SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9BPR7 Cluster: Cuticle protein; n=4; Bombyx mori|Rep: ...   126   7e-28
UniRef50_Q9BPR5 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    52   1e-05
UniRef50_O77057 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    48   2e-04
UniRef50_A6WAF5 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q9BPR4 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    42   0.020
UniRef50_Q01645 Cluster: Male-specific sperm protein Mst84Dd; n=...    42   0.020
UniRef50_A7RFW7 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.082
UniRef50_Q5TVQ9 Cluster: ENSANGP00000028691; n=1; Anopheles gamb...    39   0.14 
UniRef50_P15265 Cluster: Sperm mitochondrial-associated cysteine...    38   0.19 
UniRef50_UPI0000EBE100 Cluster: PREDICTED: hypothetical protein;...    38   0.25 
UniRef50_Q5SS00 Cluster: Novel protein; n=10; Eumetazoa|Rep: Nov...    38   0.25 
UniRef50_UPI0000F2E2FE Cluster: PREDICTED: hypothetical protein;...    38   0.33 
UniRef50_A7SX06 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.33 
UniRef50_A7RKE3 Cluster: Predicted protein; n=2; Nematostella ve...    38   0.33 
UniRef50_Q64298 Cluster: Sperm mitochondrial-associated cysteine...    38   0.33 
UniRef50_UPI0000F31DEE Cluster: UPI0000F31DEE related cluster; n...    37   0.44 
UniRef50_UPI0000F2EB19 Cluster: PREDICTED: hypothetical protein;...    36   0.76 
UniRef50_UPI000023E51A Cluster: hypothetical protein FG08013.1; ...    36   0.76 
UniRef50_UPI00004D8D50 Cluster: UPI00004D8D50 related cluster; n...    36   0.76 
UniRef50_Q9LD34 Cluster: Dinap1-interacting protein 5; n=2; Cryp...    36   0.76 
UniRef50_Q17MU1 Cluster: Cuticle protein, putative; n=4; Aedes a...    36   0.76 
UniRef50_UPI00006A19E4 Cluster: UPI00006A19E4 related cluster; n...    36   1.0  
UniRef50_UPI0000DA19E3 Cluster: PREDICTED: hypothetical protein;...    35   2.3  
UniRef50_Q3WDX4 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_Q0IV22 Cluster: Os11g0118400 protein; n=1; Oryza sativa...    35   2.3  
UniRef50_Q9VEP3 Cluster: CG4009-PA; n=2; Sophophora|Rep: CG4009-...    35   2.3  
UniRef50_A7SP15 Cluster: Predicted protein; n=1; Nematostella ve...    35   2.3  
UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;...    34   3.1  
UniRef50_Q3W6Y9 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_Q9P281 Cluster: BAH domain and coiled-coil-containing p...    34   3.1  
UniRef50_Q99494 Cluster: DAT1 protein; n=2; Homo sapiens|Rep: DA...    34   3.1  
UniRef50_UPI0000DB6C3D Cluster: PREDICTED: similar to RhoGAP88C ...    34   4.1  
UniRef50_A2A4R5 Cluster: Novel member of the keratin associated ...    34   4.1  
UniRef50_Q1DP51 Cluster: Predicted protein; n=1; Coccidioides im...    34   4.1  
UniRef50_UPI000021D9F7 Cluster: PREDICTED: similar to keratin as...    33   5.4  
UniRef50_UPI000069F08E Cluster: UPI000069F08E related cluster; n...    33   5.4  
UniRef50_Q4S1H0 Cluster: Chromosome 6 SCAF14768, whole genome sh...    33   5.4  
UniRef50_Q17MT9 Cluster: Putative uncharacterized protein; n=2; ...    33   5.4  
UniRef50_Q5T749 Cluster: Keratinocyte proline-rich protein; n=97...    33   5.4  
UniRef50_Q6PF50 Cluster: MGC68902 protein; n=2; Xenopus|Rep: MGC...    33   7.1  
UniRef50_Q1LYI5 Cluster: Novel collagen protein; n=2; Danio reri...    33   7.1  
UniRef50_Q2IMI7 Cluster: Putative uncharacterized protein precur...    33   7.1  
UniRef50_O68872 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_UPI00015B5366 Cluster: PREDICTED: similar to conserved ...    33   9.4  
UniRef50_UPI000155BC4F Cluster: PREDICTED: hypothetical protein,...    33   9.4  
UniRef50_UPI00005A08A9 Cluster: PREDICTED: similar to G protein-...    33   9.4  
UniRef50_UPI0000519DC7 Cluster: PREDICTED: similar to shifted CG...    33   9.4  
UniRef50_Q9BPR2 Cluster: Cuticle protein; n=3; Endopterygota|Rep...    33   9.4  
UniRef50_Q8IT70 Cluster: Nematocyst outer wall antigen precursor...    33   9.4  
UniRef50_Q4DEG8 Cluster: Mucin-associated surface protein (MASP)...    33   9.4  
UniRef50_A1IHG1 Cluster: Galectin; n=1; Ornithodoros moubata|Rep...    33   9.4  
UniRef50_Q14990 Cluster: Outer dense fiber protein 1; n=21; Mamm...    33   9.4  
UniRef50_P60410 Cluster: Keratin-associated protein 10-8; n=12; ...    33   9.4  

>UniRef50_Q9BPR7 Cluster: Cuticle protein; n=4; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 248

 Score =  126 bits (303), Expect = 7e-28
 Identities = 77/168 (45%), Positives = 86/168 (51%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHDQPQTIQ 353
           P +    P +    P      P +   APVAYHTSPLRYSSAESVSSQNIVRHDQPQTIQ
Sbjct: 55  PVAYHAAPVAYQAAPVAYHAAPVAYQAAPVAYHTSPLRYSSAESVSSQNIVRHDQPQTIQ 114

Query: 354 YXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYHSAPVAKIVAHQAEEIAYPSTSTTTQ 533
           Y                               SYHSAPVAKIVAHQAEEIAYP       
Sbjct: 115 YAAPVAKLAVAAPVAYHAAPAPVTYHAAPAAVSYHSAPVAKIVAHQAEEIAYPKYEYNYS 174

Query: 534 *LMVTPGDNKSQQEVRXR*CSKGFILFPRS*RALSELLKYTG*TNHSG 677
                 GDNKSQQEVR     KG   F  +  ++   ++YT   +HSG
Sbjct: 175 VADGHSGDNKSQQEVRDGDVVKGSYSFHEADGSI-RTVEYTA-DDHSG 220



 Score =  102 bits (244), Expect = 1e-20
 Identities = 50/50 (100%), Positives = 50/50 (100%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLHAAKL 162
           MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLHAAKL
Sbjct: 1   MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLHAAKL 50



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 17/23 (73%), Positives = 21/23 (91%)
 Frame = +3

Query: 276 SPLRYSSAESVSSQNIVRHDQPQ 344
           +P+ YS AE+VSSQ+IVRHDQPQ
Sbjct: 22  APVHYSPAEAVSSQSIVRHDQPQ 44



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 17/23 (73%), Positives = 21/23 (91%)
 Frame = +1

Query: 76  APVHYSPAEAVSSQSIVRHDQPQ 144
           +P+ YS AE+VSSQ+IVRHDQPQ
Sbjct: 89  SPLRYSSAESVSSQNIVRHDQPQ 111


>UniRef50_Q9BPR5 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 243

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/46 (65%), Positives = 35/46 (76%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 150
           MFSKIV++CA+VAVS AGLL    H+ P  AVSSQ+IVRHDQ   H
Sbjct: 1   MFSKIVLICAVVAVSHAGLL----HHGP--AVSSQNIVRHDQTIHH 40


>UniRef50_O77057 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 197

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 27/48 (56%), Positives = 35/48 (72%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLHAA 156
           MF+K+ VL A++A + AGLL  P H+  A AVSSQSIVRHD P  +A+
Sbjct: 1   MFTKVFVLSAVLAAANAGLL--PYHH--AAAVSSQSIVRHDAPAHYAS 44


>UniRef50_A6WAF5 Cluster: Putative uncharacterized protein; n=1;
           Kineococcus radiotolerans SRS30216|Rep: Putative
           uncharacterized protein - Kineococcus radiotolerans
           SRS30216
          Length = 122

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/36 (50%), Positives = 21/36 (58%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           PC +PR PC VP  P  +PR PC VP AP     +P
Sbjct: 5   PCPVPRAPCPVPRAPCPVPRAPCPVPRAPCPVLRAP 40



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           PC +PR PC VP  P  +PR PC V  AP +   +P
Sbjct: 12  PCPVPRAPCPVPRAPCPVPRAPCPVLRAPCSVLRAP 47



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 21/52 (40%), Positives = 25/52 (48%)
 Frame = +3

Query: 126 AP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           AP P     C      PC +PR PC VP  P  + R PCSV  AP +   +P
Sbjct: 4   APCPVPRAPCPVPRA-PCPVPRAPCPVPRAPCPVLRAPCSVLRAPCSVLRAP 54



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +3

Query: 183 LPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           +PR PC VP  P  +PR PC VP AP     +P
Sbjct: 1   MPRAPCPVPRAPCPVPRAPCPVPRAPCPVPRAP 33



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 114 PKHCAP*P-ASAPRCQARCCY---PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P+   P P A  P  +A C     PCS+ R PCSV   P  + R PCSV  AP +   +P
Sbjct: 23  PRAPCPVPRAPCPVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRAP 82



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/52 (38%), Positives = 24/52 (46%)
 Frame = +3

Query: 126 AP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           AP P     C      PC +PR PC V   P  + R PCSV  AP +   +P
Sbjct: 11  APCPVPRAPCPVPRA-PCPVPRAPCPVLRAPCSVLRAPCSVLRAPCSVLRAP 61



 Score = 37.1 bits (82), Expect = 0.44
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           PCS+ R PCSV   P  + R PCSV  AP +   +P
Sbjct: 54  PCSVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRAP 89



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 14/25 (56%), Positives = 16/25 (64%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSV 248
           PCS+ R PCSV   P  + R PCSV
Sbjct: 68  PCSVLRAPCSVLRAPCSVLRAPCSV 92


>UniRef50_Q9BPR4 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 291

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLHA 153
           MF KI V+C+++A+ + G+    +      AVSSQSIVRHD+P   A
Sbjct: 1   MFFKIAVVCSILAICQGGV----IDEGHGHAVSSQSIVRHDEPSHQA 43


>UniRef50_Q01645 Cluster: Male-specific sperm protein Mst84Dd; n=2;
           Drosophila melanogaster|Rep: Male-specific sperm protein
           Mst84Dd - Drosophila melanogaster (Fruit fly)
          Length = 72

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 18/36 (50%), Positives = 18/36 (50%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC 242
           P   P C   CC PC  P GPC  P  P C P GPC
Sbjct: 19  PCCGPCC-GPCCGPCCGPCGPCCGPCGPRCGPCGPC 53



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 4/50 (8%)
 Frame = +3

Query: 123 CAP*-PASAP--RCQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP  P   P   C   CC PC  P  GPC  P  P C P GP   P  P
Sbjct: 3   CAPGGPCCGPCGPCCGPCCGPCCGPCCGPCCGPCGPCCGPCGPRCGPCGP 52


>UniRef50_A7RFW7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 627

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +3

Query: 135 PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESV 308
           PA AP   A+   YP  +P  P  VPG P+  P  P  VPG P      P +  +  SV
Sbjct: 104 PAQAPGYPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSSV 162



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVP-GAPVAYHTSPL 284
           +P      PA  P   A+   YP   P  P  VPG P+ +P  P  VP G+ V Y +SP 
Sbjct: 110 YPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSSVQYVSSPQ 169

Query: 285 RY 290
           ++
Sbjct: 170 QF 171


>UniRef50_Q5TVQ9 Cluster: ENSANGP00000028691; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000028691 - Anopheles gambiae
           str. PEST
          Length = 251

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 28/60 (46%), Positives = 34/60 (56%), Gaps = 11/60 (18%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLL----------AAPV-HYSPAEAVSSQSIVRHDQPQLHAAK 159
           M  KIVVL A +A + AG +          AAPV HYS A AVS  SI RH+ P++  AK
Sbjct: 1   MAFKIVVLFATLACASAGYVEPEHHHLSYAAAPVAHYSSAPAVSYSSITRHETPKVAVAK 60


>UniRef50_P15265 Cluster: Sperm mitochondrial-associated
           cysteine-rich protein; n=2; Mus musculus|Rep: Sperm
           mitochondrial-associated cysteine-rich protein - Mus
           musculus (Mouse)
          Length = 143

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = +3

Query: 135 PASAPRCQARCC--YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           P+   +C   CC   PC  P+ PC  P +P C P+ PC  P +P
Sbjct: 4   PSKTNQCPPPCCPPKPCCPPK-PCC-PQKPPCCPKSPCCPPKSP 45



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCC--YPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           PK C P     P+ +  CC   PC  P+ PC  P    C P  PC  P
Sbjct: 17  PKPCCPPKPCCPQ-KPPCCPKSPCCPPKSPCCPPKPCPCPPPCPCPCP 63



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCC--YPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           P  C P P   P+    CC   P   P+ PC  P  P C P+ PC  P
Sbjct: 12  PPCCPPKPCCPPK---PCCPQKPPCCPKSPCCPPKSPCCPPK-PCPCP 55


>UniRef50_UPI0000EBE100 Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 394

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 22/56 (39%), Positives = 22/56 (39%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P   AP PA A R Q  C  P  LP  P S P R      G  S PG P      P
Sbjct: 154 PSGRAPAPAGARRAQVGCGMPFLLPAAPPSAPARGPVPKAGRASGPGLPPRQRPRP 209


>UniRef50_Q5SS00 Cluster: Novel protein; n=10; Eumetazoa|Rep: Novel
            protein - Mus musculus (Mouse)
          Length = 2493

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 24/45 (53%), Positives = 25/45 (55%)
 Frame = +3

Query: 126  AP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
            AP P  AP C  R   PC  PR PC  P R  CLPR PC +P AP
Sbjct: 2352 APCPPRAP-CLPRA--PCP-PRAPC--PPRAPCLPRAPC-LPQAP 2389



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 21/48 (43%), Positives = 23/48 (47%), Gaps = 2/48 (4%)
 Frame = +3

Query: 123  CAP*PASAPR--CQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
            C+P     PR  C  R   P   PR PC  P R  C PR PC +P AP
Sbjct: 2321 CSPRAPCPPRALCPPRAPCPPRAPRAPC--PPRAPCPPRAPC-LPRAP 2365



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 23/45 (51%), Positives = 23/45 (51%)
 Frame = +3

Query: 126  AP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
            AP P  APR       PC  PR PC  P R  CLPR PC  P AP
Sbjct: 2337 APCPPRAPRA------PCP-PRAPC--PPRAPCLPRAPCP-PRAP 2371



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 22/50 (44%), Positives = 23/50 (46%), Gaps = 2/50 (4%)
 Frame = +3

Query: 123  CAP*PASAPRCQARCCYPCSL--PRGPCSVPGRPSCLPRGPCSVPGAPVA 266
            C P     PR     C P +L  PR PC  P R  C PR PC  P AP A
Sbjct: 2300 CTPRAPCPPRALRAPCPPRALCSPRAPC--PPRALCPPRAPCP-PRAPRA 2346


>UniRef50_UPI0000F2E2FE Cluster: PREDICTED: hypothetical protein;
           n=2; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 283

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 29/77 (37%), Positives = 35/77 (45%)
 Frame = +3

Query: 36  VCFGRGVESWTSGCSRALLSR*SRFFPKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGR 215
           V  G      T+G  +A  SR S     H       AP CQA    P  LP    ++PG+
Sbjct: 21  VLHGGNKHGGTAGTPQAGHSRGSPSSGGHPVKGLLMAPSCQAPPHPPALLPGA--ALPGQ 78

Query: 216 PSCLPRGPCSVPGAPVA 266
           PS LPR PC+  GA  A
Sbjct: 79  PSPLPRRPCAQLGASPA 95


>UniRef50_A7SX06 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 184

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 18/42 (42%), Positives = 18/42 (42%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRY 290
           C  PC  P  PC   G P   P  PC  P  PV Y   PL Y
Sbjct: 62  CVSPCVAPSTPCVARGTPCVAPGTPCVSPSTPV-YPLVPLVY 102



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 14/36 (38%), Positives = 15/36 (41%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           PC  P  PC  P  P   P  PC  PG P     +P
Sbjct: 131 PCVAPSTPCVAPSTPCVAPSTPCVAPGTPCVAPGTP 166



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 14/39 (35%), Positives = 15/39 (38%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           C  PC  P  PC  P  P   P  PC  P  P     +P
Sbjct: 121 CVSPCVAPGTPCVAPSTPCVAPSTPCVAPSTPCVAPGTP 159



 Score = 32.7 bits (71), Expect = 9.4
 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 4/36 (11%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRP---SCL-PRGPCSVPGAP 260
           C   C  P  PC  PG P   +C+ P  PC  PG P
Sbjct: 9   CVSACVAPSTPCVAPGTPCVSACVAPSTPCVAPGTP 44


>UniRef50_A7RKE3 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 129

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 3   YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 53



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 10  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 60



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 17  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 67



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 24  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 74



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 31  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 81



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 38  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 88



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 45  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 95



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 52  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 102



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP  P
Sbjct: 59  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYP 109



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +3

Query: 111 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           +P H    P+  PR  +    YP  +PR P  VP  PS +PR P  VP
Sbjct: 66  YPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVPRYPSHVP 113


>UniRef50_Q64298 Cluster: Sperm mitochondrial-associated
           cysteine-rich protein; n=3; Muroidea|Rep: Sperm
           mitochondrial-associated cysteine-rich protein - Rattus
           norvegicus (Rat)
          Length = 145

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCC--YPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           C P P   P+    CC   PC L + PC  P  P C P+ PC  P
Sbjct: 10  CCPTPCCPPK---PCCPPKPCCLQKSPCC-PKSPCCPPKSPCCTP 50


>UniRef50_UPI0000F31DEE Cluster: UPI0000F31DEE related cluster; n=1;
           Bos taurus|Rep: UPI0000F31DEE UniRef100 entry - Bos
           Taurus
          Length = 462

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 4/40 (10%)
 Frame = +3

Query: 159 ARCCYPCS----LPRGPCSVPGRPSCLPRGPCSVPGAPVA 266
           A CC PCS    LP  P S P  P   PR PCS P  P A
Sbjct: 207 AACCRPCSGGDALPGQPPSPPAAPPQAPRVPCSPPVPPPA 246


>UniRef50_UPI0000F2EB19 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 349

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 20/44 (45%), Positives = 23/44 (52%)
 Frame = +3

Query: 129 P*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           P PA+APR   R   P + PR P      P  LPR P + PGAP
Sbjct: 226 PRPAAAPRAPPR---PAAAPRAPPRPAAAPRALPR-PAAAPGAP 265


>UniRef50_UPI000023E51A Cluster: hypothetical protein FG08013.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG08013.1 - Gibberella zeae PH-1
          Length = 1117

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 2/74 (2%)
 Frame = +3

Query: 135 PASAPRCQ-ARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSS-AESV 308
           P S P    +R   P S+P  P S+P +P+ +P  P S+P  P +  T P   S+   S+
Sbjct: 480 PTSIPTLPTSRPTQPTSMPTLPTSMPTQPTSMPTLPTSMPTQPTSRPTQPTSMSTLPTSM 539

Query: 309 SSQNIVRHDQPQTI 350
            +Q      QP ++
Sbjct: 540 PTQPTSMPTQPTSM 553



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSS-AESVSSQNIVRHDQPQTI 350
           P S+P  P S+P  P+  P  P S+P  P +  T P    +   S+ +Q   R  QP ++
Sbjct: 473 PTSMPTQPTSIPTLPTSRPTQPTSMPTLPTSMPTQPTSMPTLPTSMPTQPTSRPTQPTSM 532



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +3

Query: 135 PASAPRCQ-ARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P S P    +R   P S+P  P S+P  P+  P  P S+P  P +  T P
Sbjct: 389 PTSMPTLPTSRPTQPTSMPTQPTSMPTLPTSRPTQPTSMPTLPTSMPTQP 438



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +3

Query: 135 PASAPRCQ-ARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSS 296
           P S P    +R   P S+P  P S+P +P+ +P  P S P  P +  T P   S+
Sbjct: 410 PTSMPTLPTSRPTQPTSMPTLPTSMPTQPTSIPTLPTSRPTQPTSMPTLPTSMST 464



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P S+P  P S+P  P+  P  P S+P  P +  T P
Sbjct: 431 PTSMPTQPTSIPTLPTSRPTQPTSMPTLPTSMSTQP 466


>UniRef50_UPI00004D8D50 Cluster: UPI00004D8D50 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00004D8D50 UniRef100 entry -
           Xenopus tropicalis
          Length = 339

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +3

Query: 126 AP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPG 254
           +P P   P        P   P+GP +VP  P+  PRGP  VPG
Sbjct: 7   SPGPTPGPSASTGPSGPTCGPQGPSTVPRGPTIGPRGPSQVPG 49


>UniRef50_Q9LD34 Cluster: Dinap1-interacting protein 5; n=2;
           Crypthecodinium cohnii|Rep: Dinap1-interacting protein 5
           - Crypthecodinium cohnii (Dinoflagellate)
          Length = 642

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 16/36 (44%), Positives = 19/36 (52%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P  LP  P  +PG P  LP+G  S+P AP A    P
Sbjct: 74  PAGLPGAPTGLPGAPKALPKGAGSLPTAPGAPKALP 109


>UniRef50_Q17MU1 Cluster: Cuticle protein, putative; n=4; Aedes
           aegypti|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 260

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 4/47 (8%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAP----VHYSPAEAVSSQSIVRHDQP 141
           M  K+VVL A +A + AG L A      HYSPA AVS  SI R   P
Sbjct: 1   MAFKMVVLFATLACASAGYLEADHHHAAHYSPAPAVSYSSITREHYP 47


>UniRef50_UPI00006A19E4 Cluster: UPI00006A19E4 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A19E4 UniRef100 entry -
           Xenopus tropicalis
          Length = 335

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +3

Query: 141 SAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           +AP+ +  C    S PRGPC  PG P   PR P + P  P
Sbjct: 183 TAPK-EKTCSSQGSFPRGPCPTPGAPMPKPRVPHAQPQGP 221



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +3

Query: 174 PCSLPRGP-CSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHDQPQ 344
           P   P GP C +PG P   PR P   PGAP+     P     + + + Q  V + QPQ
Sbjct: 263 PLPNPMGPLCPIPGAPMPNPRVPLPTPGAPMPNPRGPCPTPVSPAPTPQ--VPYAQPQ 318


>UniRef50_UPI0000DA19E3 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 285

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = +3

Query: 138 ASAPRCQARCCYPCSLPRGPC--SVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           A+ PR  A    PCS PR P   S P  PS  PR    +P +PV    SP
Sbjct: 72  AARPRAPALLLRPCSYPRAPALPSHPQHPSPCPRA-TGIPISPVLARPSP 120


>UniRef50_Q3WDX4 Cluster: Putative uncharacterized protein; n=1;
           Frankia sp. EAN1pec|Rep: Putative uncharacterized
           protein - Frankia sp. EAN1pec
          Length = 98

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 7/62 (11%)
 Frame = +3

Query: 171 YPCSLPRGPCSVPGRPSCLPRG-------PCSVPGAPVAYHTSPLRYSSAESVSSQNIVR 329
           +PC LPRG  + P  PS   R          +V GAP   H+  L +S+  SV   N+V 
Sbjct: 8   WPCRLPRGGAAAPTEPSAADRSSAGVHQQEAAVTGAPARTHSGHLLWSA--SVEDPNVVV 65

Query: 330 HD 335
            D
Sbjct: 66  KD 67


>UniRef50_Q0IV22 Cluster: Os11g0118400 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os11g0118400 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 141

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/44 (36%), Positives = 17/44 (38%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVA 266
           P  APR       P S P  P   P       R P S PG+P A
Sbjct: 56  PGRAPRRHGHPASPASSPPAPAPAPSAAPASARSPASAPGSPAA 99


>UniRef50_Q9VEP3 Cluster: CG4009-PA; n=2; Sophophora|Rep: CG4009-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 623

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVP-GAPVAYHTSPLRYSSAESVSSQNIV--RHDQPQ 344
           P+  C+ P  P CLP    ++P G P+AYHT       A SVS  + +  + ++PQ
Sbjct: 174 PQDCCAEPRHPRCLP---INLPRGGPIAYHTGKTCLHFARSVSDADAICPKVEEPQ 226


>UniRef50_A7SP15 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 139

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = +3

Query: 75  CSRALLSR*SRFFPKHCAP*PAS-APRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           CS A  S     FP   AP P S AP   +   +PCSL   PC +   P  L   PC + 
Sbjct: 67  CSIAPFSCSLAPFPCSLAPFPCSLAPFPCSHASFPCSLAPFPCLLAPFPCLLAPFPCLLA 126

Query: 252 GAPVAYHTSP 281
             P ++ + P
Sbjct: 127 PCPCSHASFP 136


>UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 145

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = +2

Query: 509 PKYEYNYSVADGHSG 553
           PKYE+NY VADGH+G
Sbjct: 67  PKYEFNYGVADGHTG 81


>UniRef50_Q3W6Y9 Cluster: Putative uncharacterized protein; n=1;
           Frankia sp. EAN1pec|Rep: Putative uncharacterized
           protein - Frankia sp. EAN1pec
          Length = 256

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 37/107 (34%), Positives = 45/107 (42%), Gaps = 7/107 (6%)
 Frame = +3

Query: 27  RSTVCFGRGVES-WTSGCSRALLSR*SRFFPKHCAP*PASAPRCQARCCYPCS--LPRGP 197
           R+TV  G G+ S W SG S    +R +R   +   P     P   ARC  P S   PR P
Sbjct: 42  RATVDRGAGLSSSWPSG-SNVGTAR-ARMTGRIRPPTRRDRPTAAARCPSPESARFPRRP 99

Query: 198 C--SVPGR--PSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIV 326
                PGR  P  LP GPC  P  P A   +   Y +   V  +  V
Sbjct: 100 VRGGAPGRTSPGRLPSGPCR-PPRPAADPRNQYEYGADRLVGPEEDV 145


>UniRef50_Q9P281 Cluster: BAH domain and coiled-coil-containing
           protein 1; n=28; root|Rep: BAH domain and
           coiled-coil-containing protein 1 - Homo sapiens (Human)
          Length = 1721

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = +3

Query: 126 AP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAES 305
           AP PA+ P     CC+P   P+ P S P  P   P  PC++   P +      R  SAE 
Sbjct: 236 APSPAAGPTKLPPCCHPPD-PKPPASSP-TPPPRPSAPCTLNVCPASSPGPGSRVRSAEE 293

Query: 306 VSSQ 317
            + +
Sbjct: 294 KNGE 297


>UniRef50_Q99494 Cluster: DAT1 protein; n=2; Homo sapiens|Rep: DAT1
           protein - Homo sapiens (Human)
          Length = 106

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%)
 Frame = +3

Query: 177 CSLPRGPCSVPGRPSC-LPRGPCSVPGAPVAYHTSPLR 287
           C  P G C +PG  +C  P G C+ PG     H   L+
Sbjct: 56  CRAPTGACPIPGPDACRAPTGACTTPGRMQGPHAGSLQ 93


>UniRef50_UPI0000DB6C3D Cluster: PREDICTED: similar to RhoGAP88C
           CG31319-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to RhoGAP88C CG31319-PA - Apis mellifera
          Length = 954

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +3

Query: 183 LPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVS 311
           LP  P  VPG P  LP  P  +P +P+A   SP    S+   S
Sbjct: 191 LPGSPLHVPGSPVTLPASPYHLPPSPLANAPSPFGDDSSSYCS 233


>UniRef50_A2A4R5 Cluster: Novel member of the keratin associated
           protein 4 (Krtap4) family; n=10; Theria|Rep: Novel
           member of the keratin associated protein 4 (Krtap4)
           family - Mus musculus (Mouse)
          Length = 167

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 23/64 (35%), Positives = 26/64 (40%), Gaps = 3/64 (4%)
 Frame = +3

Query: 69  SGCSRALLSR*SRFFPKHCAP*PASAPRCQARCCYPCSLP-RGPCSVP-GRPSCLP-RGP 239
           S C +    R S      C P   S+  C + CC PC  P   PC  P  RP C P   P
Sbjct: 66  SVCCQPTCCRPSCCISSCCQPSCGSSSCCGSSCCRPCCRPCCSPCCSPCCRPCCRPCCRP 125

Query: 240 CSVP 251
           C  P
Sbjct: 126 CCRP 129


>UniRef50_Q1DP51 Cluster: Predicted protein; n=1; Coccidioides
           immitis|Rep: Predicted protein - Coccidioides immitis
          Length = 105

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 21/59 (35%), Positives = 26/59 (44%)
 Frame = +3

Query: 105 RFFPKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           R FP      P S P+      +P + P  P S PG P+  P  P S PG P    T+P
Sbjct: 31  RQFPTSIPGFPTSFPQ------FPTTFPGFPTSFPGFPTTFPGFPSSFPGLPNPNPTNP 83


>UniRef50_UPI000021D9F7 Cluster: PREDICTED: similar to keratin
           associated protein 10-7; n=7; Rattus norvegicus|Rep:
           PREDICTED: similar to keratin associated protein 10-7 -
           Rattus norvegicus
          Length = 230

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 8/69 (11%)
 Frame = +3

Query: 114 PKHCAP*PASAPRC-QARCCYPCSLPRGPCSVPG-------RPSCLPRGPCSVPGAPVAY 269
           P+ C    + AP C Q  CC PC  P   C VP         PSC    PC +   PV+ 
Sbjct: 24  PESCCEPCSCAPSCCQPSCCAPCCAP--SCCVPSCCQSSCCAPSCSAPTPCLL-CTPVSC 80

Query: 270 HTSPLRYSS 296
            +SP   SS
Sbjct: 81  VSSPCCQSS 89


>UniRef50_UPI000069F08E Cluster: UPI000069F08E related cluster; n=3;
           Xenopus tropicalis|Rep: UPI000069F08E UniRef100 entry -
           Xenopus tropicalis
          Length = 326

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGA-PVAYHTSPLR 287
           PK+ +  P ++    A   +P + PR P   PG PS  PR P   P A P A    P R
Sbjct: 127 PKYPSASPRASKHPPAPPQHPPASPRAPPLPPGHPSASPRAPPKYPSASPRASKHPPAR 185


>UniRef50_Q4S1H0 Cluster: Chromosome 6 SCAF14768, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 6 SCAF14768, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 997

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +3

Query: 216 PSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHDQPQ 344
           P CLP GP +V   PV   TS  R S+A  V++QN  R+ Q +
Sbjct: 28  PHCLPPGPAAV-SVPVR-QTSTSRLSTAPQVANQNTPRNKQAE 68


>UniRef50_Q17MT9 Cluster: Putative uncharacterized protein; n=2;
           Neoptera|Rep: Putative uncharacterized protein - Aedes
           aegypti (Yellowfever mosquito)
          Length = 210

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 8/56 (14%)
 Frame = +1

Query: 13  MFSKIVVLCALVAVSKAGLLAAPV--------HYSPAEAVSSQSIVRHDQPQLHAA 156
           M  K VV  A +AV+ AG L AP         HYSPA +VS  S+  H  P  +AA
Sbjct: 1   MAFKFVVFLASLAVASAGYLEAPAVSYAAPVAHYSPASSVSYSSL-SHATPLAYAA 55


>UniRef50_Q5T749 Cluster: Keratinocyte proline-rich protein; n=97;
           Theria|Rep: Keratinocyte proline-rich protein - Homo
           sapiens (Human)
          Length = 579

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 28/80 (35%), Positives = 32/80 (40%), Gaps = 6/80 (7%)
 Frame = +3

Query: 75  CSRALLS-R*SRFFPKHCAP*PASAP----RCQARCCYPCSLPRGP-CSVPGRPSCLPRG 236
           CS + L  R S  FP +C P   S P    RC  R    CS  RGP C +     C PR 
Sbjct: 278 CSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPR- 336

Query: 237 PCSVPGAPVAYHTSPLRYSS 296
              VP         P+R  S
Sbjct: 337 --QVPPQRCPVEIPPIRRRS 354


>UniRef50_Q6PF50 Cluster: MGC68902 protein; n=2; Xenopus|Rep:
           MGC68902 protein - Xenopus laevis (African clawed frog)
          Length = 775

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           P  LP+GP  +P  P+ LP+GP  +P  P
Sbjct: 678 PTYLPQGPTHLPQGPTHLPQGPTHLPQGP 706


>UniRef50_Q1LYI5 Cluster: Novel collagen protein; n=2; Danio
           rerio|Rep: Novel collagen protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 873

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 15/35 (42%), Positives = 16/35 (45%)
 Frame = +3

Query: 156 QARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           + R C  C   RGP   PG P   P GP   PG P
Sbjct: 731 EQRSCQHCETKRGPAGDPGPPG--PTGPSGPPGYP 763


>UniRef50_Q2IMI7 Cluster: Putative uncharacterized protein
           precursor; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep:
           Putative uncharacterized protein precursor -
           Anaeromyxobacter dehalogenans (strain 2CP-C)
          Length = 365

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 14/36 (38%), Positives = 15/36 (41%)
 Frame = +3

Query: 195 PCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAE 302
           P   PG P C P  PC +P  P A    P     AE
Sbjct: 36  PAGAPGEPPCEPVKPCEIPDEPAAGPAEPPAELGAE 71


>UniRef50_O68872 Cluster: Putative uncharacterized protein; n=1;
           Myxococcus xanthus|Rep: Putative uncharacterized protein
           - Myxococcus xanthus
          Length = 542

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 27/80 (33%), Positives = 32/80 (40%), Gaps = 6/80 (7%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLPRGPCSVPGRPS----CLPRGPC-SVPG-APVAYHTSPL 284
           C P PA  PRC+AR   P       C   G  S    C P G C S PG  P     SP 
Sbjct: 119 CTPCPAP-PRCRARPSAPAPSAGRTCPTAGPSSCASGCCPTGRCGSAPGPTPHGAEPSPP 177

Query: 285 RYSSAESVSSQNIVRHDQPQ 344
             S + + +S    R   P+
Sbjct: 178 SQSPSPAPASSGGRRRTHPR 197


>UniRef50_UPI00015B5366 Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 342

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLP--RGP 239
           P  C       P C+   CYP  +  G C+ PG  SC P  +GP
Sbjct: 188 PGPCPDGYMGPPHCKKALCYPNCMNGGNCTAPGVCSCPPGFQGP 231


>UniRef50_UPI000155BC4F Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein, partial - Ornithorhynchus anatinus
          Length = 309

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPG--RPSCLP 230
           P+ C P     P C + CC PC  PR PC VP   +P C P
Sbjct: 123 PRPCCP----QPCCVSTCCRPC-CPR-PCCVPSCCQPCCRP 157


>UniRef50_UPI00005A08A9 Cluster: PREDICTED: similar to G
           protein-regulated inducer of neurite outgrowth 1; n=2;
           Canis lupus familiaris|Rep: PREDICTED: similar to G
           protein-regulated inducer of neurite outgrowth 1 - Canis
           familiaris
          Length = 422

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 29/100 (29%), Positives = 36/100 (36%), Gaps = 2/100 (2%)
 Frame = +3

Query: 21  QNRSTVCFGRGVESWTSGCSRALLSR*SRFFPKHCAP*PASAPRCQARCCYPCSLPRGPC 200
           Q  +T C      +   GC  AL +     FPK  A    S  + Q      C  PRGP 
Sbjct: 193 QPAATSCHALSPAAGAGGCCPALPAPGVPAFPKLVASVSESGLQAQRGGMCQCRFPRGP- 251

Query: 201 SVPGRPSCL--PRGPCSVPGAPVAYHTSPLRYSSAESVSS 314
             PG   C   P GP +    P A        +SA  + S
Sbjct: 252 --PGLSRCCAHPWGPAACAMGPAARTKDVWTMTSASDLGS 289


>UniRef50_UPI0000519DC7 Cluster: PREDICTED: similar to shifted
           CG3135-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to shifted CG3135-PA - Apis mellifera
          Length = 327

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLP--RGP 239
           P  C       P C+   CYP  +  G C+ PG  SC P  +GP
Sbjct: 173 PGPCPDGYLGPPHCKKALCYPNCMNGGNCTAPGVCSCPPGFQGP 216


>UniRef50_Q9BPR2 Cluster: Cuticle protein; n=3; Endopterygota|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 238

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 13/15 (86%), Positives = 13/15 (86%)
 Frame = +1

Query: 586 GDVVKGSYSFHEADG 630
           GDVVKG YS HEADG
Sbjct: 186 GDVVKGEYSLHEADG 200


>UniRef50_Q8IT70 Cluster: Nematocyst outer wall antigen precursor;
           n=1; Hydra vulgaris|Rep: Nematocyst outer wall antigen
           precursor - Hydra attenuata (Hydra) (Hydra vulgaris)
          Length = 774

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           P  AP+C   CC   S+   P  +P  PSC     CS   AP
Sbjct: 589 PTCAPQCSQLCCQQSSM---PLQMPQMPSCPQFPSCSASCAP 627


>UniRef50_Q4DEG8 Cluster: Mucin-associated surface protein (MASP),
           putative; n=13; Trypanosoma cruzi|Rep: Mucin-associated
           surface protein (MASP), putative - Trypanosoma cruzi
          Length = 603

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%)
 Frame = +3

Query: 192 GPCSVPGRPSCLP-RGPCSVPGAPVAYH 272
           GP ++PG P  +P  GP ++PGAPV+ H
Sbjct: 249 GPAAIPGAP--VPGNGPAAIPGAPVSGH 274



 Score = 32.7 bits (71), Expect = 9.4
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%)
 Frame = +3

Query: 192 GPCSVPGRPSCLP-RGPCSVPGAPVAYH 272
           GP ++PG P  +P  GP ++PGAPV+ H
Sbjct: 314 GPAAIPGAP--VPGHGPAAIPGAPVSGH 339


>UniRef50_A1IHG1 Cluster: Galectin; n=1; Ornithodoros moubata|Rep:
           Galectin - Ornithodoros moubata (Soft tick)
          Length = 333

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 5/54 (9%)
 Frame = +3

Query: 153 CQ-ARCCYPCSL---PRGPCSVPGRPSC-LPRGPCSVPGAPVAYHTSPLRYSSA 299
           CQ A+ CYP  L      P + P R +  L  GP +VPG+PVA+H +P  Y  +
Sbjct: 201 CQLAQGCYPGLLIYISGRPYAEPDRFNIDLTCGPHAVPGSPVAFHWNPRFYEKS 254


>UniRef50_Q14990 Cluster: Outer dense fiber protein 1; n=21;
           Mammalia|Rep: Outer dense fiber protein 1 - Homo sapiens
           (Human)
          Length = 250

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRP--SCLPRGPCS 245
           CYPC+ P  PCS P  P   C P  PCS
Sbjct: 202 CYPCTSPCSPCS-PCSPCNPCSPCNPCS 228


>UniRef50_P60410 Cluster: Keratin-associated protein 10-8; n=12;
           Eutheria|Rep: Keratin-associated protein 10-8 - Homo
           sapiens (Human)
          Length = 259

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 1/65 (1%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC-SVPGAPVAYHTSPLRY 290
           P  C         CQ  CC P S     C+    PSC    PC ++  APV+   SP + 
Sbjct: 33  PSTCTGSSWQVDNCQESCCEPRSCASSCCT----PSCCAPAPCLALVCAPVSCEPSPCQS 88

Query: 291 SSAES 305
              +S
Sbjct: 89  GCTDS 93


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 612,168,167
Number of Sequences: 1657284
Number of extensions: 10435688
Number of successful extensions: 34310
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 31540
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34005
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).