SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9VNE9 Cluster: 60S ribosomal protein L13A; n=127; Euka...   173   4e-42
UniRef50_Q1HR63 Cluster: 60S ribosomal protein L13a; n=2; Aedes ...   172   5e-42
UniRef50_P93099 Cluster: 60S ribosomal protein L13a; n=4; Eukary...   143   4e-33
UniRef50_Q6RH10 Cluster: 60S ribosomal protein L13a; n=5; Magnol...   136   6e-31
UniRef50_Q245E7 Cluster: Ribosomal protein L13 containing protei...   119   5e-26
UniRef50_Q4Q3B9 Cluster: 60S ribosomal protein L13a, putative; n...   109   8e-23
UniRef50_UPI0000EB39CE Cluster: UPI0000EB39CE related cluster; n...   103   5e-21
UniRef50_A4S5V9 Cluster: Ribosomal protein L13a, component of cy...   103   5e-21
UniRef50_A2DZ26 Cluster: Ribosomal protein L13, putative; n=7; T...   100   6e-20
UniRef50_Q7R0D6 Cluster: GLP_608_8346_8939; n=1; Giardia lamblia...    96   6e-19
UniRef50_Q98RZ9 Cluster: 60s ribosomal protein L13A; n=1; Guilla...    93   5e-18
UniRef50_O18718 Cluster: Ribosomal protein L13A; n=4; Entamoeba|...    82   1e-14
UniRef50_Q8SS16 Cluster: 60S RIBOSOMAL PROTEIN L13A; n=1; Enceph...    76   9e-13
UniRef50_Q9AVH9 Cluster: Putative senescence-associated protein;...    70   6e-11
UniRef50_A7DRR6 Cluster: Ribosomal protein L13; n=1; Candidatus ...    65   2e-09
UniRef50_A0RXP5 Cluster: Ribosomal protein L13; n=1; Cenarchaeum...    64   2e-09
UniRef50_A1RWV8 Cluster: Ribosomal protein L13; n=1; Thermofilum...    61   2e-08
UniRef50_Q3LWM1 Cluster: Ribosomal protein L13A; n=1; Bigelowiel...    61   3e-08
UniRef50_Q75J15 Cluster: Putative ribosomal protein L13a; n=1; O...    60   4e-08
UniRef50_O59300 Cluster: 50S ribosomal protein L13P; n=45; root|...    55   1e-06
UniRef50_O29137 Cluster: 50S ribosomal protein L13P; n=1; Archae...    52   9e-06
UniRef50_Q8TVB6 Cluster: 50S ribosomal protein L13P; n=1; Methan...    52   1e-05
UniRef50_Q4GXI8 Cluster: Ribomsomal protein L13Ae; n=2; Neoptera...    50   5e-05
UniRef50_Q9YB50 Cluster: 50S ribosomal protein L13P; n=1; Aeropy...    48   2e-04
UniRef50_Q8ZYQ1 Cluster: 50S ribosomal protein L13P; n=5; Thermo...    47   5e-04
UniRef50_Q8PW45 Cluster: 50S ribosomal protein L13P; n=11; Eurya...    45   0.002
UniRef50_P95991 Cluster: 50S ribosomal protein L13P; n=3; Sulfol...    44   0.003
UniRef50_Q6L294 Cluster: 50S ribosomal protein L13P; n=4; Thermo...    43   0.006
UniRef50_Q2Q0G5 Cluster: Ribosomal protein L13P; n=1; uncultured...    42   0.010
UniRef50_A7D2Q7 Cluster: Ribosomal protein L13; n=1; Halorubrum ...    42   0.010
UniRef50_Q6LXM6 Cluster: 50S ribosomal protein L13P; n=6; Methan...    41   0.023
UniRef50_P29198 Cluster: 50S ribosomal protein L13P; n=4; Haloba...    41   0.030
UniRef50_P39473 Cluster: 50S ribosomal protein L13P; n=4; Thermo...    38   0.16 
UniRef50_Q9M3S6 Cluster: 60S L13 ribosomal protein; n=1; Arabido...    37   0.37 
UniRef50_Q4QG46 Cluster: Putative uncharacterized protein; n=2; ...    37   0.49 
UniRef50_Q53K43 Cluster: Retrotransposon protein, putative, uncl...    36   0.65 
UniRef50_Q85FU2 Cluster: 50S ribosomal protein L13; n=1; Cyanidi...    35   1.5  
UniRef50_A5Z5I7 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_Q7NZC0 Cluster: Probable cobalamin biosynthesis transme...    33   4.6  
UniRef50_Q6N2I6 Cluster: Putative uncharacterized protein; n=1; ...    33   4.6  
UniRef50_Q7XVT3 Cluster: OSJNBa0041M21.3 protein; n=3; Oryza sat...    33   6.1  
UniRef50_Q22933 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_P53008 Cluster: Mannosyl-oligosaccharide glucosidase; n...    33   6.1  
UniRef50_Q74ND7 Cluster: 50S ribosomal protein L13P; n=1; Nanoar...    33   8.0  

>UniRef50_Q9VNE9 Cluster: 60S ribosomal protein L13A; n=127;
           Eukaryota|Rep: 60S ribosomal protein L13A - Drosophila
           melanogaster (Fruit fly)
          Length = 205

 Score =  173 bits (420), Expect = 4e-42
 Identities = 82/163 (50%), Positives = 104/163 (63%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G +N+ +VIDGRGHLLGRLA+V+AK LL+G KV VVRCE++N+SG+F+RNK+K +++LRK
Sbjct: 3   GLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRK 62

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           RCNVNPARGPFHFRAPS+I +K V      K    +  L       G   P         
Sbjct: 63  RCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVV 122

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGK 491
                          C VGRLSHE+GW Y+DV++ LE KRK K
Sbjct: 123 PIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAK 165


>UniRef50_Q1HR63 Cluster: 60S ribosomal protein L13a; n=2; Aedes
           aegypti|Rep: 60S ribosomal protein L13a - Aedes aegypti
           (Yellowfever mosquito)
          Length = 236

 Score =  172 bits (419), Expect = 5e-42
 Identities = 86/164 (52%), Positives = 102/164 (62%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G S K I+IDGRGHLLGRLA+VIAK +L G KVVVVRCE + +SG+FFRNK+K +++LRK
Sbjct: 3   GLSEKPILIDGRGHLLGRLASVIAKQILNGRKVVVVRCEDLQLSGHFFRNKIKFLAYLRK 62

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           RCNVNPARGPFHFRAPS++LWK V      K       L       G   P         
Sbjct: 63  RCNVNPARGPFHFRAPSRMLWKAVRGMVPHKTKRGHNALKRLKVYEGIPSPFDRQKRLCV 122

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                          C VGR++HE+GWKYRDVV  LE KRK K+
Sbjct: 123 PTAMRQLCLRPDRKFCDVGRVAHEVGWKYRDVVNNLEAKRKIKS 166



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 25/50 (50%), Positives = 31/50 (62%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG NAL+RL+ Y+G P PFD              CL+P RK
Sbjct: 87  RGMVPHKTKRGHNALKRLKVYEGIPSPFDRQKRLCVPTAMRQLCLRPDRK 136


>UniRef50_P93099 Cluster: 60S ribosomal protein L13a; n=4;
           Eukaryota|Rep: 60S ribosomal protein L13a - Cyanophora
           paradoxa
          Length = 200

 Score =  143 bits (346), Expect = 4e-33
 Identities = 74/169 (43%), Positives = 97/169 (57%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           K +V+D RGHLLGRLAA +AK LL G +VV VR E+INISG+ FRNKLK  +FL+KR N 
Sbjct: 4   KVVVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNT 63

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP RGPFHFR+P++ILW+T+      K       L       G   P             
Sbjct: 64  NPRRGPFHFRSPARILWRTIRGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQAL 123

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVP*KET 521
                      C +GRL+ E+GW++ D+V +LE+KRK K+      K+T
Sbjct: 124 RVLRLKPGRKFCVLGRLATEVGWRHSDLVTRLEEKRKTKSAAFYARKKT 172



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/50 (50%), Positives = 29/50 (58%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGMIPHKT RG  AL RL+ ++G PPP+D               LKPGRK
Sbjct: 84  RGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQALRVLRLKPGRK 133


>UniRef50_Q6RH10 Cluster: 60S ribosomal protein L13a; n=5;
           Magnoliophyta|Rep: 60S ribosomal protein L13a - Capsicum
           annuum (Bell pepper)
          Length = 220

 Score =  136 bits (328), Expect = 6e-31
 Identities = 68/164 (41%), Positives = 91/164 (55%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G S + IV+D R H+LGRL++++AK LL G +VVVVRCE+I +SG   R K+K + FLRK
Sbjct: 6   GISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRK 65

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           R N  P+ GP HFRAPSKILW+T+      K       L       G   P         
Sbjct: 66  RMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVI 125

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                          C +G+LS E+GW + D +++LEDKRK +A
Sbjct: 126 PDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELEDKRKERA 169



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 20/29 (68%), Positives = 24/29 (82%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFD 340
           RGMIPHKT+RG  AL RL+ Y+G PPP+D
Sbjct: 90  RGMIPHKTKRGAAALARLKVYEGVPPPYD 118


>UniRef50_Q245E7 Cluster: Ribosomal protein L13 containing protein;
           n=16; Alveolata|Rep: Ribosomal protein L13 containing
           protein - Tetrahymena thermophila SB210
          Length = 270

 Score =  119 bits (287), Expect = 5e-26
 Identities = 64/161 (39%), Positives = 84/161 (52%)
 Frame = +3

Query: 12  NKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCN 191
           +K +VID +GHLLGRLA+ +AK LL G ++VVVR E INISG+ FRN++K   FL K  N
Sbjct: 75  DKLVVIDAKGHLLGRLASYVAKELLSGQRIVVVRTEAINISGSLFRNRVKFSEFLNKWMN 134

Query: 192 VNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXX 371
            NP RG  HFRAPS+I W+ V      K       L       G   P            
Sbjct: 135 HNPRRGVQHFRAPSRIFWRAVRGMLPHKTPKGAAALERLKIFEGIPTPYDRVKKQVVVDA 194

Query: 372 XXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       C +G LS  +GW  + ++ KLE+KR+ +A
Sbjct: 195 LKVQRLRNSRPVCKLGDLSASVGWGKQTLIEKLEEKRRARA 235



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFD 340
           RGM+PHKT +G  AL RL+ ++G P P+D
Sbjct: 156 RGMLPHKTPKGAAALERLKIFEGIPTPYD 184


>UniRef50_Q4Q3B9 Cluster: 60S ribosomal protein L13a, putative;
           n=10; Trypanosomatidae|Rep: 60S ribosomal protein L13a,
           putative - Leishmania major
          Length = 222

 Score =  109 bits (261), Expect = 8e-23
 Identities = 63/159 (39%), Positives = 81/159 (50%), Gaps = 1/159 (0%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           IVID + H+LGR AAV+AK LL G K+ VVRCEQ+NI+G   RNK+K + +LRKR   NP
Sbjct: 25  IVIDLKDHVLGRAAAVVAKQLLLGKKITVVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNP 84

Query: 201 ARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLI-TXXXXXXXXXXX 377
            +GPFH RAPS +  +TV +            L   V   G    ++ T           
Sbjct: 85  TKGPFHHRAPSDVFVRTVRSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQR 144

Query: 378 XXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       +G +   +GWKY DVV  LE  R  KA
Sbjct: 145 HVCYRSERPYTVLGNMCKHVGWKYSDVVANLEKARVEKA 183


>UniRef50_UPI0000EB39CE Cluster: UPI0000EB39CE related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB39CE UniRef100
           entry - Canis familiaris
          Length = 172

 Score =  103 bits (246), Expect = 5e-21
 Identities = 49/79 (62%), Positives = 62/79 (78%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+ GRGHLLG LAA +AK +L G KVVVV  E INISGNF+RNKLK ++FL K+ N 
Sbjct: 5   QVLVLSGRGHLLGCLAATVAKQVL-GCKVVVVHYEGINISGNFYRNKLKYLAFLCKQMNT 63

Query: 195 NPARGPFHFRAPSKILWKT 251
           NP+RGP+ F+APS+I W T
Sbjct: 64  NPSRGPYRFQAPSRIFWWT 82



 Score = 39.9 bits (89), Expect = 0.053
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = +3

Query: 411 HVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
           ++GRL+H++GWKY+ V   LE+ RK KA
Sbjct: 106 YLGRLAHKVGWKYQAVTATLEENRKEKA 133


>UniRef50_A4S5V9 Cluster: Ribosomal protein L13a, component of
           cytosolic 80S ribosome and 60S large subunit; n=2;
           Ostreococcus|Rep: Ribosomal protein L13a, component of
           cytosolic 80S ribosome and 60S large subunit -
           Ostreococcus lucimarinus CCE9901
          Length = 199

 Score =  103 bits (246), Expect = 5e-21
 Identities = 55/161 (34%), Positives = 80/161 (49%)
 Frame = +3

Query: 12  NKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCN 191
           +K IVID +GHL GRLA++++K LL+G  VVVVR E I +SG   R ++    +  KR N
Sbjct: 2   DKVIVIDAKGHLFGRLASIVSKQLLQGQHVVVVRTEGICMSGGMVRRRMAHDRYKNKRMN 61

Query: 192 VNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXX 371
            NP +GP+H+ +PS++ WKTV      K          +    G   P            
Sbjct: 62  TNPKKGPYHYTSPSRLFWKTVRGMLPHKTVRGAAAFERFKAYEGIPAPYDKVKRAVVPEA 121

Query: 372 XXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       C +G    +IGWK+  +V++LE KR+  A
Sbjct: 122 LKVLRLGEGHRFCVLGDFCEQIGWKHGAIVKELEAKRQTAA 162



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFD 340
           RGM+PHKT RG  A  R + Y+G P P+D
Sbjct: 83  RGMLPHKTVRGAAAFERFKAYEGIPAPYD 111


>UniRef50_A2DZ26 Cluster: Ribosomal protein L13, putative; n=7;
           Trichomonas vaginalis G3|Rep: Ribosomal protein L13,
           putative - Trichomonas vaginalis G3
          Length = 200

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 62/179 (34%), Positives = 84/179 (46%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           IVID +GH+ GRLAA +AK LL+G KVVVVRCE+I ++G           FL K  N NP
Sbjct: 5   IVIDAKGHIQGRLAAAVAKQLLKGRKVVVVRCEEIELNGQHKFTVHTYERFLNKTTNSNP 64

Query: 201 ARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXXXX 380
             GPFH RAP +I  + V      K               G     ++            
Sbjct: 65  RDGPFHQRAPHEIFARAVRGMIPYKTHRGADAFANLQCYEGIPAKYVSYKRLVIPHALRC 124

Query: 381 XXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVP*KET*EDHQGCW*ESV 557
                      +GRLS  +GWKY +VV +LE++RK ++ K    K+  +D +    E V
Sbjct: 125 VSIHTDRPTTKLGRLSTTMGWKYGNVVAQLEEQRKAESAKYFEAKKAAQDKRAAAIEKV 183



 Score = 35.9 bits (79), Expect = 0.86
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPF 337
           RGMIP+KT RG +A   L+ Y+G P  +
Sbjct: 83  RGMIPYKTHRGADAFANLQCYEGIPAKY 110


>UniRef50_Q7R0D6 Cluster: GLP_608_8346_8939; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_608_8346_8939 - Giardia lamblia ATCC
           50803
          Length = 197

 Score = 96.3 bits (229), Expect = 6e-19
 Identities = 56/155 (36%), Positives = 82/155 (52%), Gaps = 1/155 (0%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           IVID +GH+LGRL+A++AK LL G++V +VRCE+  ISG F   K   +  + KR N N 
Sbjct: 4   IVIDCKGHILGRLSAIVAKELLHGHEVALVRCEKAIISGAFRDVKAHYLKKMHKRTNFNH 63

Query: 201 ARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLIT-XXXXXXXXXXX 377
            RGPFHFRAP++I+ +T+      K +V        + +   + P               
Sbjct: 64  LRGPFHFRAPAEIVRRTIRGMIPYK-TVRGSDAMSRLRVYDGIPPCCARYKRVVCPSAMA 122

Query: 378 XXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKR 482
                     C VGR++HEIGW++   V + E +R
Sbjct: 123 YLCLRPERRRCEVGRVAHEIGWQHAADVERYEKRR 157



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/50 (44%), Positives = 27/50 (54%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGMIP+KT RG +A+ RLR YDG PP                 CL+P R+
Sbjct: 82  RGMIPYKTVRGSDAMSRLRVYDGIPPCCARYKRVVCPSAMAYLCLRPERR 131


>UniRef50_Q98RZ9 Cluster: 60s ribosomal protein L13A; n=1;
           Guillardia theta|Rep: 60s ribosomal protein L13A -
           Guillardia theta (Cryptomonas phi)
          Length = 194

 Score = 93.1 bits (221), Expect = 5e-18
 Identities = 38/81 (46%), Positives = 60/81 (74%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           K  V+D + HLLGR+A++ AK +L+G+K++++R E  +I+G   RN  K  S  +K+ N 
Sbjct: 2   KIHVLDAKNHLLGRMASICAKKILQGDKIIIIRSELTSITGKLGRNVNKYKSIFKKKTNT 61

Query: 195 NPARGPFHFRAPSKILWKTVE 257
           NP RGPFHF++PSKIL++T++
Sbjct: 62  NPRRGPFHFKSPSKILYQTIK 82



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 14/26 (53%), Positives = 18/26 (69%)
 Frame = +2

Query: 260 MIPHKTERGKNALRRLRTYDGCPPPF 337
           MIPHKT RG  AL+ L+ ++G P  F
Sbjct: 84  MIPHKTMRGSKALKNLKIFEGLPRIF 109


>UniRef50_O18718 Cluster: Ribosomal protein L13A; n=4;
           Entamoeba|Rep: Ribosomal protein L13A - Entamoeba dispar
          Length = 87

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 37/80 (46%), Positives = 54/80 (67%)
 Frame = +3

Query: 9   SNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRC 188
           +NK  VID  GH+LGR+A+V+AK LL G K+V+VRCE + + G      ++   + RKR 
Sbjct: 8   NNKVTVIDCHGHVLGRVASVVAKHLLLGQKIVLVRCEDLQVCGTLKMRLVQWELYQRKRV 67

Query: 189 NVNPARGPFHFRAPSKILWK 248
           N NP RG FH R+P++++ K
Sbjct: 68  NTNPTRGAFHHRSPAEMVRK 87


>UniRef50_Q8SS16 Cluster: 60S RIBOSOMAL PROTEIN L13A; n=1;
           Encephalitozoon cuniculi|Rep: 60S RIBOSOMAL PROTEIN L13A
           - Encephalitozoon cuniculi
          Length = 198

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 48/155 (30%), Positives = 68/155 (43%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           ++ID  G + G+LAA +AK+LLEG +V VV  E+    G+  R   K   +L KRC VNP
Sbjct: 7   VIIDATGQVAGKLAAKVAKLLLEGVRVTVVCAEEAVFVGSLERAMDKFKQYLNKRCLVNP 66

Query: 201 ARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXXXX 380
            RGPFHFR P   L K +      K+   +  +       G    L              
Sbjct: 67  RRGPFHFREPRMHLAKIIRRMISYKKPRGKAAMSRLATYEGIPREL-EGQPRYKVTCAFV 125

Query: 381 XXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRK 485
                      +G+L    GWK+ +  + L D+ K
Sbjct: 126 KYTGNPNRYVTLGKLLSMFGWKHAEAAKSLTDELK 160


>UniRef50_Q9AVH9 Cluster: Putative senescence-associated protein;
           n=1; Pisum sativum|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 255

 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 38/91 (41%), Positives = 52/91 (57%)
 Frame = +3

Query: 45  LLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNPARGPFHFR 224
           +LGRLA+++AK L    +  +VRCE+I ISG   R K+K M FLR+R N  P+ GP  F 
Sbjct: 1   MLGRLASIVAKELSMVRRSFLVRCEEICISGGLGRQKMKYMRFLRRRMNTKPSHGPITFV 60

Query: 225 APSKILWKTVEA*SHTKQSVARMLLGGYVHM 317
              +          HT+ SVAR+ L G  +M
Sbjct: 61  LHPRSFGALFVEWFHTRPSVARLHLLGCKYM 91


>UniRef50_A7DRR6 Cluster: Ribosomal protein L13; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein L13
           - Candidatus Nitrosopumilus maritimus SCM1
          Length = 154

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/82 (35%), Positives = 48/82 (58%)
 Frame = +3

Query: 9   SNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRC 188
           +++ IV+D   H+ GRL++ +AK+L +G++V +V CE+I  SG       +   FL    
Sbjct: 10  TDRPIVVDATNHIAGRLSSNVAKLLKQGHRVSIVNCEKIMYSGTRSNLIKEYREFLEINS 69

Query: 189 NVNPARGPFHFRAPSKILWKTV 254
            +NP  GP H+R P  I+ K +
Sbjct: 70  IINPKHGPVHYRRPDTIITKMI 91


>UniRef50_A0RXP5 Cluster: Ribosomal protein L13; n=1; Cenarchaeum
           symbiosum|Rep: Ribosomal protein L13 - Cenarchaeum
           symbiosum
          Length = 139

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 28/77 (36%), Positives = 47/77 (61%)
 Frame = +3

Query: 24  VIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNPA 203
           ++D   H+ GRLA+ +AK+LLEGN+V ++ CE++ ISG       +   FL+    ++P 
Sbjct: 1   MVDATDHIAGRLASNVAKMLLEGNRVSIINCEKVMISGKRASIVREYRDFLKIASIIHPE 60

Query: 204 RGPFHFRAPSKILWKTV 254
            GP+H R P  I+ + +
Sbjct: 61  HGPYHPRRPDTIMTRMI 77


>UniRef50_A1RWV8 Cluster: Ribosomal protein L13; n=1; Thermofilum
           pendens Hrk 5|Rep: Ribosomal protein L13 - Thermofilum
           pendens (strain Hrk 5)
          Length = 154

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 37/94 (39%), Positives = 58/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLK-LMSFLRKRCN 191
           +AIVIDG GH+ GRLA+V+AK LL+G++VVVV  E+I I+G   R   K L  ++  +  
Sbjct: 6   EAIVIDGTGHIAGRLASVVAKRLLKGDRVVVVNAEKIVITGKPKRVVEKYLKRWVEWKTY 65

Query: 192 VNP-ARGPFHFRAPSKILWKTVEA*SHTKQSVAR 290
            NP  RGP + + P ++  + V      ++++ R
Sbjct: 66  YNPELRGPKYPKTPDRLFKRMVRGMLPMEKTIGR 99


>UniRef50_Q3LWM1 Cluster: Ribosomal protein L13A; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L13A - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 181

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/81 (37%), Positives = 47/81 (58%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           K IVIDGR  L+GRLA+ I  +L +G  + V+RC+ +  SG +     +++     +   
Sbjct: 3   KTIVIDGRNQLIGRLASNIVILLKKGYTLKVIRCKDLVFSGRYEHVYNRILKKKNLKTRT 62

Query: 195 NPARGPFHFRAPSKILWKTVE 257
           NP +GP+ F  PS +L K V+
Sbjct: 63  NPNKGPYFFSNPSSLLKKIVK 83


>UniRef50_Q75J15 Cluster: Putative ribosomal protein L13a; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           ribosomal protein L13a - Oryza sativa subsp. japonica
           (Rice)
          Length = 172

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 44/148 (29%), Positives = 58/148 (39%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           +V+D R H+L RLA++IAK LL G +VV                          R N  P
Sbjct: 12  VVVDARHHMLSRLASIIAKELLNGKRVV--------------------------RMNTKP 45

Query: 201 ARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXXXX 380
           + GP HFR+P+KILW+TV      K       L           P               
Sbjct: 46  SHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRTKRMVIPDALKV 105

Query: 381 XXXXXXXXXCHVGRLSHEIGWKYRDVVR 464
                    C +G+LS E+GW Y D +R
Sbjct: 106 LRLQPGHKYCLLGQLSKEVGWNYYDTIR 133



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/50 (44%), Positives = 28/50 (56%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGMIPHKT+RG+ AL RL+ Y+   PP+D               L+PG K
Sbjct: 64  RGMIPHKTKRGEAALARLKAYEVVTPPYDRTKRMVIPDALKVLRLQPGHK 113


>UniRef50_O59300 Cluster: 50S ribosomal protein L13P; n=45;
           root|Rep: 50S ribosomal protein L13P - Pyrococcus
           horikoshii
          Length = 142

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/79 (40%), Positives = 50/79 (63%), Gaps = 2/79 (2%)
 Frame = +3

Query: 24  VIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGN--FFRNKLKLMSFLRKRCNVN 197
           +I+  G +LGRLA+ +AK+LLEG +VV+V  E+  I+GN     +K K  + LR     N
Sbjct: 3   IINADGLILGRLASRVAKMLLEGEEVVIVNAEKAVITGNREVIFSKYKQRTGLRTL--TN 60

Query: 198 PARGPFHFRAPSKILWKTV 254
           P RGPF+ +   +I+ +T+
Sbjct: 61  PRRGPFYPKRSDEIVRRTI 79



 Score = 39.9 bits (89), Expect = 0.053
 Identities = 16/30 (53%), Positives = 21/30 (70%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDN 343
           RGM+P KT+RG+ A RRL+ Y G P  F +
Sbjct: 80  RGMLPWKTDRGRKAFRRLKVYVGIPKEFQD 109


>UniRef50_O29137 Cluster: 50S ribosomal protein L13P; n=1;
           Archaeoglobus fulgidus|Rep: 50S ribosomal protein L13P -
           Archaeoglobus fulgidus
          Length = 156

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 32/89 (35%), Positives = 48/89 (53%)
 Frame = +3

Query: 24  VIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNPA 203
           VID  GH+LGRL++ IAK LL G ++VVV  E+  I+G+ +   +    +  K    +  
Sbjct: 18  VIDASGHILGRLSSKIAKRLLNGERIVVVNAEKAVITGDKY---MVFERYKEKYDRGSKE 74

Query: 204 RGPFHFRAPSKILWKTVEA*SHTKQSVAR 290
           +GP+  R P +I  +TV      K S  R
Sbjct: 75  KGPYFPRHPERIFKRTVRGMLPWKSSRGR 103



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 14/25 (56%), Positives = 19/25 (76%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+P K+ RG++A RRLR + G P
Sbjct: 92  RGMLPWKSSRGRDAYRRLRVFMGVP 116


>UniRef50_Q8TVB6 Cluster: 50S ribosomal protein L13P; n=1;
           Methanopyrus kandleri|Rep: 50S ribosomal protein L13P -
           Methanopyrus kandleri
          Length = 159

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 29/77 (37%), Positives = 47/77 (61%)
 Frame = +3

Query: 24  VIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNPA 203
           VID    +LGRLA+V+AK +L+G ++ V+  E+  I+G   +N +K   +L+K    +P 
Sbjct: 17  VIDAENAVLGRLASVVAKRILKGERIAVINTEKAIITGK--KNTIK-EEWLQKIQRGDPK 73

Query: 204 RGPFHFRAPSKILWKTV 254
           +GPF+ R P  I  + V
Sbjct: 74  KGPFYPRRPDLIFRRVV 90



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+P KT+RG+ A +RLR Y G P
Sbjct: 91  RGMLPWKTKRGREAFKRLRAYIGTP 115


>UniRef50_Q4GXI8 Cluster: Ribomsomal protein L13Ae; n=2;
           Neoptera|Rep: Ribomsomal protein L13Ae - Cicindela
           campestris (Green tiger beetle)
          Length = 78

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +3

Query: 408 CHVGRLSHEIGWKYRDVVRKLEDKRKGK-AVK 500
           CHVGRLSHE+GWKY+ V+  LE KR+ K A+K
Sbjct: 12  CHVGRLSHEVGWKYQKVIESLEHKRQVKVAIK 43


>UniRef50_Q9YB50 Cluster: 50S ribosomal protein L13P; n=1; Aeropyrum
           pernix|Rep: 50S ribosomal protein L13P - Aeropyrum
           pernix
          Length = 155

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/46 (50%), Positives = 34/46 (73%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGN 140
           G   + IV+DG G ++GRLA+V+AK+LL G +V VV  E+I +SG+
Sbjct: 5   GGEAREIVVDGSGMIMGRLASVVAKLLLAGWRVNVVNAEKIVLSGD 50



 Score = 33.1 bits (72), Expect = 6.1
 Identities = 14/25 (56%), Positives = 16/25 (64%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+P    RG+ AL RLR Y G P
Sbjct: 90  RGMLPKNKARGRRALARLRVYVGVP 114


>UniRef50_Q8ZYQ1 Cluster: 50S ribosomal protein L13P; n=5;
           Thermoproteaceae|Rep: 50S ribosomal protein L13P -
           Pyrobaculum aerophilum
          Length = 187

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 7/100 (7%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLE--GNKVVVVRCEQINISGNFFRNKLKLMSFLRK---- 182
           +++D  GH+ GRLA  IAK LLE    ++VVV  E++ I+G+    K+ +  F RK    
Sbjct: 19  VIVDAEGHVAGRLATYIAKALLERPNLRIVVVNAEKLVITGD---EKMVIEWFKRKISEW 75

Query: 183 RCNVNPAR-GPFHFRAPSKILWKTVEA*SHTKQSVARMLL 299
           R + NP + GP   R P ++  + V      K    R  L
Sbjct: 76  RTHYNPEKAGPKVPRRPDRVFKRIVRGMLPKKSETGRSAL 115



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 14/25 (56%), Positives = 19/25 (76%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+P K+E G++AL+RLR Y   P
Sbjct: 101 RGMLPKKSETGRSALKRLRVYMSIP 125


>UniRef50_Q8PW45 Cluster: 50S ribosomal protein L13P; n=11;
           Euryarchaeota|Rep: 50S ribosomal protein L13P -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 140

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +3

Query: 24  VIDGRGHLLGRLAAVIAKVLLEGN-KVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           VID +G +LGRLA+ +AK LL G+ KV ++  E+  ISG+       L  +   R     
Sbjct: 3   VIDAKGLILGRLASSVAKQLLSGDEKVYIINAEKAIISGS---RAATLREYRETRDRGAT 59

Query: 201 ARGPFHFRAPSKILWKTV 254
             GP+  + P +IL +T+
Sbjct: 60  EFGPYFPKRPDRILKRTI 77



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+P+K  RG++A+ RL+ Y G P
Sbjct: 78  RGMLPYKRARGRDAMSRLKVYVGVP 102


>UniRef50_P95991 Cluster: 50S ribosomal protein L13P; n=3;
           Sulfolobaceae|Rep: 50S ribosomal protein L13P -
           Sulfolobus solfataricus
          Length = 149

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + ++I+  G +LGR+A+ + ++L EG KV++V  E+  ISG   R        L  +   
Sbjct: 8   QVVIINAEGQILGRMASNVVRLLKEGKKVIIVNGEKAVISGEKNRVIESYKLLLTVKTLF 67

Query: 195 NPAR-GPFHFRAPSKILWKTVEA*SHTKQSVARML 296
           NP R G    R+P  I+ +T+           RML
Sbjct: 68  NPYRNGIRRPRSPINIVKRTIRGMLPKSSKGRRML 102


>UniRef50_Q6L294 Cluster: 50S ribosomal protein L13P; n=4;
           Thermoplasmatales|Rep: 50S ribosomal protein L13P -
           Picrophilus torridus
          Length = 138

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/78 (28%), Positives = 42/78 (53%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           I ID   H+ GRL++ +AK LL G  + +V   ++ I+G   R +  +  F   R   + 
Sbjct: 2   IYIDASNHIYGRLSSYVAKKLLNGESITIVNASKVVITG---RKEFIIDKFNNLRNTGSI 58

Query: 201 ARGPFHFRAPSKILWKTV 254
            +GP++ +   +IL +++
Sbjct: 59  RKGPYYPKTADRILKRSI 76


>UniRef50_Q2Q0G5 Cluster: Ribosomal protein L13P; n=1; uncultured
           organism HF70_19B12|Rep: Ribosomal protein L13P -
           uncultured organism HF70_19B12
          Length = 161

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 14/119 (11%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLL----EGN--KVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           +V D    +LGRLA+ IAK LL    EG+  +V+++  E   ++G   ++++ L  + RK
Sbjct: 7   LVFDAHDKVLGRLASHIAKTLLVTRREGDPKRVIIINAEMAIVTGP--KDRI-LADYDRK 63

Query: 183 RCNVNPARGPFHFRAPSKILWKTV------EA*SHTKQSV--ARMLLGGYVHMMGALLP 335
               +P +GPF  R P  IL +TV      +  S  +Q+V   R+++G   ++ G  LP
Sbjct: 64  YKLNHPRKGPFFPRMPDMILKRTVRGMLPYQKKSSGRQAVKDLRVMIGTPTNLKGEALP 122


>UniRef50_A7D2Q7 Cluster: Ribosomal protein L13; n=1; Halorubrum
           lacusprofundi ATCC 49239|Rep: Ribosomal protein L13 -
           Halorubrum lacusprofundi ATCC 49239
          Length = 149

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 22/78 (28%), Positives = 42/78 (53%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           +V+D R  +LGR+++ +A+ +L+G  V VV  E+  I+G    N+   M     R  +  
Sbjct: 10  VVVDARDCILGRVSSKVAQRVLDGETVAVVNAERAVITG----NEEATMETYHTRAELGS 65

Query: 201 ARGPFHFRAPSKILWKTV 254
             GP++ + P +I  + +
Sbjct: 66  DSGPYYPKRPDRIFKRAI 83



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/25 (56%), Positives = 18/25 (72%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+P+KTE G+ AL  +R Y G P
Sbjct: 84  RGMLPYKTEDGREALSNVRVYVGNP 108


>UniRef50_Q6LXM6 Cluster: 50S ribosomal protein L13P; n=6;
           Methanococcales|Rep: 50S ribosomal protein L13P -
           Methanococcus maripaludis
          Length = 137

 Score = 41.1 bits (92), Expect = 0.023
 Identities = 22/79 (27%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           +V++    ++GRLA+ +AK+ L G ++ VV  E+  ++GN      K +    ++   NP
Sbjct: 2   VVVNAENAVVGRLASYVAKLALSGEEITVVNAEKAIMTGNKEYIFQKYVQLRTRKSISNP 61

Query: 201 AR-GPFHFRAPSKILWKTV 254
            + GP + R P  I+ + +
Sbjct: 62  KKMGPKYPRRPDDIVRRVI 80


>UniRef50_P29198 Cluster: 50S ribosomal protein L13P; n=4;
           Halobacteriaceae|Rep: 50S ribosomal protein L13P -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 145

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 1/87 (1%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           +++D R  ++GR+A+ +A+  L+G  V VV  E+  I+G     + +++    KR ++  
Sbjct: 10  VIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITG----REEQIVEKYEKRVDIGN 65

Query: 201 ARGPFHFRAPSKILWKTVEA-*SHTKQ 278
             G F+ + P  I  +T+     H KQ
Sbjct: 66  DNGYFYPKRPDGIFKRTIRGMLPHKKQ 92



 Score = 33.9 bits (74), Expect = 3.5
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+PHK +RG+ A   +R Y G P
Sbjct: 84  RGMLPHKKQRGREAFESVRVYLGNP 108


>UniRef50_P39473 Cluster: 50S ribosomal protein L13P; n=4;
           Thermoprotei|Rep: 50S ribosomal protein L13P -
           Sulfolobus acidocaldarius
          Length = 148

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISG 137
           +++D    +LGR++  IAK+L  G KV VV  E+  ISG
Sbjct: 8   VIVDATNQILGRMSTHIAKLLKSGKKVYVVNAEKAIISG 46


>UniRef50_Q9M3S6 Cluster: 60S L13 ribosomal protein; n=1;
           Arabidopsis thaliana|Rep: 60S L13 ribosomal protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 61

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 13/22 (59%), Positives = 19/22 (86%)
 Frame = +3

Query: 426 SHEIGWKYRDVVRKLEDKRKGK 491
           +HE+GW+Y+ +V KLE+KRK K
Sbjct: 1   AHEVGWQYQGIVEKLEEKRKVK 22


>UniRef50_Q4QG46 Cluster: Putative uncharacterized protein; n=2;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 1445

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = -2

Query: 152 VPKEVARNIDLFAANHNN-----FVPFEKDLGDDCRQTAQQMTTAIDHYGLI 12
           VP ++ RN       HNN     FVPF ++  +D  QT QQ+ +A+ H GL+
Sbjct: 271 VPADMNRNATSNMKGHNNGDPGDFVPFAREEKEDPIQTTQQLYSAVCHAGLV 322


>UniRef50_Q53K43 Cluster: Retrotransposon protein, putative,
           unclassified; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 512

 Score = 36.3 bits (80), Expect = 0.65
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +2

Query: 281 RGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RG+ AL RL+ Y+G PPP+D               L+PG K
Sbjct: 9   RGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHK 49


>UniRef50_Q85FU2 Cluster: 50S ribosomal protein L13; n=1;
           Cyanidioschyzon merolae|Rep: 50S ribosomal protein L13 -
           Cyanidioschyzon merolae (Red alga)
          Length = 98

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 16/47 (34%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNK--VVVVRCEQINISGNFFRNK 155
           ++I+ +  +LGRLA+ + K LL  +   + +V+  QI ++GN ++NK
Sbjct: 1   MLINAKDEILGRLASRVVKTLLTQSVTCIEIVQANQIQVTGNKYKNK 47


>UniRef50_A5Z5I7 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium ventriosum ATCC 27560|Rep: Putative
           uncharacterized protein - Eubacterium ventriosum ATCC
           27560
          Length = 106

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = -3

Query: 259 ASTVFHRILDGALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEILICSQRTTTTLFPSRR 80
           +S  FHR     L+W+  R+G + +  +   +S S F+KK+P   + SQ T+    P RR
Sbjct: 16  SSGCFHR-----LEWRACRSGESPYKFQSLSVSRSKFIKKVPSGRVISQSTSAFWLPFRR 70


>UniRef50_Q7NZC0 Cluster: Probable cobalamin biosynthesis
           transmembrane protein; n=1; Chromobacterium
           violaceum|Rep: Probable cobalamin biosynthesis
           transmembrane protein - Chromobacterium violaceum
          Length = 306

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 6/74 (8%)
 Frame = -2

Query: 635 WL*FLKSLNCIHRNLDDGSEM--VFVAFDTFSPASLVILLSFFSWHSLNS-LALP---LV 474
           WL F +  N + RNL+ G+E   VF       PA L+ LL F+S  +++  LAL    LV
Sbjct: 25  WLLFTRYANHLERNLNAGAERHGVFAWLAAIVPALLLSLLLFYSLKAMSPILALAFNVLV 84

Query: 473 FKLTNNITVFPSNF 432
             LT     F S F
Sbjct: 85  LYLTMGFRHFSSAF 98


>UniRef50_Q6N2I6 Cluster: Putative uncharacterized protein; n=1;
           Rhodopseudomonas palustris|Rep: Putative uncharacterized
           protein - Rhodopseudomonas palustris
          Length = 1005

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 20/78 (25%), Positives = 35/78 (44%)
 Frame = -2

Query: 572 VFVAFDTFSPASLVILLSFFSWHSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIYGQ 393
           V+V   TF+P  + +L  F     L+S  + +++ L   ITV  +  +G   +     G 
Sbjct: 671 VYVTSITFAPVVVHLLSQFVFRRELSSSVIDVIYLLVMPITVLAAAIIGVQLFYLAKLGH 730

Query: 392 VLDRRHVEQQALQHVDGY 339
           + D     Q AL +  G+
Sbjct: 731 LADLSMFFQYALGYAGGF 748


>UniRef50_Q7XVT3 Cluster: OSJNBa0041M21.3 protein; n=3; Oryza
           sativa|Rep: OSJNBa0041M21.3 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 258

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 17/41 (41%), Positives = 22/41 (53%)
 Frame = -1

Query: 534 GDPLKFLFMALS*QPCPSSCLQAYEQHHGISIQFHGTVCLH 412
           GD   F++M     PCPS+CL+ Y  H  IS+Q      LH
Sbjct: 50  GDAPSFIYM----WPCPSNCLKPYSAHCYISVQDEMQTNLH 86


>UniRef50_Q22933 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 168

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = -2

Query: 533 VILLSFFSWHSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIYGQV 390
           V L+ F+S   L  L + L   L NNI VFPSN + +++ MT+ +G++
Sbjct: 6   VFLICFYSISCLTDLDI-LNVALENNILVFPSN-ISEASGMTLFHGRI 51


>UniRef50_P53008 Cluster: Mannosyl-oligosaccharide glucosidase; n=5;
           Saccharomycetales|Rep: Mannosyl-oligosaccharide
           glucosidase - Saccharomyces cerevisiae (Baker's yeast)
          Length = 833

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 3/60 (5%)
 Frame = -2

Query: 236 LRWSSKMERSTSRI-HVAPLTQE*HKLEFVPKEVARNIDL--FAANHNNFVPFEKDLGDD 66
           L W   M RS  +I HV  LTQ+  +   + +EV  N+DL  ++ N N +     D  DD
Sbjct: 619 LAWVGVMTRSMKQIAHVLKLTQDEQRYAQIEQEVVENLDLLHWSENDNCYCDISIDPEDD 678


>UniRef50_Q74ND7 Cluster: 50S ribosomal protein L13P; n=1;
           Nanoarchaeum equitans|Rep: 50S ribosomal protein L13P -
           Nanoarchaeum equitans
          Length = 162

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCP 328
           RGM+P KT RG+  L+ ++ Y G P
Sbjct: 82  RGMLPRKTARGRELLKNVKVYIGVP 106


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 686,683,144
Number of Sequences: 1657284
Number of extensions: 13681682
Number of successful extensions: 35539
Number of sequences better than 10.0: 44
Number of HSP's better than 10.0 without gapping: 34524
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35523
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50000004659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).