SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8SZP2 Cluster: RE71854p; n=2; Sophophora|Rep: RE71854p...    88   2e-16
UniRef50_Q9VB86 Cluster: CG5812-PA; n=10; Endopterygota|Rep: CG5...    79   2e-13
UniRef50_Q16VP6 Cluster: Putative uncharacterized protein; n=2; ...    78   2e-13
UniRef50_Q7QFK3 Cluster: ENSANGP00000017295; n=7; Endopterygota|...    71   4e-11
UniRef50_Q7QFK4 Cluster: ENSANGP00000017315; n=1; Anopheles gamb...    62   1e-08
UniRef50_Q8SZ76 Cluster: RE14272p; n=4; Diptera|Rep: RE14272p - ...    61   3e-08
UniRef50_Q5BIE5 Cluster: RE40185p; n=2; Drosophila melanogaster|...    60   9e-08
UniRef50_Q7PXS3 Cluster: ENSANGP00000011799; n=1; Anopheles gamb...    59   1e-07
UniRef50_Q16I50 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q9VMZ6 Cluster: CG14643-PA; n=2; Sophophora|Rep: CG1464...    50   1e-04
UniRef50_Q7PS59 Cluster: ENSANGP00000020057; n=2; Anopheles gamb...    45   0.003
UniRef50_Q2IL44 Cluster: Putative uncharacterized protein; n=1; ...    37   0.54 
UniRef50_Q9VMZ8 Cluster: CG14640-PA; n=2; Sophophora|Rep: CG1464...    36   1.3  
UniRef50_Q8IR11 Cluster: CG32571-PA; n=2; Sophophora|Rep: CG3257...    36   1.7  
UniRef50_Q9VMZ5 Cluster: CG14639-PA; n=3; Sophophora|Rep: CG1463...    34   3.8  
UniRef50_UPI000155632F Cluster: PREDICTED: similar to venom myot...    34   5.1  
UniRef50_Q1E0K6 Cluster: Putative uncharacterized protein; n=1; ...    34   5.1  
UniRef50_Q8IR08 Cluster: CG32574-PA; n=3; Sophophora|Rep: CG3257...    33   6.7  
UniRef50_Q8IH13 Cluster: LD21452p; n=2; Sophophora|Rep: LD21452p...    33   6.7  
UniRef50_Q1DFP5 Cluster: Putative uncharacterized protein; n=2; ...    33   8.8  
UniRef50_Q1CNX5 Cluster: BBG17; n=5; Borrelia|Rep: BBG17 - Borre...    33   8.8  
UniRef50_Q8IR10 Cluster: CG32570-PA; n=2; Sophophora|Rep: CG3257...    33   8.8  
UniRef50_A6R3I1 Cluster: Predicted protein; n=1; Ajellomyces cap...    33   8.8  

>UniRef50_Q8SZP2 Cluster: RE71854p; n=2; Sophophora|Rep: RE71854p -
           Drosophila melanogaster (Fruit fly)
          Length = 197

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 48/103 (46%), Positives = 58/103 (56%), Gaps = 1/103 (0%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLHP-RNXXXXXXXXXXXXXXXXXXXXXXXXXNE 607
           P++ KH+YVHVPPPEP E + PR P ++ P +                          NE
Sbjct: 59  PVIHKHVYVHVPPPEP-EYQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQNE 117

Query: 608 EKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKTLVYVLVKKPEEQP+IIIP  +    PSKPEVYF +    K
Sbjct: 118 EKTLVYVLVKKPEEQPEIIIPTPAP-TQPSKPEVYFIRYKTQK 159


>UniRef50_Q9VB86 Cluster: CG5812-PA; n=10; Endopterygota|Rep:
           CG5812-PA - Drosophila melanogaster (Fruit fly)
          Length = 286

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 47/102 (46%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQR-LPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LVQKHIYVHVPPPE  E R  P +P     +                          NEE
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLPIG-QSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEE 188

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           KTLVYVLVKKPE+Q DI+IP  +    PSKPEVYF +    K
Sbjct: 189 KTLVYVLVKKPEDQQDIVIPTPAP-TQPSKPEVYFIKYKTQK 229



 Score = 33.9 bits (74), Expect = 5.1
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>UniRef50_Q16VP6 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 278

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 44/94 (46%), Positives = 50/94 (53%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEK 613
           +VQKHIYVHVPP EP E R  +I +   PR                           EEK
Sbjct: 122 VVQKHIYVHVPPQEPEETRAQQIVSQGVPRKHYKIIFIKTPNVQPSAAQIALQQAQQEEK 181

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           T+VYVLVKKP+EQ DI IP   +   PSKPEVYF
Sbjct: 182 TIVYVLVKKPDEQADINIPQLPS-LPPSKPEVYF 214



 Score = 42.3 bits (95), Expect = 0.014
 Identities = 20/30 (66%), Positives = 23/30 (76%), Gaps = 1/30 (3%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPV-GYSYSAPR 195
           M+  VVLACVAMA  RPE P+ GY+Y APR
Sbjct: 1   MKILVVLACVAMAAARPEAPLHGYNYPAPR 30


>UniRef50_Q7QFK3 Cluster: ENSANGP00000017295; n=7;
           Endopterygota|Rep: ENSANGP00000017295 - Anopheles
           gambiae str. PEST
          Length = 192

 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 44/105 (41%), Positives = 53/105 (50%), Gaps = 2/105 (1%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLHP-RNXXXXXXXXXXXXXXXXXXXXXXXXXNE 607
           P++ KH+YVHVPPPEP E    R P  + P +                          NE
Sbjct: 56  PIIHKHVYVHVPPPEP-EYVTTRKPIVVPPPQKHYKIVFIKAPSPPTQAPPVLPPIQQNE 114

Query: 608 EKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISN-PKG 739
           EKTLVYVLVKK +E  +I+IP  +    PSKPEVYF    N P G
Sbjct: 115 EKTLVYVLVKKQDEPEEIVIPTVAP-TPPSKPEVYFILYQNQPNG 158


>UniRef50_Q7QFK4 Cluster: ENSANGP00000017315; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017315 - Anopheles gambiae
           str. PEST
          Length = 199

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 38/91 (41%), Positives = 44/91 (48%)
 Frame = +2

Query: 443 KHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEKTLV 622
           KHIYVHVPPPEP +    +I A    +                           EEKT+V
Sbjct: 63  KHIYVHVPPPEPQQSFQQQIVAPGLRQKHYKIIFIKTPHQQPSAAQLALQQSQTEEKTIV 122

Query: 623 YVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           YVLVKKPE   DI +P  +    PSKPEVYF
Sbjct: 123 YVLVKKPEAVGDISLPLPAV-TKPSKPEVYF 152



 Score = 33.1 bits (72), Expect = 8.8
 Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 1/21 (4%)
 Frame = +1

Query: 124 VLACVAMAYGRPEPPV-GYSY 183
           VLACVA+   RPEPPV GYS+
Sbjct: 9   VLACVAIVVARPEPPVGGYSH 29


>UniRef50_Q8SZ76 Cluster: RE14272p; n=4; Diptera|Rep: RE14272p -
           Drosophila melanogaster (Fruit fly)
          Length = 198

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 37/94 (39%), Positives = 44/94 (46%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEK 613
           LV K++YVHVPP EP             P+                          +E K
Sbjct: 69  LVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQDEHK 128

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           TLVYVLVKKPEEQ  +I+P +     PSKPEVYF
Sbjct: 129 TLVYVLVKKPEEQQPVILP-APEPTEPSKPEVYF 161


>UniRef50_Q5BIE5 Cluster: RE40185p; n=2; Drosophila
           melanogaster|Rep: RE40185p - Drosophila melanogaster
           (Fruit fly)
          Length = 392

 Score = 59.7 bits (138), Expect = 9e-08
 Identities = 39/103 (37%), Positives = 49/103 (47%), Gaps = 3/103 (2%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRL--PRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXX-NE 607
           V KHIYVHVPP +  E+     R+     P+                           NE
Sbjct: 159 VHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQNE 218

Query: 608 EKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKTL+YVL KKPE++ DI+IP +     PSKPEVYF +    K
Sbjct: 219 EKTLIYVLHKKPEQEQDIVIP-TPPPTKPSKPEVYFIKYKTKK 260


>UniRef50_Q7PXS3 Cluster: ENSANGP00000011799; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000011799 - Anopheles gambiae
           str. PEST
          Length = 197

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 37/100 (37%), Positives = 45/100 (45%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEKT 616
           V KH+YVHV P E  E     I      +                          NEEKT
Sbjct: 82  VHKHVYVHVAPEEKEEIHQKVILPTYTKQKHYKIIFIKAPSPPTVSKVVLPQPPVNEEKT 141

Query: 617 LVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           LVYVL KKPE + +I++P  +T   PSKPEVYF +    K
Sbjct: 142 LVYVLHKKPELEQEIVVPAPAT-AKPSKPEVYFIKYKTKK 180


>UniRef50_Q16I50 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 164

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 35/101 (34%), Positives = 46/101 (45%), Gaps = 1/101 (0%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRLPR-IPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEK 613
           V KH+YVHVPP +  E   PR I    H +                          +EEK
Sbjct: 63  VYKHVYVHVPPEDKEEYEAPRVIQPVSHKQKHYKIIFIKAPSPPAPKSVVVPPQPSSEEK 122

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           T+VYVL +KPE Q ++I+         +KPEVYF +  N K
Sbjct: 123 TIVYVLHQKPEHQQEVIVQKPEP-AKQNKPEVYFIKYKNRK 162


>UniRef50_Q9VMZ6 Cluster: CG14643-PA; n=2; Sophophora|Rep:
           CG14643-PA - Drosophila melanogaster (Fruit fly)
          Length = 278

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 33/95 (34%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPR-IPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LV K IYVHVPP E  E R P+ +     PR                           EE
Sbjct: 112 LVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVSKAALRIKQAPVEE 171

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           KT++YVL KKP+               PSKPEV+F
Sbjct: 172 KTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFF 206



 Score = 34.7 bits (76), Expect = 2.9
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 511 APPQKHYKIIFIKGPNSSHS 570
           APP+KHY+I+FIK P +S S
Sbjct: 139 APPRKHYRIVFIKAPTTSVS 158


>UniRef50_Q7PS59 Cluster: ENSANGP00000020057; n=2; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000020057 - Anopheles gambiae
           str. PEST
          Length = 365

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 31/95 (32%), Positives = 40/95 (42%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           P+V K+ Y HV P EP  +   +    + PR                           EE
Sbjct: 134 PVVLKNFYYHVAPEEPQAEAGAKTLT-ITPRKHYKVIFIKAPSASANAGASSQAASQTEE 192

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           KTLVYVLV KP +        +S+ +S  KPEVYF
Sbjct: 193 KTLVYVLVNKPAKAQATSEAEASS-YSSGKPEVYF 226


>UniRef50_Q2IL44 Cluster: Putative uncharacterized protein; n=1;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative
           uncharacterized protein - Anaeromyxobacter dehalogenans
           (strain 2CP-C)
          Length = 500

 Score = 37.1 bits (82), Expect = 0.54
 Identities = 19/51 (37%), Positives = 23/51 (45%)
 Frame = +3

Query: 669 QTPAPTSALQNRKFTFIKYQTQKESGWCYWPGALGGGLRPEGLRAEGLGRA 821
           + P+   A   R  T     T+   GWC  PG  G G RP   RA G GR+
Sbjct: 284 RNPSSRRACALRSSTISMAVTRGMPGWCTGPGPEGSGARPHVRRARGAGRS 334


>UniRef50_Q9VMZ8 Cluster: CG14640-PA; n=2; Sophophora|Rep:
           CG14640-PA - Drosophila melanogaster (Fruit fly)
          Length = 251

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 26/94 (27%), Positives = 39/94 (41%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEK 613
           +V K  ++H  P E  + +   I   +  RN                         NEEK
Sbjct: 78  IVSKRFFIHSAPEEAEDYKERHITVGVPKRNYNVVFIKSPQRNNRKTIKISPAA--NEEK 135

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           T++YVL KK E   +  +   ++  S SKPEV+F
Sbjct: 136 TVIYVLSKKGESDLNAEVVEQAS--STSKPEVFF 167


>UniRef50_Q8IR11 Cluster: CG32571-PA; n=2; Sophophora|Rep:
           CG32571-PA - Drosophila melanogaster (Fruit fly)
          Length = 346

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 25/100 (25%), Positives = 38/100 (38%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEKT 616
           + KH Y+H  P +  EQ++ R      P+                           EEKT
Sbjct: 147 INKHFYIHSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTASKAKIIANVAPVEEKT 206

Query: 617 LVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
            +YVL KK     D+     +     +KPEV+F +   P+
Sbjct: 207 AIYVLSKK-SNALDVTAEVVTQRPVANKPEVFFVKYKTPQ 245


>UniRef50_Q9VMZ5 Cluster: CG14639-PA; n=3; Sophophora|Rep:
           CG14639-PA - Drosophila melanogaster (Fruit fly)
          Length = 354

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 3/41 (7%)
 Frame = +2

Query: 602 NEEKTLVYVLVKKP---EEQPDIIIPNSSTHFSPSKPEVYF 715
           NEEKT++YVL KKP   E Q  + +  S       KPEVYF
Sbjct: 197 NEEKTVIYVLSKKPDLTEIQQQLQVTQSEA--KVQKPEVYF 235


>UniRef50_UPI000155632F Cluster: PREDICTED: similar to venom
           myotoxin inhibitor DM64; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to venom myotoxin
           inhibitor DM64 - Ornithorhynchus anatinus
          Length = 479

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 18/64 (28%), Positives = 28/64 (43%)
 Frame = +2

Query: 80  GSVSFRPSTKCALSWYSPVWLWPMAALNLQWDTATPLPEVTQEASALPLSAADTELLLWW 259
           G  + R S +C   W    W  P + L++    A+PLP+    A   PL      ++LW 
Sbjct: 64  GKANHRGSYRCYY-WLKEGWCGPSSFLDIT--AASPLPKPRLSAKPYPLLLPKENVMLWC 120

Query: 260 SFWI 271
             W+
Sbjct: 121 RVWV 124


>UniRef50_Q1E0K6 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 842

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAW 511
           P V KH+Y  VPP  PV + L RI  W
Sbjct: 647 PKVPKHMYYEVPPKPPVSEALARIFPW 673


>UniRef50_Q8IR08 Cluster: CG32574-PA; n=3; Sophophora|Rep:
           CG32574-PA - Drosophila melanogaster (Fruit fly)
          Length = 388

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPE--EQPDIIIPNSSTHFSPSKPEVYF 715
           EEKT++YVL KK    E  DI  P  +    PSKPEV+F
Sbjct: 229 EEKTVIYVLSKKDNQLEVNDIATPAPTV---PSKPEVFF 264


>UniRef50_Q8IH13 Cluster: LD21452p; n=2; Sophophora|Rep: LD21452p -
           Drosophila melanogaster (Fruit fly)
          Length = 308

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 26/104 (25%), Positives = 40/104 (38%), Gaps = 2/104 (1%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLH-PRNXXXXXXXXXXXXXXXXXXXXXXXXXNE 607
           P+V K+ ++H  P E  ++    +      PRN                          +
Sbjct: 127 PIVTKNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAAALNLAKTLKQ 186

Query: 608 EKTLVYVLVKKPEEQP-DIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKT+VYVL KK         I  +  H   +KPEV+F +   P+
Sbjct: 187 EKTVVYVLAKKTTASDLQDAIAEAPQHI--NKPEVFFIKYRTPE 228


>UniRef50_Q1DFP5 Cluster: Putative uncharacterized protein; n=2;
           Cystobacterineae|Rep: Putative uncharacterized protein -
           Myxococcus xanthus (strain DK 1622)
          Length = 209

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 2/32 (6%)
 Frame = -2

Query: 833 PPEVRPPKSFRPKSLRPKSTAQSPRP--IAPT 744
           PPEVR P +  P SL  + +A SPRP   APT
Sbjct: 24  PPEVRRPSAMAPTSLCERPSAGSPRPRRAAPT 55


>UniRef50_Q1CNX5 Cluster: BBG17; n=5; Borrelia|Rep: BBG17 - Borrelia
           hermsii DAH
          Length = 255

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = +2

Query: 620 VYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGIWL 748
           +  LV K  E P +  PN    F P  PE++F + + P G ++
Sbjct: 189 IVTLVFKGLEHPVLYEPNPEAMFLPMMPEIFFRRFAGPDGDYI 231


>UniRef50_Q8IR10 Cluster: CG32570-PA; n=2; Sophophora|Rep:
           CG32570-PA - Drosophila melanogaster (Fruit fly)
          Length = 247

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPE--EQPDIIIPNSSTHFSPSKPEVYF 715
           EEKT++YVL KK    +  DI  P  +    PSKPEV+F
Sbjct: 134 EEKTVIYVLSKKDNDVDASDIATPAPT---QPSKPEVFF 169


>UniRef50_A6R3I1 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 117

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +2

Query: 122 WYSPVWLWPMAA---LNLQWDTATPLPEVTQEASALPLSAADTELLLWWSFWIPRW 280
           W   V LW + +   L  +W   TP+P++T E+ A+ +   D E  L +   I RW
Sbjct: 23  WNIAVLLWDLVSPGHLFGKWKNLTPIPDITLESLAIDVQGEDKEGFLSFLRKILRW 78


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 704,836,603
Number of Sequences: 1657284
Number of extensions: 12728922
Number of successful extensions: 47502
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 44091
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47356
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 72553824147
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).