  QS         D+ +   + C+  I K +G    + G  +N+L+
Sbjct: 218 LSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLK 275


>UniRef50_Q67Z63 Cluster: Mitochondrial carrier like protein; n=16;
           Magnoliophyta|Rep: Mitochondrial carrier like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 337

 Score = 36.3 bits (80), Expect = 0.84
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AF 183
           +YP D VRRRM ++    ++ +        +  I K+EG    ++G      +   G   
Sbjct: 261 TYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEYYKVVPGVGI 320

Query: 184 VLVLYDEIKKVL 219
           V + YD ++++L
Sbjct: 321 VFMTYDALRRLL 332


>UniRef50_Q5KGS0 Cluster: Succinate:fumarate antiporter, putative;
           n=8; Dikarya|Rep: Succinate:fumarate antiporter,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 342

 Score = 36.3 bits (80), Expect = 0.84
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P DT++ R+   S + + +          + + + EG   F+KG    VLR   G A V 
Sbjct: 260 PIDTIKTRIQKAS-KVEGETALSRMAKVASEMFRNEGAKAFYKGITPRVLRVAPGQAIVF 318

Query: 190 VLYDEIKKVL 219
            +Y+ +KK++
Sbjct: 319 TVYERVKKMI 328


>UniRef50_P38127 Cluster: Mitochondrial carrier protein RIM2; n=10;
           Saccharomycetales|Rep: Mitochondrial carrier protein
           RIM2 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 377

 Score = 36.3 bits (80), Expect = 0.84
 Identities = 16/69 (23%), Positives = 35/69 (50%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P   ++ R+ +      S   YKN+  C  ++ + EG +  +KG  ++ L    G    +
Sbjct: 195 PIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWL 254

Query: 193 LYDEIKKVL 219
           LY+++K+++
Sbjct: 255 LYEQMKRLI 263


>UniRef50_Q75AH6 Cluster: Mitochondrial aspartate-glutamate
           transporter AGC1; n=2; Eremothecium gossypii|Rep:
           Mitochondrial aspartate-glutamate transporter AGC1 -
           Ashbya gossypii (Yeast) (Eremothecium gossypii)
          Length = 911

 Score = 36.3 bits (80), Expect = 0.84
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-A 180
           ++ PFD ++ R+ +   + +S  +Y        TI K EG   FFKG  + VLR +    
Sbjct: 736 LTTPFDVIKTRLQIDPKKGES--VYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFG 793

Query: 181 FVLVLYD 201
           F L  Y+
Sbjct: 794 FTLAAYE 800


>UniRef50_Q9VKZ5 Cluster: CG4995-PA, isoform A; n=3; Drosophila
           melanogaster|Rep: CG4995-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 399

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           P +  + R+ + S +  S I +   IHC   I KTEG    FKG  + +LR   G
Sbjct: 152 PMELAKTRLQL-STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPG 205



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ +PFDTV+  +     R      YK T HC+ TI + +     ++G  S+ + G G  
Sbjct: 56  LVGHPFDTVKVHLQTDDPRNPK---YKGTFHCFRTIVQRDKFIGLYRG-ISSPMGGIGLV 111

Query: 175 GAFVLVLYDEIKKV 216
            A V  +Y  ++++
Sbjct: 112 NAIVFGVYGNVQRL 125


>UniRef50_A1Z7S4 Cluster: CG8026-PA, isoform A; n=6;
           Endopterygota|Rep: CG8026-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 360

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P   V+ R+ +Q   A S   Y+  IH    I K EG    ++G    +L  + GA
Sbjct: 138 LLTNPIWVVKTRLCLQCDAASS-AEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGA 196

Query: 181 FVLVLYDEIK 210
              + Y+E+K
Sbjct: 197 IQFMTYEELK 206


>UniRef50_A0D6F3 Cluster: Chromosome undetermined scaffold_4, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_4,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 295

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TGGAF 183
           +YP  T++ R++        +  YKN       I + EG   F+KG  ++VL+G    A 
Sbjct: 215 TYPMTTIKTRIIQNQYIGTDNPKYKNNFDIANKILEHEGLRGFYKGISASVLKGMPSKAI 274

Query: 184 VLVLYDEIKKVL 219
               Y+  K +L
Sbjct: 275 YFFFYEHFKDML 286


>UniRef50_A0BLZ2 Cluster: Chromosome undetermined scaffold_115,
           whole genome shotgun sequence; n=3;
           Oligohymenophorea|Rep: Chromosome undetermined
           scaffold_115, whole genome shotgun sequence - Paramecium
           tetraurelia
          Length = 301

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-GA 180
           I+ PFD ++ R  +          YKN    +  I K +G   F++G   N++R      
Sbjct: 130 IASPFDVIKVRFQVDGNLPVEQRRYKNLTDAYIKIYKQDGLHGFWRGVTPNIIRNAVINC 189

Query: 181 FVLVLYDEIKKVL 219
             L  +D IK+ L
Sbjct: 190 AELATFDHIKESL 202


>UniRef50_A2R479 Cluster: Function: OAC1 of S. cerevisiae is an
           oxaloacetate carrier; n=15; Pezizomycotina|Rep:
           Function: OAC1 of S. cerevisiae is an oxaloacetate
           carrier - Aspergillus niger
          Length = 406

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           + +P DT+  RM  Q+G      LYK    C     KTEG    +KG F+++ R
Sbjct: 323 VMHPPDTIMSRMYNQTGN-----LYKGVFDCLFKTIKTEGVLAIYKGYFAHLAR 371


>UniRef50_Q1ECW7 Cluster: Hepatocellular carcinoma down-regulated
           mitochondrial carrier homolog A; n=7; Clupeocephala|Rep:
           Hepatocellular carcinoma down-regulated mitochondrial
           carrier homolog A - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 294

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TGGA 180
           +  P D ++ R+ M   R +    Y+  +HC     +TEG   FF+    N LR      
Sbjct: 217 VGTPMDVIKARLQMDGVRGQRR--YRGLLHCLTVTTRTEGLGVFFRSLGINCLRAFPVNM 274

Query: 181 FVLVLYDEIKKVL 219
            V  +Y+   +VL
Sbjct: 275 VVFAVYEVSVRVL 287


>UniRef50_Q0E2M9 Cluster: Os02g0226300 protein; n=5;
           Magnoliophyta|Rep: Os02g0226300 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 377

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 20/54 (37%), Positives = 28/54 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I+YP D VRR+M +Q+  + +    K T    A IAK +G    F G   N L+
Sbjct: 259 ITYPLDVVRRQMQVQAFSSSNLEKGKGTFGSIAMIAKHQGWRQLFSGLSINYLK 312


>UniRef50_Q57UM4 Cluster: Mitochondrial carrier protein, putative;
           n=2; Trypanosoma|Rep: Mitochondrial carrier protein,
           putative - Trypanosoma brucei
          Length = 331

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 20/65 (30%), Positives = 33/65 (50%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           ++ PF+ V RRM + +  + +   YK  +HC  TI   EG +  + G  + +L    G  
Sbjct: 262 LTQPFEVVSRRMQLTAS-STTGRRYKGMLHCARTIVAEEGYTALWAGMQARLLVTCVGVA 320

Query: 184 VLVLY 198
           VL L+
Sbjct: 321 VLELH 325


>UniRef50_Q54DU1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 297

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS-GRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           ++YPFD VRRR+     G AK+ + L   T+   A I K EG    +KG   N ++
Sbjct: 220 VAYPFDVVRRRVQTHGFGDAKAVVNLEHGTLRTIAHILKEEGILALYKGLSINYVK 275


>UniRef50_Q16YM1 Cluster: Mitochondrial carrier protein ymc; n=1;
           Aedes aegypti|Rep: Mitochondrial carrier protein ymc -
           Aedes aegypti (Yellowfever mosquito)
          Length = 380

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ YPFDTV+  +  Q  R   + LYK T+ C+  I   E     ++G  S+ + G    
Sbjct: 17  LVGYPFDTVKVHLQTQDYR---NPLYKGTLDCFRKIIAKESVRGLYRG-MSSPMAGVAAV 72

Query: 175 GAFVLVLYDEIKK 213
            A V  +Y  +++
Sbjct: 73  NAIVFGVYGNVQR 85


>UniRef50_A7SDS4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 306

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 3/75 (4%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSD--ILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TG 174
           I  P D  + +M +Q  RA+S   I Y+N  H   TIA+T G    ++G  + ++R    
Sbjct: 130 IEGPIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYGIRGCYQGLSATLVRNIPA 189

Query: 175 GAFVLVLYDEIKKVL 219
             F    Y+  K +L
Sbjct: 190 NGFFFGFYEFTKNLL 204


>UniRef50_A0C2U9 Cluster: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 299

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           I+YPFD +R R+ MQ    K   LYKN       I K EG   F+ G
Sbjct: 122 IAYPFDFLRTRLAMQ----KDAFLYKNIYDAALKIYKIEGFMSFYSG 164


>UniRef50_Q750J8 Cluster: AGL047Cp; n=1; Eremothecium gossypii|Rep:
           AGL047Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 316

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRR-MMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           + YPFD +RRR  ++  G+++    Y +      TI + EG   ++KG  +N+++
Sbjct: 240 VVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294


>UniRef50_Q01DN6 Cluster: Mitochondrial carnitine-acylcarnitine
           carrier protein; n=2; Ostreococcus|Rep: Mitochondrial
           carnitine-acylcarnitine carrier protein - Ostreococcus
           tauri
          Length = 558

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVL 189
           YP + ++RR+ +   +  + + YKN  H    +  TEG    + G   N  +    A + 
Sbjct: 484 YPLEMIQRRIQVAGMKQGAKVAYKNMFHGIYVVGTTEGVGALYAGLLPNYAKILPSAAIS 543

Query: 190 VLYDEIKKVL 219
               E+ K L
Sbjct: 544 FYVYELMKQL 553


>UniRef50_Q9VMK1 Cluster: CG9064-PA; n=2; Sophophora|Rep: CG9064-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 335

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           ++S P D ++ RMM Q    +  ++ YKN++ C   + + EG    +KG
Sbjct: 256 VLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKG 304


>UniRef50_Q9VC40 Cluster: CG5805-PA; n=6; Endopterygota|Rep:
           CG5805-PA - Drosophila melanogaster (Fruit fly)
          Length = 339

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 17/70 (24%), Positives = 37/70 (52%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVL 189
           +P   ++ ++ +Q    KSD+ YK  + C   I ++EG    ++G + + ++   G F +
Sbjct: 58  FPLTVIKTQLQVQH---KSDV-YKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYI 113

Query: 190 VLYDEIKKVL 219
             Y+ ++ VL
Sbjct: 114 STYEGVRHVL 123


>UniRef50_Q8N413-4 Cluster: Isoform 4 of Q8N413 ; n=3; Eutheria|Rep:
           Isoform 4 of Q8N413 - Homo sapiens (Human)
          Length = 335

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSG-RAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           PFD ++ R+  Q+  RA+       Y+  +HC A+I + EG    F+GA++  LR T
Sbjct: 95  PFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDT 151


>UniRef50_Q8LDF6 Cluster: Putative mitochondrial dicarboxylate
           carrier protein; n=4; Arabidopsis thaliana|Rep: Putative
           mitochondrial dicarboxylate carrier protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 313

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + S P D ++ R+M     A     YK  + C     K EG    +KG    V R     
Sbjct: 235 VASNPVDVIKTRVMNMKVVAGVAPPYKGAVDCALKTVKAEGIMSLYKGFIPTVSRQAPFT 294

Query: 181 FVL-VLYDEIKKVL 219
            VL V  +++KK+L
Sbjct: 295 VVLFVTLEQVKKLL 308


>UniRef50_Q9VLF1 Cluster: CG9582-PA; n=2; Sophophora|Rep: CG9582-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 300

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +1

Query: 61  KSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           K ++ Y+ TI    +  K EG    FKG  + +LR G GGA +LV Y+ + + L
Sbjct: 242 KGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFL 295


>UniRef50_A7S9U9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 311

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSD-ILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFV 186
           P+D V  R+  Q   +  + +LY+    C+  I + EG   F+KG   +  R G      
Sbjct: 230 PWDVVATRLYNQGTSSSGEKLLYRGFFDCFLKIFRKEGVLGFYKGVGPHYFRIGPHTVLS 289

Query: 187 LVLYDEIKKV 216
           L+ +D++K +
Sbjct: 290 LLFWDQLKSL 299



 Score = 33.9 bits (74), Expect = 4.5
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 13  PFDTVRRRMMMQS---GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAF 150
           P + V+ RM +Q     R    + Y+N  H   TIAK EG     KG F
Sbjct: 24  PLEVVKTRMQLQGELKSRGTYSVYYRNVFHASYTIAKYEGILAMQKGLF 72


>UniRef50_A4H8E6 Cluster: Mitochondrial ornithine carrier
           protein-like protein; n=1; Leishmania braziliensis|Rep:
           Mitochondrial ornithine carrier protein-like protein -
           Leishmania braziliensis
          Length = 299

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           PF+ V+ RM     R +    Y+ ++ C   + +  G   F+KG F+ + R   G  V  
Sbjct: 115 PFELVKCRMQADGRRGQRQ--YRGSLDCAQQVFRQHGVKGFYKGGFAMLCREVPGVVVWC 172

Query: 193 -LYDEIK 210
             YD +K
Sbjct: 173 GTYDTLK 179


>UniRef50_Q8N413 Cluster: Solute carrier family 25 member 45; n=27;
           Euteleostomi|Rep: Solute carrier family 25 member 45 -
           Homo sapiens (Human)
          Length = 288

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSG-RAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           PFD ++ R+  Q+  RA+       Y+  +HC A+I + EG    F+GA++  LR T
Sbjct: 119 PFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDT 175


>UniRef50_UPI00015B4EB4 Cluster: PREDICTED: similar to SLC25A35
           protein; n=4; Nasonia vitripennis|Rep: PREDICTED:
           similar to SLC25A35 protein - Nasonia vitripennis
          Length = 317

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSD-ILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFV 186
           PFD V  R+  Q   AK   +LY         I +TEG    +KG F   LR        
Sbjct: 242 PFDVVATRLYNQGIDAKGKGVLYNGLFDALYKIFRTEGVFGLYKGVFPTWLRIAPHTVLC 301

Query: 187 LVLYDEIKK 213
           LV Y++I +
Sbjct: 302 LVFYEKIAR 310


>UniRef50_UPI000150A9DC Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 327

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ R+ +QS     +  YKN+I     I+K EG    +KG  + +   G   A   
Sbjct: 138 PIDVIKERLQVQSNLKLYE--YKNSIDAIKQISKAEGILGLYKGYGATLASFGPYSALYF 195

Query: 190 VLYDEIKKVL 219
           + Y++ KK +
Sbjct: 196 MFYEKFKKAV 205


>UniRef50_Q9MA27 Cluster: T5E21.6; n=9; Magnoliophyta|Rep: T5E21.6 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 319

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKS----DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I+YP D VRR+M +++ +  +    +  YKNT     TI +T+G    F G   N ++
Sbjct: 232 ITYPLDVVRRQMQVENLQPMTSEGNNKRYKNTFDGLNTIVRTQGWKQLFAGLSINYIK 289


>UniRef50_O04619 Cluster: A_IG002N01.16 protein; n=9;
           Magnoliophyta|Rep: A_IG002N01.16 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 352

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 12/84 (14%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMM-----------QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAF 150
           I+YP D +RRRM M             GR+ + + Y   +  +    + EG    +KG  
Sbjct: 261 IAYPLDVIRRRMQMVGWKDASAIVTGEGRSTASLEYTGMVDAFRKTVRHEGFGALYKGLV 320

Query: 151 SNVLRGTGG-AFVLVLYDEIKKVL 219
            N ++     A   V Y+ +K VL
Sbjct: 321 PNSVKVVPSIAIAFVTYEMVKDVL 344


>UniRef50_Q54PY7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 318

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           + + P D ++ R+M        ++ YK T  C +   + EG   F+KG
Sbjct: 237 VATSPLDVIKTRIMNSPKTVTGELQYKGTFDCLSKTLRAEGFKAFYKG 284


>UniRef50_Q38BB0 Cluster: Mitochondrial carrier protein, putative;
           n=1; Trypanosoma brucei|Rep: Mitochondrial carrier
           protein, putative - Trypanosoma brucei
          Length = 704

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEG-TSPFFKGAFSNVLRGTGGAF 183
           +YP D VRRRM +  GR      Y+   H    I K EG    ++KG   N ++G     
Sbjct: 334 TYPLDIVRRRMQVTPGR------YRGVFHALRVIYKEEGFLQGWYKGLSMNWIKGPIAVS 387

Query: 184 VLVLYDEIKK 213
            +   ++I K
Sbjct: 388 TVFTVNDIVK 397


>UniRef50_O01883 Cluster: Uncoupling protein (Mitochondrial
           substrate carrier) protein 4; n=2; Caenorhabditis|Rep:
           Uncoupling protein (Mitochondrial substrate carrier)
           protein 4 - Caenorhabditis elegans
          Length = 324

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 12/83 (14%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDI-----------LYKNTIHCWATIAKTEGTSPFFKGA 147
           I+S P D V+ RMM Q  R + D            LYK  + C+  I K EG    +KG 
Sbjct: 236 IVSLPSDVVKTRMMDQI-RHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNEGFFSLYKGF 294

Query: 148 FSNVLRGTGGAFVL-VLYDEIKK 213
             + +R    +    V Y+EI+K
Sbjct: 295 LPSYIRMAPWSLTFWVSYEEIRK 317


>UniRef50_A7RL60 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 308

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMM-MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           ++ +P DT++ R+  M   +     +YKN+  C+  I + EG    F+G    +L     
Sbjct: 34  LVGFPLDTIKVRLQAMPLPKPGEPWMYKNSFDCFFKIIRNEGVYYLFRGVTVPILNSIPN 93

Query: 178 AFVL 189
             VL
Sbjct: 94  TTVL 97


>UniRef50_A0EEK4 Cluster: Chromosome undetermined scaffold_91, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_91,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 286

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAK-SDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           IIS+PF  +   M   +     S + YKN   C + + K++  +   +G+    L  T  
Sbjct: 197 IISFPFFKIMLMMKADTLNFNHSPVQYKNVFECTSRVLKSQKLTYLIQGSTQRFLLATKD 256

Query: 178 AFVLVLYDEIK 210
           A  L+LY  I+
Sbjct: 257 ALTLMLYYNIQ 267


>UniRef50_Q4PEG8 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 352

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 19/72 (26%), Positives = 34/72 (47%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + + P   V+ R M+QS +      Y++T   +  I K+EG   F+KG   ++   +  A
Sbjct: 136 VCTSPLWVVKTRFMLQSAKDTGVKPYRHTGDAFVQIYKSEGLRGFYKGLLPSLFGVSHVA 195

Query: 181 FVLVLYDEIKKV 216
               LY+  K +
Sbjct: 196 VQFPLYESFKAI 207


>UniRef50_Q4P2S5 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 475

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++YP+  +R R+      A S I Y N   C       EG   F+KG   N++R   G 
Sbjct: 381 LLTYPYQVIRSRIQ---NHATSHI-YPNISTCIRLTYTQEGLRAFYKGLVPNLVRILPGT 436

Query: 181 FV-LVLYDEIKKVL 219
            V  V+Y+ +  VL
Sbjct: 437 CVTFVVYENVSWVL 450


>UniRef50_O94502 Cluster: Mitochondrial carrier, calcium binding
           subfamily; n=1; Schizosaccharomyces pombe|Rep:
           Mitochondrial carrier, calcium binding subfamily -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 426

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           I +P + +R R+  Q G +     Y   I C+    K EG    +KG   N+L+     A
Sbjct: 352 IVFPLNVIRTRLQTQ-GTSAHPATYDGFIDCFYKTTKNEGFRGLYKGLSPNLLKVAPSVA 410

Query: 181 FVLVLYDEIKKVL 219
              ++Y+  KK L
Sbjct: 411 ISYLVYENCKKWL 423


>UniRef50_UPI00006CFCC1 Cluster: hypothetical protein
           TTHERM_00599880; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00599880 - Tetrahymena
           thermophila SB210
          Length = 662

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = -3

Query: 510 KKTNHFSF*IKNRLYNMKAIEMSKLENFQRGPISLQLEQPIM*HLIKQ*IMESLYNTL 337
           KKT+  SF  KN+  N K  EM KL++F     S Q+ +  +  L+   ++E+ Y TL
Sbjct: 95  KKTSATSFNAKNQKGNFKIHEMFKLDDFLNSKKSHQITKSDVSGLLNNHLIENEYETL 152


>UniRef50_UPI00006CC3DC Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 1773

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 17/73 (23%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           ++  P D +++R+ +QS        YKN++  +  I ++EG    ++G  + ++  GT  
Sbjct: 117 VLWLPVDVLKQRLQVQSNLGLYQ--YKNSLDAFQKIVQSEGFFALYRGFGATLISFGTSV 174

Query: 178 AFVLVLYDEIKKV 216
           A     Y+++K++
Sbjct: 175 AIYFASYEKLKEI 187


>UniRef50_A7PP43 Cluster: Chromosome chr8 scaffold_23, whole genome
           shotgun sequence; n=7; Magnoliophyta|Rep: Chromosome
           chr8 scaffold_23, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 381

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++ YP DTVRR+M M+         YK  +     I + +G    ++G   N L+    +
Sbjct: 290 VMCYPLDTVRRQMQMKGAP------YKTVLDAIPGIVERDGFIGLYRGFVPNALKTLPNS 343

Query: 181 FV-LVLYDEIKKVL 219
            + L  +D +K+++
Sbjct: 344 SIRLTTFDSVKRLI 357


>UniRef50_Q86AV5 Cluster: Similar to Mus musculus (Mouse).
           Calcium-binding mitochondrial carrier protein Aralar2;
           n=2; Dictyostelium discoideum|Rep: Similar to Mus
           musculus (Mouse). Calcium-binding mitochondrial carrier
           protein Aralar2 - Dictyostelium discoideum (Slime mold)
          Length = 301

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNV 159
           +S PFD ++ R+ ++ G   +D  YK    C+    ++EG    FKG    V
Sbjct: 227 VSTPFDVIKTRIQVKPG--PNDPHYKGIADCFRKTIQSEGPKALFKGVLPRV 276


>UniRef50_O14281 Cluster: Iron ion transporter; n=13; Dikarya|Rep:
           Iron ion transporter - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 303

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFF 138
           PFD +++RM + S +      YK+ +HC  T+ + EG   F+
Sbjct: 133 PFDVIKQRMQLPSRK------YKSALHCATTVFRNEGLGAFY 168


>UniRef50_O95847 Cluster: Mitochondrial uncoupling protein 4; n=37;
           Eumetazoa|Rep: Mitochondrial uncoupling protein 4 - Homo
           sapiens (Human)
          Length = 323

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           I+  P D ++ R+M Q   +    +LYK++  C     + EG    +KG   + LR T  
Sbjct: 244 ILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPW 303

Query: 178 AFVLVL-YDEIKKV 216
           + V  L Y++I+++
Sbjct: 304 SMVFWLTYEKIREM 317


>UniRef50_UPI0000ECBAAF Cluster: Hepatocellular
           carcinoma-downregulated mitochondrial carrier protein.;
           n=2; Gallus gallus|Rep: Hepatocellular
           carcinoma-downregulated mitochondrial carrier protein. -
           Gallus gallus
          Length = 285

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 2/70 (2%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMM-QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TGG 177
           ++ P D ++ RM + +SG+ K    YK  IHC     + EG    FKG   N +R     
Sbjct: 209 LATPLDVLKSRMQVDESGQHK----YKGLIHCARESVRQEGLKVLFKGLGLNCIRAFPVN 264

Query: 178 AFVLVLYDEI 207
             V V Y+ +
Sbjct: 265 MVVFVTYEAV 274


>UniRef50_A3CI14 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 865

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 73  LYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKV 216
           +Y+N  HC   +  TEG +  +KG F+   R G   A   V+ ++++++
Sbjct: 811 VYRNGFHCGYQVVVTEGVTSLYKGGFATFARLGPQTAITFVVCEKLREL 859


>UniRef50_O77304 Cluster: LA-MSC; n=3; Oxytrichidae|Rep: LA-MSC -
           Oxytricha fallax
          Length = 307

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 16/53 (30%), Positives = 27/53 (50%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           P + V+ R+ +Q    K+   Y+  +HC   I + EG+   +KG  S + R T
Sbjct: 127 PIELVKCRLQVQR-EDKAHAYYRGPLHCVKRIIQEEGSRGLYKGLLSTISRET 178


>UniRef50_Q6Q0C1 Cluster: Hepatocellular carcinoma down-regulated
           mitochondrial carrier protein; n=10; Tetrapoda|Rep:
           Hepatocellular carcinoma down-regulated mitochondrial
           carrier protein - Homo sapiens (Human)
          Length = 308

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           Y+  +HC AT+A+ EG    +KG+ + VLR
Sbjct: 159 YRGPLHCLATVAREEGLCGLYKGSSALVLR 188


>UniRef50_Q4S893 Cluster: Chromosome 3 SCAF14707, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 3
           SCAF14707, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 334

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           ++  P DT+R R   Q G  K   +Y N  H  +T+  TEG   F++G    +L
Sbjct: 134 VVCQPLDTLRTRFAAQ-GEPK---VYSNLRHAVSTMCSTEGALTFYRGLSPTLL 183


>UniRef50_Q3KNJ4 Cluster: Expressed sequence AU042651; n=4;
           Murinae|Rep: Expressed sequence AU042651 - Mus musculus
           (Mouse)
          Length = 306

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           I+ YP DTV+ R+  Q+G     + Y NT +C   + K E    FFKG
Sbjct: 21  IVGYPLDTVKTRL--QAG-----VGYANTFNCIRMVYKRERVFGFFKG 61



 Score = 33.1 bits (72), Expect = 7.9
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +1

Query: 55  RAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AFVLVLY 198
           ++++   Y+  +HC ATI + EG +  ++GA + +LR   G  F  + Y
Sbjct: 146 KSRAVAAYQGPVHCIATIVQMEGLTGLYRGASAMLLRDIPGYCFYFIPY 194


>UniRef50_Q9XI74 Cluster: F7A19.22 protein; n=10; Magnoliophyta|Rep:
           F7A19.22 protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 305

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           +S P D V+ RMM Q   A    +Y+N+  C     K EG    +KG F    R     F
Sbjct: 232 LSCPADVVKTRMMNQGENA----VYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPWQF 287

Query: 184 VL-VLYDEIK 210
           V  V Y++ +
Sbjct: 288 VFWVSYEKFR 297


>UniRef50_A5BXC7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 316

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQ 48
           ++SYP DTVRRRMMMQ
Sbjct: 282 LLSYPLDTVRRRMMMQ 297


>UniRef50_A4S8E6 Cluster: MC family transporter; n=2;
           Ostreococcus|Rep: MC family transporter - Ostreococcus
           lucimarinus CCE9901
          Length = 322

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 1/69 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV- 186
           YP DT+RR+M +Q         Y N +     I    G    F+G   N ++      + 
Sbjct: 236 YPLDTIRRQMQLQGS------TYANMLDAGRGIVAANGVGGLFRGFIPNAMKNMPNKSIQ 289

Query: 187 LVLYDEIKK 213
           L  +D +KK
Sbjct: 290 LTTFDVLKK 298


>UniRef50_Q9VMK0 Cluster: CG18340-PA, isoform A; n=2; Drosophila
           melanogaster|Rep: CG18340-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 337

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 2/73 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQ-SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTG 174
           I+S P D V+ R+M Q +      I YK ++ C + + + EG    +KG     +R G  
Sbjct: 258 ILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPA 317

Query: 175 GAFVLVLYDEIKK 213
                + +++I++
Sbjct: 318 SVVFWMTFEQIRR 330


>UniRef50_Q54W11 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 285

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR---GT 171
           + ++PFD +R R+M      +S   YK  I C   I + +G   F+KG    +LR     
Sbjct: 211 LTNFPFDVIRSRIMTMPYN-ESPPRYKGMIDCAKHIYRVDGLKGFWKGFSPCLLRTFPAN 269

Query: 172 GGAFV 186
           G  FV
Sbjct: 270 GATFV 274


>UniRef50_A1Z9M0 Cluster: CG18324-PB, isoform B; n=7;
           Sophophora|Rep: CG18324-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 307

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKG 144
           + + PFD +  RM  Q    K   ++YK  + C+  I +TEG    +KG
Sbjct: 223 VANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKG 271


>UniRef50_Q6C107 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 336

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           I +YPFD  R     Q  +  +   Y +    +  I KTEG   FF+G  S+++
Sbjct: 130 IATYPFDLFRTLFAAQGAKNCNVKNYTSLFQTFKLIYKTEGPLGFFRGVSSSII 183


>UniRef50_Q5KKK6 Cluster: Mitochondrial inner membrane protein,
           putative; n=2; Filobasidiella neoformans|Rep:
           Mitochondrial inner membrane protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 698

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTE-GTSPFFKGAFSNVL 162
           YP D V+ R+  Q      ++LY+N   C   +   E G   F++G    ++
Sbjct: 370 YPIDLVKTRLQNQRSTVVGEVLYRNAFDCVKKVYTNEGGIRAFYRGVLPQLV 421


>UniRef50_Q4P843 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 371

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 5/59 (8%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKS-----DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +  P DT   RM  Q  R          LY+N  HC    AK EG   ++KG  +++ R
Sbjct: 276 VMQPADTALTRMYNQPVRVDERGRSVGTLYRNPFHCLYLTAKAEGVMGWYKGTTAHLFR 334


>UniRef50_A7TIY4 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 320

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRR-MMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I YPFD +RRR  ++  G+ +    Y +  +   TI K EG   ++ G   N+ +
Sbjct: 244 IIYPFDLLRRRFQVINMGKNELGFNYTSIWNALVTIGKKEGFKGYYNGLTVNLFK 298


>UniRef50_O75746 Cluster: Calcium-binding mitochondrial carrier
           protein Aralar1; n=26; Euteleostomi|Rep: Calcium-binding
           mitochondrial carrier protein Aralar1 - Homo sapiens
           (Human)
          Length = 678

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG S F+KG  + V R +    V +
Sbjct: 538 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTL 595

Query: 193 LYDEI 207
            + E+
Sbjct: 596 AHYEV 600


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 687,736,705
Number of Sequences: 1657284
Number of extensions: 12451148
Number of successful extensions: 25803
Number of sequences better than 10.0: 158
Number of HSP's better than 10.0 without gapping: 24943
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25758
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 64615845515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).