SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q96H53 Cluster: HSPA8 protein; n=37; Eukaryota|Rep: HSP...   153   3e-36
UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=23...   153   3e-36
UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931; roo...   140   2e-32
UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome sho...   132   8e-30
UniRef50_P34935 Cluster: 78 kDa glucose-regulated protein; n=13;...   109   7e-23
UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precur...   109   7e-23
UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular...   107   3e-22
UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock...   104   2e-21
UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep: ...   104   2e-21
UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1; ...   102   6e-21
UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular ...   101   1e-20
UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular ...   100   5e-20
UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|R...    99   7e-20
UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4; ...    98   1e-19
UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular...    97   3e-19
UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular ...    97   4e-19
UniRef50_UPI00005A08DE Cluster: PREDICTED: similar to heat shock...    96   5e-19
UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1; ...    96   7e-19
UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial precur...    95   2e-18
UniRef50_Q6L5N6 Cluster: Heat shock protein 70; n=8; Viridiplant...    93   6e-18
UniRef50_A4HIH9 Cluster: Heat shock 70-related protein 1, mitoch...    93   6e-18
UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38; Bacteria|...    93   6e-18
UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole gen...    92   8e-18
UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular...    92   1e-17
UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial ...    91   3e-17
UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellula...    91   3e-17
UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular or...    89   1e-16
UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 7...    87   2e-16
UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3; Planctomyc...    87   3e-16
UniRef50_Q4P629 Cluster: Putative uncharacterized protein; n=1; ...    86   5e-16
UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas vaginali...    79   8e-14
UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia intest...    79   1e-13
UniRef50_UPI00005A1D5B Cluster: PREDICTED: similar to heat shock...    77   3e-13
UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n...    76   6e-13
UniRef50_Q4DGL0 Cluster: DNAK protein, putative; n=2; Trypanosom...    76   8e-13
UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n...    76   8e-13
UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative g...    75   1e-12
UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago...    75   1e-12
UniRef50_UPI0000661593 Cluster: Homolog of Homo sapiens "Heat sh...    75   1e-12
UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1; Aca...    75   2e-12
UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella natan...    74   2e-12
UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia stip...    74   2e-12
UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9; ...    74   3e-12
UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Re...    73   5e-12
UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3; Psychrobacter...    73   7e-12
UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila aurari...    73   7e-12
UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188; Bacteria...    73   7e-12
UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1; ...    72   1e-11
UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14; R...    72   1e-11
UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonosp...    71   2e-11
UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2; ...    70   4e-11
UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29; Proteobac...    70   4e-11
UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6; Magnoliop...    70   5e-11
UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum fer...    69   7e-11
UniRef50_A7R204 Cluster: Chromosome undetermined scaffold_388, w...    69   7e-11
UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: Dna...    69   9e-11
UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13; Rickett...    68   2e-10
UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus ...    68   2e-10
UniRef50_Q4CVX5 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_Q59U56 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock...    67   3e-10
UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago...    67   3e-10
UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5; Enterobac...    67   4e-10
UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168, w...    66   5e-10
UniRef50_A6SEG2 Cluster: Putative uncharacterized protein; n=1; ...    66   5e-10
UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2; Panspora...    66   6e-10
UniRef50_Q9HHC0 Cluster: Putative glutamate dehydrogenase; n=1; ...    66   6e-10
UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_030017...    66   8e-10
UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1; N...    65   1e-09
UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter ...    65   1e-09
UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1; T...    63   4e-09
UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:...    63   6e-09
UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2; Gammapro...    63   6e-09
UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n...    62   8e-09
UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia stip...    61   2e-08
UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27; P...    61   2e-08
UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera a...    61   2e-08
UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma marg...    61   2e-08
UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2; Enta...    60   5e-08
UniRef50_Q1NCH4 Cluster: Putative NAD-specific glutamate dehydro...    59   7e-08
UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock...    59   9e-08
UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone...    59   9e-08
UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14; Alphapro...    59   9e-08
UniRef50_Q47AH4 Cluster: Molecular chaperone-like protein precur...    58   1e-07
UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera aphi...    58   2e-07
UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate dehydro...    58   2e-07
UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacif...    57   3e-07
UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;...    57   3e-07
UniRef50_A4J964 Cluster: Heat shock protein 70; n=2; Clostridial...    56   5e-07
UniRef50_A7BPD2 Cluster: Molecular chaperone DnaK; n=1; Beggiato...    56   7e-07
UniRef50_Q6RV34 Cluster: HSP70; n=2; Chironomus|Rep: HSP70 - Chi...    56   7e-07
UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena t...    55   1e-06
UniRef50_A7CRR2 Cluster: Glutamate dehydrogenase; n=1; Opitutace...    55   1e-06
UniRef50_Q670L1 Cluster: Heat shock cognate protein 71; n=12; Fu...    55   1e-06
UniRef50_Q9S9I7 Cluster: Heat shock protein 70 homolog; n=1; Zea...    55   2e-06
UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA...    54   2e-06
UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=...    54   2e-06
UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4; Planctomyc...    54   4e-06
UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n...    54   4e-06
UniRef50_Q1CY00 Cluster: DnaK family protein; n=2; Cystobacterin...    54   4e-06
UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    54   4e-06
UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodosp...    54   4e-06
UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2; Anaeromyxob...    53   5e-06
UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;...    53   5e-06
UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1; Methanospir...    53   5e-06
UniRef50_Q43372 Cluster: Heat shock protein 70 homologue; n=2; M...    53   6e-06
UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26; Bacteria|...    52   8e-06
UniRef50_UPI0000588703 Cluster: PREDICTED: similar to heat shock...    52   1e-05
UniRef50_A0C707 Cluster: Chromosome undetermined scaffold_153, w...    52   1e-05
UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermoph...    51   2e-05
UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia bu...    50   3e-05
UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus...    50   6e-05
UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1; Syntroph...    50   6e-05
UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    50   6e-05
UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG070...    50   6e-05
UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3; ...    49   8e-05
UniRef50_Q54BE1 Cluster: Putative uncharacterized protein; n=1; ...    49   8e-05
UniRef50_UPI0000DA3FE5 Cluster: PREDICTED: similar to heat shock...    49   1e-04
UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter ...    49   1e-04
UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera a...    48   2e-04
UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomon...    48   2e-04
UniRef50_A0UQH1 Cluster: Glutamate dehydrogenase; n=14; Proteoba...    47   4e-04
UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella nata...    46   7e-04
UniRef50_A5AXV7 Cluster: Putative uncharacterized protein; n=1; ...    46   7e-04
UniRef50_A2YD08 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q2INJ2 Cluster: Putative NAD-specific glutamate dehydro...    45   0.001
UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock...    45   0.002
UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1; Planctom...    45   0.002
UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1; Enta...    44   0.002
UniRef50_Q07658 Cluster: Putative uncharacterized protein YDL228...    44   0.004
UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshime...    43   0.005
UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1; Saccharo...    42   0.009
UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone...    42   0.015
UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM 55...    42   0.015
UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2; Actinomy...    42   0.015
UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    41   0.020
UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3; Actinomy...    41   0.027
UniRef50_A1XM69 Cluster: Heat shock protein Hsp70-8; n=1; Blasto...    40   0.035
UniRef50_A7KK88 Cluster: Heat shock protein; n=8; Melampsora med...    40   0.047
UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    40   0.062
UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas s...    39   0.11 
UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lambl...    39   0.11 
UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gamb...    39   0.11 
UniRef50_A4R0D3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.19 
UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena ...    38   0.25 
UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1; Entam...    37   0.43 
UniRef50_Q4XH99 Cluster: Putative uncharacterized protein; n=2; ...    37   0.43 
UniRef50_A3BBU6 Cluster: Putative uncharacterized protein; n=1; ...    36   0.57 
UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock...    36   0.76 
UniRef50_Q86ZP0 Cluster: Ribosome-associated Hsp70-like protein ...    36   1.0  
UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein...    35   1.3  
UniRef50_Q0E591 Cluster: 13.8 kDa; n=1; Spodoptera frugiperda as...    35   1.8  
UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein), HSP7...    35   1.8  
UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza sat...    35   1.8  
UniRef50_P77319 Cluster: Chaperone protein hscC; n=19; Gammaprot...    35   1.8  
UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=...    34   2.3  
UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep...    34   2.3  
UniRef50_A0LQV0 Cluster: Putative uncharacterized protein precur...    34   2.3  
UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginali...    34   2.3  
UniRef50_A2DHP2 Cluster: Putative uncharacterized protein; n=1; ...    34   2.3  
UniRef50_A2EAL7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_Q10207 Cluster: Uncharacterized protein C17D1.01; n=1; ...    33   4.0  
UniRef50_Q4S8H7 Cluster: Chromosome 2 SCAF14705, whole genome sh...    33   5.3  
UniRef50_Q58KF8 Cluster: ORF94; n=1; Leptospirillum ferrooxidans...    33   5.3  
UniRef50_A7BVG3 Cluster: von Willebrand factor type A domain pro...    33   5.3  
UniRef50_A6LQ10 Cluster: Amino acid adenylation domain; n=1; Clo...    33   5.3  
UniRef50_Q8IBX6 Cluster: Sin3 associated polypeptide p18-like pr...    33   5.3  
UniRef50_P18914 Cluster: Flagellin fljL; n=7; Alphaproteobacteri...    33   5.3  
UniRef50_UPI00015B5E7D Cluster: PREDICTED: similar to adenylate ...    33   7.1  
UniRef50_UPI00015546A1 Cluster: PREDICTED: similar to Chromosome...    33   7.1  
UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein), C-te...    33   7.1  
UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM 55...    33   7.1  
UniRef50_A3K485 Cluster: Probable acyl-CoA dehydrogenase; n=1; S...    33   7.1  
UniRef50_Q6L612 Cluster: Transcription factor involved in conidi...    33   7.1  
UniRef50_Q39FQ6 Cluster: Nucleoside diphosphate kinase; n=112; B...    33   7.1  
UniRef50_UPI000023F113 Cluster: hypothetical protein FG10529.1; ...    32   9.3  
UniRef50_Q1DAX0 Cluster: Putative uncharacterized protein; n=1; ...    32   9.3  
UniRef50_A6DLB8 Cluster: RecA regulator RecX; n=1; Lentisphaera ...    32   9.3  
UniRef50_A0J752 Cluster: Putative uncharacterized protein; n=6; ...    32   9.3  
UniRef50_Q7XMI5 Cluster: OSJNBb0006N15.14 protein; n=5; Oryza sa...    32   9.3  
UniRef50_Q6CUB0 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    32   9.3  
UniRef50_Q58321 Cluster: Magnesium-chelatase subunit chlI homolo...    32   9.3  

>UniRef50_Q96H53 Cluster: HSPA8 protein; n=37; Eukaryota|Rep: HSPA8
           protein - Homo sapiens (Human)
          Length = 219

 Score =  153 bits (371), Expect = 3e-36
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 4   YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 63

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 64  VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 122

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 123 KATVEDEKLQGKI-NDEDKQKI 143


>UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=239;
           Eukaryota|Rep: Heat shock cognate 71 kDa protein - Homo
           sapiens (Human)
          Length = 646

 Score =  153 bits (371), Expect = 3e-36
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 491 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 550 KATVEDEKLQGKI-NDEDKQKI 570


>UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931;
           root|Rep: Heat shock 70 kDa protein 1 - Homo sapiens
           (Human)
          Length = 641

 Score =  140 bits (340), Expect = 2e-32
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome
           shotgun sequence; n=3; Fungi/Metazoa group|Rep:
           Chromosome 3 SCAF9564, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score =  132 bits (318), Expect = 8e-30
 Identities = 61/77 (79%), Positives = 68/77 (88%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQV+EGER MTK NNLLGKFELTGIPPAP+GVPQIEVTF IDANGILNVSA
Sbjct: 323 YADNQPGVLIQVYEGERVMTKGNNLLGKFELTGIPPAPQGVPQIEVTFYIDANGILNVSA 382

Query: 227 IEKSTNKENRSPLPTTK 277
           ++KST KEN+  +   K
Sbjct: 383 VDKSTGKENKITITNDK 399



 Score = 37.9 bits (84), Expect = 0.19
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMV 312
           +ITITNDKGRLSKEEIE+ V
Sbjct: 392 KITITNDKGRLSKEEIEKCV 411


>UniRef50_P34935 Cluster: 78 kDa glucose-regulated protein; n=13;
           Eukaryota|Rep: 78 kDa glucose-regulated protein - Sus
           scrofa (Pig)
          Length = 262

 Score =  109 bits (261), Expect = 7e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 99  SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 158

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 159 DKGTGNKNK 167



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 167 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 200


>UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78); n=736;
           root|Rep: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78) - Homo
           sapiens (Human)
          Length = 654

 Score =  109 bits (261), Expect = 7e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 455 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 514

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 515 DKGTGNKNK 523



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 523 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 556


>UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular
           organisms|Rep: Chaperone protein dnaK - Brucella
           melitensis
          Length = 637

 Score =  107 bits (256), Expect = 3e-22
 Identities = 49/68 (72%), Positives = 57/68 (83%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I+VF+GER M  DN LLG+F+L GIPPAPRGVPQIEVTFDIDANGI+NVSA +
Sbjct: 426 DNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKD 485

Query: 233 KSTNKENR 256
           K T KE++
Sbjct: 486 KGTGKEHQ 493


>UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock
           protein protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 502

 Score =  104 bits (249), Expect = 2e-21
 Identities = 50/69 (72%), Positives = 56/69 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ GV IQVFEGERAM KDNN LG+FELTGIPPAP GVP+IEVTFDIDAN +L  +A
Sbjct: 362 YSDNQLGVSIQVFEGERAMVKDNNRLGQFELTGIPPAPHGVPKIEVTFDIDANELLTDTA 421

Query: 227 IEKSTNKEN 253
            +  T+  N
Sbjct: 422 KDLMTDHTN 430



 Score = 39.5 bits (88), Expect = 0.062
 Identities = 18/30 (60%), Positives = 26/30 (86%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNEDD 345
           ITI +DK RLSK++IERM+ +AE+++ EDD
Sbjct: 432 ITIYHDK-RLSKDDIERMMKDAERFQTEDD 460


>UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep:
           GLP_623_6850_8883 - Giardia lamblia ATCC 50803
          Length = 677

 Score =  104 bits (249), Expect = 2e-21
 Identities = 48/66 (72%), Positives = 55/66 (83%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  V IQV+EGER+M KDNNLLG F+L  IPPAPRG PQIEVTF+ID+NGIL VSA+E
Sbjct: 475 DQQTMVKIQVYEGERSMVKDNNLLGNFDLNDIPPAPRGTPQIEVTFEIDSNGILTVSAVE 534

Query: 233 KSTNKE 250
           KS+ KE
Sbjct: 535 KSSGKE 540



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/31 (61%), Positives = 25/31 (80%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNED 342
           E ITI ND+GRLS++EI R+V EAE++  ED
Sbjct: 541 ESITIKNDRGRLSEDEINRLVKEAEEFAEED 571


>UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 391

 Score =  102 bits (245), Expect = 6e-21
 Identities = 46/70 (65%), Positives = 56/70 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V IQVFEGER+MT+DN LLGKF+LTGI PAPRG PQI VTF++DANGIL+V A
Sbjct: 188 YKDRQTTVTIQVFEGERSMTRDNRLLGKFDLTGIAPAPRGAPQIAVTFEVDANGILSVLA 247

Query: 227 IEKSTNKENR 256
            +K+T +  +
Sbjct: 248 ADKATGRSEK 257



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 28/108 (25%), Positives = 54/108 (50%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMKCYHGG 423
           + E+ITI+ D  ++S+EEI+RMV EAE++ +ED + + +    R       +++K   GG
Sbjct: 254 RSEKITISGDDRKISQEEIDRMVREAEEFADEDRRHR-EQVDARNSLEAYVYNVKSTLGG 312

Query: 424 *EAQGKDSPEL*QADHSSNKCNIHPFKWMGFPVQAGRARRSMSTRQKE 567
             A   +  E  + + +  + +    +W+     AG+       R+ E
Sbjct: 313 KMADAMEGEEKEKVEEAVREAH----EWLDGNPDAGKEEYEEKLRELE 356


>UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular
           organisms|Rep: Chaperone protein dnaK - Bordetella
           bronchiseptica (Alcaligenes bronchisepticus)
          Length = 641

 Score =  101 bits (243), Expect = 1e-20
 Identities = 47/68 (69%), Positives = 55/68 (80%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQP V I+VF+GER +   N  LG+F L GIPPAPRG+PQIEVTFDIDANGIL+VSA +
Sbjct: 432 DNQPAVTIKVFQGEREIAAGNKGLGEFNLEGIPPAPRGLPQIEVTFDIDANGILHVSAKD 491

Query: 233 KSTNKENR 256
           K T KEN+
Sbjct: 492 KGTGKENK 499


>UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular
           organisms|Rep: Chaperone protein dnaK - Lactobacillus
           johnsonii
          Length = 624

 Score = 99.5 bits (237), Expect = 5e-20
 Identities = 48/103 (46%), Positives = 66/103 (64%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQP V + V +GER M  D+  LG+FELT IPPAPRGVPQI+VTFDID NGI+NVSA 
Sbjct: 401 ADNQPAVDVHVLQGERPMAADDKTLGRFELTDIPPAPRGVPQIQVTFDIDKNGIVNVSAK 460

Query: 230 EKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKE 358
           +  T KE +  + ++  +S  +   +    +   E    R++E
Sbjct: 461 DMGTGKEQKITIKSSSGLSDEEIKKMQKDAEEHAEEDKKRKEE 503


>UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|Rep:
           Chaperone protein DnaK - Roseiflexus sp. RS-1
          Length = 624

 Score = 99.1 bits (236), Expect = 7e-20
 Identities = 47/69 (68%), Positives = 53/69 (76%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I V +GER +  DN  LG+F L GIPPAPRGVPQIEVTFDIDANGILNVSA 
Sbjct: 425 ADGQTAVDIHVLQGERELAADNMTLGRFRLEGIPPAPRGVPQIEVTFDIDANGILNVSAR 484

Query: 230 EKSTNKENR 256
           +K+T KE R
Sbjct: 485 DKATGKEQR 493



 Score = 33.5 bits (73), Expect = 4.0
 Identities = 17/35 (48%), Positives = 24/35 (68%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           ++ITIT     LSKEEIERM+ +AE +  ED + +
Sbjct: 492 QRITITASTN-LSKEEIERMIRDAELHAAEDKRRR 525


>UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 430

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 42/70 (60%), Positives = 56/70 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V ++VFEGER+MT+DN LLG+F+L GI PAPRG PQIEV F++DA+GIL+VSA
Sbjct: 229 YKDKQTTVTVKVFEGERSMTRDNRLLGRFDLAGIAPAPRGAPQIEVAFEVDADGILSVSA 288

Query: 227 IEKSTNKENR 256
            +++T +  R
Sbjct: 289 ADRATGRSER 298



 Score = 40.3 bits (90), Expect = 0.035
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNED 342
           + E+ITI+ D  + S+EEI+RMV EAE++ +ED
Sbjct: 295 RSERITISGDDRKTSREEIDRMVGEAEEFADED 327


>UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular
           organisms|Rep: Chaperone protein dnaK - Chlamydophila
           caviae
          Length = 664

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 44/69 (63%), Positives = 55/69 (79%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQP V I V +GER M KDN  +G+F+LT IPPAPRG PQIEVTFDIDANGIL+VSA 
Sbjct: 428 ADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAK 487

Query: 230 EKSTNKENR 256
           + ++ +E +
Sbjct: 488 DAASGREQK 496



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 15/35 (42%), Positives = 25/35 (71%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           ++I I    G L ++EI+RM+N+AEK++ ED K +
Sbjct: 495 QKIRIEASSG-LKEDEIQRMINDAEKHKEEDKKRR 528


>UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular
           organisms|Rep: Chaperone protein dnaK1 - Streptomyces
           avermitilis
          Length = 622

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 44/68 (64%), Positives = 53/68 (77%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQP V IQV++GER +   N  LG FELTG+PPAPRGVPQIEV FDIDANGI++V+A +
Sbjct: 402 DNQPSVQIQVYQGEREIAAYNKKLGMFELTGLPPAPRGVPQIEVAFDIDANGIMHVTAKD 461

Query: 233 KSTNKENR 256
             T KE +
Sbjct: 462 LGTGKEQK 469


>UniRef50_UPI00005A08DE Cluster: PREDICTED: similar to heat shock
           protein 8; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 8 - Canis familiaris
          Length = 141

 Score = 96.3 bits (229), Expect = 5e-19
 Identities = 42/57 (73%), Positives = 49/57 (85%)
 Frame = +2

Query: 107 KDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTK 277
           KDNNLLGKFELTGIPPAP G+PQIEV+FDID NGILN SA++KST KEN+  +  +K
Sbjct: 61  KDNNLLGKFELTGIPPAPHGIPQIEVSFDIDGNGILNASAVDKSTGKENKISITNSK 117



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/32 (68%), Positives = 27/32 (84%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           +I+ITN KG LSKE+IERMV EAEK + ED+K
Sbjct: 110 KISITNSKGHLSKEDIERMVQEAEKCKAEDEK 141


>UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: HEAT SHOCK RELATED 70kDa
           PROTEIN - Encephalitozoon cuniculi
          Length = 683

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 51/104 (49%), Positives = 65/104 (62%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y DNQ  V I V+EG RAM KDN  +G F L GI  APRGVP+IEVTFD+D NGIL V+A
Sbjct: 496 YEDNQTAVTINVYEGNRAMCKDNKKIGSFNLDGIIAAPRGVPKIEVTFDVDHNGILIVTA 555

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKE 358
            +K T KEN+      KV + + R S   + + + E R   Q++
Sbjct: 556 QDKQTGKENQ-----IKVTNSQNRLSQEEIERMTKEARDNEQRD 594



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMKCY 414
           QI +TN + RLS+EEIERM  EA      D++ K +  G RM ++    S K +
Sbjct: 565 QIKVTNSQNRLSQEEIERMTKEARDNEQRDNETK-EKMGKRMAFDQAISSFKAF 617


>UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial
           precursor; n=291; root|Rep: Stress-70 protein,
           mitochondrial precursor - Homo sapiens (Human)
          Length = 679

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 476 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 536 DKGTGREQQ 544



 Score = 37.1 bits (82), Expect = 0.33
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 542 EQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 576


>UniRef50_Q6L5N6 Cluster: Heat shock protein 70; n=8;
           Viridiplantae|Rep: Heat shock protein 70 - Nicotiana
           benthamiana
          Length = 247

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 43/67 (64%), Positives = 50/67 (74%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I V +GER   KDN  LG+F L GIPPAPRGVPQIEV FDIDANGIL+V+A 
Sbjct: 25  ADGQTSVEINVLQGEREFVKDNKSLGRFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAT 84

Query: 230 EKSTNKE 250
           +K T K+
Sbjct: 85  DKGTGKK 91



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGD 360
           + ITIT     L K+E++RMV EAEK+  E DK K D
Sbjct: 92  QDITITG-ASTLPKDEVDRMVQEAEKFAKE-DKEKRD 126


>UniRef50_A4HIH9 Cluster: Heat shock 70-related protein 1,
           mitochondrial, putative; n=2; Leishmania
           braziliensis|Rep: Heat shock 70-related protein 1,
           mitochondrial, putative - Leishmania braziliensis
          Length = 356

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 39/63 (61%), Positives = 51/63 (80%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  +  +VF+GER M  DN ++G+F+L GIPPAPRGVPQ+EVTFDIDANGI +V+A +
Sbjct: 155 DGQTAIKFEVFQGEREMASDNQMMGQFDLVGIPPAPRGVPQVEVTFDIDANGICHVTAKD 214

Query: 233 KST 241
           K+T
Sbjct: 215 KAT 217


>UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38;
           Bacteria|Rep: Chaperone protein dnaK - Ureaplasma parvum
           (Ureaplasma urealyticum biotype 1)
          Length = 603

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 41/67 (61%), Positives = 54/67 (80%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQP V I++ +GER++  DN LLG FEL+GI PAPRGVPQIE+ F+IDANGI++V+A 
Sbjct: 403 ADNQPSVDIRIVQGERSLAADNKLLGNFELSGIEPAPRGVPQIEIKFNIDANGIMSVNAK 462

Query: 230 EKSTNKE 250
           +  T KE
Sbjct: 463 DLKTQKE 469


>UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr18 scaffold_24, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 667

 Score = 92.3 bits (219), Expect = 8e-18
 Identities = 42/67 (62%), Positives = 50/67 (74%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I V +GER   +DN  LG F L GIPPAPRGVPQIEV FDIDANGIL+V+A+
Sbjct: 458 ADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAV 517

Query: 230 EKSTNKE 250
           +K T K+
Sbjct: 518 DKGTGKK 524



 Score = 32.3 bits (70), Expect = 9.3
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGD 360
           + ITIT     L  +E++RMV EAEK+  E DK K D
Sbjct: 525 QDITITG-ASTLPNDEVDRMVKEAEKFAKE-DKEKRD 559


>UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular
           organisms|Rep: Chaperone protein dnaK1 - Synechocystis
           sp. (strain PCC 6803)
          Length = 692

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 43/66 (65%), Positives = 50/66 (75%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  V I V +GERAM +DN  LGKF L GIPPAPRG+PQIEV+F+ID NGIL VSA +
Sbjct: 426 DGQTSVEIHVIQGERAMARDNKSLGKFLLAGIPPAPRGMPQIEVSFEIDVNGILKVSAQD 485

Query: 233 KSTNKE 250
           + T KE
Sbjct: 486 QGTGKE 491


>UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial
           precursor; n=18; Ascomycota|Rep: Heat shock protein
           SSQ1, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 657

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 40/66 (60%), Positives = 53/66 (80%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q GV I+VF+GER + ++N L+G  +LTGI P P+G+PQI VTFDIDA+GI+NVSA E
Sbjct: 467 DGQAGVDIKVFQGERGLVRNNKLIGDLKLTGITPLPKGIPQIYVTFDIDADGIINVSAAE 526

Query: 233 KSTNKE 250
           KS+ K+
Sbjct: 527 KSSGKQ 532


>UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellular
           organisms|Rep: Chaperone protein dnaK3 - Synechocystis
           sp. (strain PCC 6803)
          Length = 771

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 41/78 (52%), Positives = 57/78 (73%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           +NQ  V + V +GER M  DN  LG+F+L+GIPPAPRGVPQ++V+FDIDANGIL V+A +
Sbjct: 426 NNQTVVEVHVLQGEREMASDNISLGRFKLSGIPPAPRGVPQVQVSFDIDANGILQVTARD 485

Query: 233 KSTNKENRSPLPTTKVVS 286
           K+T +E    +    ++S
Sbjct: 486 KTTGREQSITVQGASILS 503


>UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular
           organisms|Rep: Heat shock protein 70 - Rhodoferax
           ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)
          Length = 633

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 44/87 (50%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I VF+GER M  DN  LG+F L G+PPAPRGVP+IEVTFDID+NGIL+V+A 
Sbjct: 405 ADMQTNVTIHVFQGERPMASDNTGLGEFTLDGLPPAPRGVPKIEVTFDIDSNGILSVAAR 464

Query: 230 EKSTNK-ENRSPLPTTKVVSPRKRSSV 307
           + ++ K ++ S   +T++    K+  V
Sbjct: 465 DTASGKSQSISITSSTRLPESEKKRMV 491


>UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 70;
           n=11; Entamoeba histolytica|Rep: Mitochondrial-type heat
           shock protein 70 - Entamoeba histolytica
          Length = 598

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 40/66 (60%), Positives = 52/66 (78%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I+VF+GER +T+ N  LG+F+L GIPPA +GV +IEVTFDID NGI+ VSA++
Sbjct: 427 DNQQEVDIKVFQGERRVTRKNKKLGEFKLVGIPPAKKGVAKIEVTFDIDVNGIVKVSALD 486

Query: 233 KSTNKE 250
           K T K+
Sbjct: 487 KGTGKK 492


>UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3;
           Planctomycetaceae|Rep: Chaperone protein dnaK -
           Rhodopirellula baltica
          Length = 645

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 42/67 (62%), Positives = 48/67 (71%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V ++VF+GER M   N LL +F L  IP APRGVPQIEV FDID NGIL+VSA 
Sbjct: 434 ADNQTAVTVRVFQGERKMANANRLLAEFNLEDIPAAPRGVPQIEVKFDIDQNGILSVSAK 493

Query: 230 EKSTNKE 250
           E  T KE
Sbjct: 494 ELKTGKE 500


>UniRef50_Q4P629 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 417

 Score = 86.2 bits (204), Expect = 5e-16
 Identities = 40/66 (60%), Positives = 48/66 (72%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V   V+EGER   KDN LLG+FELTGIPP PRG  ++  TF+IDANG+L VSA E
Sbjct: 243 DNQTQVTFPVYEGERTQCKDNRLLGEFELTGIPPQPRGQAELLTTFEIDANGLLKVSAQE 302

Query: 233 KSTNKE 250
           K T ++
Sbjct: 303 KITGRK 308



 Score = 37.5 bits (83), Expect = 0.25
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH 363
           ITITN  GRLS  EIE+M+ +AE +   D      H
Sbjct: 311 ITITNSVGRLSSNEIEQMIKDAETFSKADKDFTAKH 346


>UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas
           vaginalis|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 617

 Score = 79.0 bits (186), Expect = 8e-14
 Identities = 39/81 (48%), Positives = 54/81 (66%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D+  G  I++FEGER +T+DN  LG FEL  +P A RG  QI+VTF+IDAN IL V+A E
Sbjct: 435 DDAAGARIEIFEGERPLTRDNRPLGIFELHNLPRAARGQLQIDVTFEIDANAILTVTAQE 494

Query: 233 KSTNKENRSPLPTTKVVSPRK 295
            ST   ++  + T  +V P++
Sbjct: 495 MSTKSMDQIQIDTLDMVLPQE 515


>UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia
           intestinalis|Rep: GLP_54_20127_18205 - Giardia lamblia
           ATCC 50803
          Length = 640

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 41/146 (28%), Positives = 81/146 (55%), Gaps = 2/146 (1%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I+VF+GER +   N+ LG+FEL  +PP PRG  +I+++F++D NG+++V A++
Sbjct: 454 DNQRSVKIKVFQGEREIASQNHYLGEFELDNLPPGPRGSLKIDISFEVDENGLIHVKAVD 513

Query: 233 KSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMT--RQKETIQGQECIGILLASA* 406
           + T  +    +    +     + ++  M + + E +    R++E  +  + +G L+A   
Sbjct: 514 QDTGVQQSIKINNASL----SQDAINEMLKAAAENKEADKREREIFEYSKELGGLIAGLK 569

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTS 484
            A  E + L  K ++    + + ++S
Sbjct: 570 EALREHKDLLSKDIVEKGNRLVTQSS 595


>UniRef50_UPI00005A1D5B Cluster: PREDICTED: similar to heat shock
           protein 8; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 8 - Canis familiaris
          Length = 348

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 34/38 (89%), Positives = 35/38 (92%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAP 160
           YSDNQPGVLIQV+E E AMTKDNNLLGKFE TGIPPAP
Sbjct: 270 YSDNQPGVLIQVYESEHAMTKDNNLLGKFEFTGIPPAP 307


>UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n=2;
           Trichomonas vaginalis|Rep: Heat shock cognate protein,
           putative - Trichomonas vaginalis G3
          Length = 622

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 33/66 (50%), Positives = 47/66 (71%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D+   V IQ++EGER +T+DN+ LG F+L+G+PP PRG    EV+F++D N IL VSA +
Sbjct: 440 DDDDTVTIQIYEGERPLTRDNHFLGSFDLSGLPPGPRGTVLFEVSFELDQNNILTVSAKD 499

Query: 233 KSTNKE 250
            S+  E
Sbjct: 500 ISSGHE 505


>UniRef50_Q4DGL0 Cluster: DNAK protein, putative; n=2; Trypanosoma
           cruzi|Rep: DNAK protein, putative - Trypanosoma cruzi
          Length = 279

 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V I+V+EGER +      LG F LT IPPAPRG P+I VTFD++ +GIL VSA+
Sbjct: 65  ADNQRNVEIKVYEGERPLVTQCQCLGTFTLTDIPPAPRGKPRITVTFDVNTDGILVVSAV 124

Query: 230 EKSTNKENRSPLPTTK 277
           E+   K +   +   K
Sbjct: 125 EEMGGKTHAITITNDK 140



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 22/29 (75%), Positives = 28/29 (96%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNED 342
           ITITNDKGRLSK++IE+MV+EAE++ NED
Sbjct: 134 ITITNDKGRLSKDQIEKMVHEAEQFANED 162


>UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n=2;
           Eukaryota|Rep: NAD-specific glutamate dehydrogenase -
           Achlya klebsiana
          Length = 1063

 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 38/76 (50%), Positives = 52/76 (68%)
 Frame = -2

Query: 229 DSGNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIR 50
           D  +V+DTVGI+VEGD+NL + TR   +  + E  EQVV+ GH TLT K+L++++ LV+ 
Sbjct: 550 DGRHVQDTVGINVEGDINLWNTTRHWRNTIEGELPEQVVVTGHRTLTFKHLNQHTRLVVS 609

Query: 49  VGGECLSLFSGDGSVT 2
           VGGE L L     SVT
Sbjct: 610 VGGESLRLLGWHSSVT 625


>UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative gdh;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           putative gdh - Nasonia vitripennis
          Length = 486

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 36/74 (48%), Positives = 51/74 (68%)
 Frame = -2

Query: 223 GNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVG 44
           G+++DTVG+++EGD +L  AT  RWD G++EF++++VI GH  LTL  LD    LV+R  
Sbjct: 89  GHLKDTVGVNLEGDFDLGDATWCRWDSGEVEFSKKMVILGHRALTLVDLDGDGVLVVRGS 148

Query: 43  GECLSLFSGDGSVT 2
           GE L L  GD  V+
Sbjct: 149 GEDLRLLGGDDGVS 162


>UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 592

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 43/76 (56%), Positives = 49/76 (64%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDN   VLI+V+EGERA   DNNLLG F L+ +P APRG P  EV F I+ NGIL VSA 
Sbjct: 415 SDNLTSVLIKVYEGERARASDNNLLGSFCLS-VPSAPRGHP-FEVCFTINENGILIVSAN 472

Query: 230 EKSTNKENRSPLPTTK 277
           EKST   N   +   K
Sbjct: 473 EKSTGSTNEITVTNDK 488



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 20/32 (62%), Positives = 26/32 (81%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           +IT+TNDK RLS +EI +M+ EAE YR ED+K
Sbjct: 481 EITVTNDKERLSSQEIIKMIKEAENYRVEDEK 512


>UniRef50_UPI0000661593 Cluster: Homolog of Homo sapiens "Heat shock
           70kDa protein 8; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Heat shock 70kDa protein 8 - Takifugu
           rubripes
          Length = 200

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 34/72 (47%), Positives = 50/72 (69%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGG 41
           +V++ VGID+EGDL+LR  +  R +  QL+  ++VV+ GH + +  +LDE   LV+R+GG
Sbjct: 14  HVQNAVGIDIEGDLDLRDPSGSRREARQLKLAQEVVVLGHGSFSFIHLDEDPRLVVRIGG 73

Query: 40  ECLSLFSGDGSV 5
           E L  FSGDG V
Sbjct: 74  EDLCFFSGDGGV 85


>UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Heat shock protein
           70 homolog - Mimivirus
          Length = 941

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 35/75 (46%), Positives = 51/75 (68%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D+Q  V I++FEGER +TK+N  +G F L+G    PRG P I++TF ID NGIL V+A 
Sbjct: 459 TDDQDNVNIKIFEGERKLTKNNFHVGTFNLSGFEKGPRGYPVIKITFHIDINGILQVTAH 518

Query: 230 EKSTNKENRSPLPTT 274
           EK ++ +N   + +T
Sbjct: 519 EKKSDIQNGIKITST 533


>UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella
           natans|Rep: Chaperone DnaK - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 653

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 35/63 (55%), Positives = 43/63 (68%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I V +GER    +   LG F+L+GIPPAPRG PQIEV F +D NGIL V A +
Sbjct: 488 DNQNSVEINVLQGERDFAANCKPLGTFKLSGIPPAPRGTPQIEVNFQLDVNGILKVIATD 547

Query: 233 KST 241
           K++
Sbjct: 548 KTS 550


>UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 946

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 51/136 (37%), Positives = 71/136 (52%), Gaps = 4/136 (2%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SD Q  ++++VFEGE  +   N LLG+FEL+GI  A +G  +I V F++D NGIL VSA 
Sbjct: 426 SDYQTNLVVKVFEGENEVCSKNRLLGEFELSGIQRATKGEARIIVVFNVDDNGILKVSAT 485

Query: 230 EKSTNKENRSPLPTTK---VVSPRKRSSVWLMR-QRSTETRMTRQKETIQGQECIGILLA 397
           E  TNK     +   K       ++R S  +   +R  E      KE  Q    I  LL 
Sbjct: 486 ESKTNKTKSLTITKLKESWTEKEKQRVSTEIEEFKRDRELHSAMSKEIEQEIYKIEHLL- 544

Query: 398 SA*SATMEDEKLKEKI 445
           SA +  + D ++K KI
Sbjct: 545 SAMNNVLTDPRIKSKI 560


>UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9;
           Trypanosomatidae|Rep: Heat shock cognate HSP70 protein -
           Trypanosoma brucei brucei
          Length = 676

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 36/61 (59%), Positives = 43/61 (70%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V IQVFEGER +T+ N+ LG F L GI PA  G P I VTF +DA+GIL V+A E
Sbjct: 439 DNQSEVEIQVFEGERPLTRHNHRLGSFVLDGITPAKHGEPTITVTFSVDADGILTVTAAE 498

Query: 233 K 235
           +
Sbjct: 499 E 499


>UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Rep:
           Heat shock protein 70 - Acidobacteria bacterium (strain
           Ellin345)
          Length = 634

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 35/67 (52%), Positives = 46/67 (68%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           + Q  V I V +GER +  D   L +F+L GIPP P G+P+IEV F IDANGIL+VSA E
Sbjct: 426 EGQTSVAIHVVQGERELAADCRSLARFDLKGIPPMPAGLPRIEVKFLIDANGILHVSAKE 485

Query: 233 KSTNKEN 253
           + + KE+
Sbjct: 486 QRSGKES 492


>UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3;
           Psychrobacter|Rep: 2-alkenal reductase - Psychrobacter
           sp. PRwf-1
          Length = 650

 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 34/65 (52%), Positives = 45/65 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q G+++ V +GER   +    LG+FEL GIPP   G+ +IEVTFDIDANG L+VSA
Sbjct: 447 YQDGQTGMVVHVVQGERDTVEHCRSLGRFELYGIPPMKAGLARIEVTFDIDANGQLSVSA 506

Query: 227 IEKST 241
            E ++
Sbjct: 507 FEATS 511


>UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila
           auraria|Rep: LAC ORF protein - Drosophila auraria (Fruit
           fly)
          Length = 613

 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 35/72 (48%), Positives = 50/72 (69%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGG 41
           +V+D VG+ VEGDL+L H+TR   + GQ+E  +++V+ GH  L L +LD  SGLV+RV G
Sbjct: 123 DVQDAVGVHVEGDLDLGHSTRGWRNAGQVEGAQRIVVLGHRALALVHLDGDSGLVVRVRG 182

Query: 40  ECLSLFSGDGSV 5
           E L L + D +V
Sbjct: 183 EGLRLLARDAAV 194


>UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188;
           Bacteria|Rep: Chaperone protein hscA - Yersinia pestis
          Length = 650

 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 32/68 (47%), Positives = 45/68 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           + D Q  ++I V +GER + KD   L +F L G+PP P G   I VTF +DA+G+L+V+A
Sbjct: 460 FKDGQSAMMIHVLQGERELVKDCRSLARFTLRGLPPLPAGGAHIRVTFQVDADGLLSVTA 519

Query: 227 IEKSTNKE 250
           +EKST  E
Sbjct: 520 MEKSTGVE 527


>UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 516

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 36/74 (48%), Positives = 50/74 (67%)
 Frame = -2

Query: 226 SGNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRV 47
           SG+++DTVG+DVEGDL+LRHA     D GQLE TE++V+ G   L L++++  +GLV+  
Sbjct: 35  SGDLDDTVGVDVEGDLDLRHAAAGSRDTGQLELTERLVVAGKLALALEHVNLDAGLVVGS 94

Query: 46  GGECLSLFSGDGSV 5
           GG  L L   D  V
Sbjct: 95  GGVDLGLGGRDRGV 108


>UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14;
           Rickettsia|Rep: Chaperone protein hscA homolog -
           Rickettsia felis (Rickettsia azadi)
          Length = 637

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 34/66 (51%), Positives = 44/66 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQ G+   + +GER M  D   L +FEL G+PP   G  + EVTF IDA+GIL+VSA
Sbjct: 446 YADNQTGIQFHILQGEREMAVDCRSLARFELKGLPPMKAGNIRAEVTFAIDADGILSVSA 505

Query: 227 IEKSTN 244
            EK +N
Sbjct: 506 YEKISN 511


>UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonospora
           locustae|Rep: Mitochondrial-type HSP70 - Antonospora
           locustae (Nosema locustae)
          Length = 622

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 33/66 (50%), Positives = 44/66 (66%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I +++GER + K N  LG  +L  IP AP+ VP+IEVTF+ DANGI  ++A +
Sbjct: 469 DNQTEVDINIYQGERPLVKYNKFLGSLKLKNIPRAPKNVPKIEVTFESDANGICKITARD 528

Query: 233 KSTNKE 250
             T KE
Sbjct: 529 ALTKKE 534


>UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, cytosolic -
           Ostreococcus lucimarinus CCE9901
          Length = 711

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 30/66 (45%), Positives = 49/66 (74%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  + +++FEGER+ T  N+LLG+F+++GI  A  G P+I+VTF+++ NG+L V+A +
Sbjct: 602 DNQDEIDVRIFEGERSNTDGNHLLGEFQISGIERASAGEPKIDVTFEVNTNGLLTVTAKD 661

Query: 233 KSTNKE 250
           + T  E
Sbjct: 662 RVTGVE 667



 Score = 36.7 bits (81), Expect = 0.43
 Identities = 15/31 (48%), Positives = 23/31 (74%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           +++ +D+GRL+ EEIERM  EAE    ED++
Sbjct: 670 VSLQHDRGRLTAEEIERMCAEAEAMAEEDER 700


>UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29;
           Proteobacteria|Rep: Chaperone protein hscA - Salmonella
           typhimurium
          Length = 616

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 32/68 (47%), Positives = 44/68 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           + D Q  + I V +GER + +D   L +F L GIPP P G   I VTF +DA+G+L+V+A
Sbjct: 426 FKDGQTAMSIHVMQGERELVQDCRSLARFALRGIPPLPAGGAHIRVTFQVDADGLLSVTA 485

Query: 227 IEKSTNKE 250
           +EKST  E
Sbjct: 486 MEKSTGVE 493


>UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6;
           Magnoliophyta|Rep: 70kD heat shock protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 563

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 32/58 (55%), Positives = 41/58 (70%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           DNQ   LI ++EGE    ++N+LLG F+L GIPPAP+GVP+I V  DIDA+  L V A
Sbjct: 456 DNQKEALIIIYEGEGETVEENHLLGYFKLVGIPPAPKGVPEINVCMDIDASNALRVFA 513


>UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum
           ferrooxidans|Rep: HscA chaperone - Leptospirillum
           ferrooxidans
          Length = 588

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 34/67 (50%), Positives = 43/67 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           + D Q  V I V +GER M KDN  L +F LT I P   G  +IEVTF IDANGIL+V A
Sbjct: 393 FLDGQVKVDIHVLQGEREMAKDNRSLARFSLTDITPMTAGAARIEVTFTIDANGILDVRA 452

Query: 227 IEKSTNK 247
           +++ T +
Sbjct: 453 LDQRTGR 459


>UniRef50_A7R204 Cluster: Chromosome undetermined scaffold_388,
           whole genome shotgun sequence; n=2; core
           eudicotyledons|Rep: Chromosome undetermined
           scaffold_388, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 372

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 31/41 (75%), Positives = 36/41 (87%)
 Frame = +2

Query: 134 ELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENR 256
           +L GIPPAPRG+PQIEVTFDIDANGI+ VSA +KST KE +
Sbjct: 197 QLVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKSTGKEQQ 237



 Score = 32.7 bits (71), Expect = 7.1
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +QITI +  G LS +EIE+MV EAE +   D + K
Sbjct: 236 QQITIRSSGG-LSDDEIEKMVKEAELHAQRDQERK 269


>UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: DnaK
           protein - Clostridium perfringens
          Length = 575

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 38/78 (48%), Positives = 49/78 (62%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  VL+ V+EGE     DN L+ +F L+GIP A  G  +I++TF  D NGILNVSA  
Sbjct: 410 DNQTEVLVSVYEGESRYVSDNTLIDEFILSGIPKADTGKEKIDITFTYDLNGILNVSAEI 469

Query: 233 KSTNKENRSPLPTTKVVS 286
            ST  E  S + +TK +S
Sbjct: 470 LSTGDE-ISKIMSTKGLS 486


>UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13;
           Rickettsiales|Rep: Heat shock protein Hsp70 - Ehrlichia
           canis (strain Jake)
          Length = 618

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/65 (50%), Positives = 42/65 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  + I V +GER M + N  L KF+L GIPP P G  +I V F++D +G+L VSA
Sbjct: 429 YIDGQNSIQIHVCQGEREMVEHNKSLAKFDLKGIPPLPAGSAKIIVEFNVDMDGMLTVSA 488

Query: 227 IEKST 241
            EKST
Sbjct: 489 QEKST 493


>UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: 2-alkenal reductase -
           Alkaliphilus metalliredigens QYMF
          Length = 569

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 35/77 (45%), Positives = 47/77 (61%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SD+Q  V I V++G+      NNLLGKFEL+GIPPA     +I++ F  D NGIL V  +
Sbjct: 413 SDDQEMVEIIVYQGDYEKASLNNLLGKFELSGIPPAKASTEKIKIRFTYDVNGILQVEGM 472

Query: 230 EKSTNKENRSPLPTTKV 280
             ST K+ +  + TT V
Sbjct: 473 IVSTGKQAQITIDTTGV 489


>UniRef50_Q4CVX5 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 165

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 35/51 (68%), Positives = 39/51 (76%)
 Frame = -3

Query: 237 DFSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSSNLPSKLLSLVIARSPS 85
           D S A T R+  +S SKVTSI GTPRGAGG+P SSNLPS+ LS VI RSPS
Sbjct: 115 DLSTALTCRMLFSSTSKVTSICGTPRGAGGMPDSSNLPSRRLSFVICRSPS 165


>UniRef50_Q59U56 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 100

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 40/61 (65%), Positives = 42/61 (68%)
 Frame = -3

Query: 249 SLLVDFSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSSNLPSKLLSLVIARSPSNTWMS 70
           SLLV  S AETL IP  SMSKVTSI GTP GAGGIP    LP  LLS V + SP NT +S
Sbjct: 38  SLLVALSRAETLIIPSVSMSKVTSICGTPFGAGGIPDKVKLPINLLSSVNSLSPWNTSIS 97

Query: 69  T 67
           T
Sbjct: 98  T 98


>UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to heat shock protein - Nasonia vitripennis
          Length = 523

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 34/62 (54%), Positives = 41/62 (66%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I+V+EGE     +N  L KF L  IPP P+G P I VTFD++ NGIL VSA+ 
Sbjct: 438 DNQQKVEIKVYEGEDKNVNNNLFLDKFTLMNIPPGPKGTPTIIVTFDMNNNGILIVSAVI 497

Query: 233 KS 238
           KS
Sbjct: 498 KS 499


>UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 599

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  + ++V+EGER    +NNLLG F+   IPPAPRG   ++V F +D +GILNVSA E
Sbjct: 410 DNQSVISVRVYEGERLKANENNLLGLFDFA-IPPAPRGHIPMKVCFSVDVDGILNVSAKE 468

Query: 233 KST-NKEN 253
            +  NK++
Sbjct: 469 DTCGNKQD 476



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + ITI N+ G LS +EIERM+ EAE ++ ED K
Sbjct: 475 QDITIKNENGSLSTDEIERMIQEAENFKAEDMK 507


>UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5;
           Enterobacteriaceae|Rep: Glutamate dehydrogenase -
           Escherichia coli B
          Length = 678

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 34/73 (46%), Positives = 47/73 (64%)
 Frame = -2

Query: 223 GNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVG 44
           GNV+DTV ID+EG+ +LRHA R R D  Q+E T++ VI    T TL+++D Y  LV+  G
Sbjct: 179 GNVQDTVSIDIEGNFDLRHAARCRVDTIQVELTQRFVISRTFTFTLQHMDGYRRLVVFSG 238

Query: 43  GECLSLFSGDGSV 5
            E L++   D  V
Sbjct: 239 REHLAVLGRDSGV 251


>UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 636

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 31/101 (30%), Positives = 56/101 (55%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q G+ I +F+GE   T+ N  +G F+L+GI  A +GVP+IE+TF ++ NG+L  +A +
Sbjct: 449 DYQTGISINIFQGESEFTEYNEKIGNFKLSGIQKATKGVPEIEITFALNQNGMLTATAFD 508

Query: 233 KSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQK 355
            +T   ++  +         +     L ++   E ++ R+K
Sbjct: 509 LNTKSSSQLAIQIKNKKRLTQEDIDNLRKENEQEEKLDREK 549


>UniRef50_A6SEG2 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 500

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 31/66 (46%), Positives = 42/66 (63%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V   VF+GER   +DN  LG+F L  IPP   G   +EV F++D NGIL V+A 
Sbjct: 323 ADNQQTVQFPVFQGERVNCEDNTSLGEFTLAPIPPMKAGDAVLEVVFEVDVNGILKVTAT 382

Query: 230 EKSTNK 247
           EK++ +
Sbjct: 383 EKTSGR 388



 Score = 36.3 bits (80), Expect = 0.57
 Identities = 15/30 (50%), Positives = 22/30 (73%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNEDD 345
           ITI N  G+LS  EIE+MV +A ++++ DD
Sbjct: 392 ITIANSVGKLSSSEIEKMVADAAEFKSSDD 421


>UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2;
           Pansporablastina|Rep: Mitochondrial-like Hsp70 -
           Trachipleistophora hominis
          Length = 543

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 31/66 (46%), Positives = 42/66 (63%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V++ +++GE    KDN  LGK  L  I  AP+GVP+IEV F+ D NGI  V+A +
Sbjct: 413 DNQEEVIVNIYQGESENVKDNCFLGKIILKDIKKAPKGVPRIEVGFEADVNGIYRVTAKD 472

Query: 233 KSTNKE 250
             T +E
Sbjct: 473 LLTGRE 478


>UniRef50_Q9HHC0 Cluster: Putative glutamate dehydrogenase; n=1;
           Haloferax mediterranei|Rep: Putative glutamate
           dehydrogenase - Halobacterium mediterranei (Haloferax
           mediterranei)
          Length = 959

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 34/73 (46%), Positives = 44/73 (60%)
 Frame = -2

Query: 223 GNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVG 44
           G+V+DTV +DVE D NLR + R R D  + EF E+ V+F H   TL+  D +  LV+  G
Sbjct: 486 GDVDDTVFVDVEADFNLRRSGRCRRDAREREFAEEFVVFSHLAFTLEDADLHRRLVVGRG 545

Query: 43  GECLSLFSGDGSV 5
           GE L L   DG V
Sbjct: 546 GENLRLLGRDGRV 558


>UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_03001788;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03001788 - Ferroplasma acidarmanus fer1
          Length = 565

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 31/63 (49%), Positives = 42/63 (66%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + ++V +GER +  DN +LG F L+GI PAPRG   I+VT+ +D NGIL VSA +
Sbjct: 399 DYQSEIEVKVVQGERPLGTDNIVLGHFTLSGIKPAPRGEVAIDVTYSVDKNGILTVSARD 458

Query: 233 KST 241
             T
Sbjct: 459 NDT 461


>UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1;
           Neorickettsia sennetsu str. Miyayama|Rep: Putative
           chaperone protein HscA - Neorickettsia sennetsu (strain
           Miyayama)
          Length = 593

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 30/65 (46%), Positives = 38/65 (58%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q    I V +GER   +DN  L +F L  +PP P G  +IE+TF +D +GIL VSA E
Sbjct: 407 DGQTSFKIHVLQGEREFARDNRYLAEFTLNNLPPLPMGKARIEITFSVDEDGILKVSATE 466

Query: 233 KSTNK 247
             T K
Sbjct: 467 LLTRK 471


>UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter sp.
           BAL39|Rep: Heat shock protein 70 - Pedobacter sp. BAL39
          Length = 617

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/60 (46%), Positives = 42/60 (70%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + I VF+GER + ++N  L +FEL GIP  P G+P++++ F ++A+GIL V AIE
Sbjct: 430 DGQVNMKISVFQGERDLVQENRKLAEFELRGIPAMPAGLPKVDINFMLNADGILTVQAIE 489


>UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1;
           Theileria sp. China|Rep: Putative heat schock protein 70
           - Theileria sp. China
          Length = 372

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 34/80 (42%), Positives = 45/80 (56%)
 Frame = +1

Query: 7   HYHPH*TDSDIHHLL**PTRSTHPSI*G*ACYDQR*QLAR*IRADRDPTGAAWRASN*GH 186
           H+HPH  + D+HH    P    HP + G A  DQ  Q AR +  +RD   A  R ++ GH
Sbjct: 275 HHHPHQEEPDLHHQRGPPGGRAHPGLRGRARNDQGQQPARQVPPERDRARAQGRPADRGH 334

Query: 187 LRHRCQRYPQRFRYREVHQQ 246
           LRHR QR+PQR  + +V  Q
Sbjct: 335 LRHRRQRHPQRHCHGQVDGQ 354


>UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:
           2-alkenal reductase - Anaeromyxobacter sp. Fw109-5
          Length = 623

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 34/75 (45%), Positives = 44/75 (58%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D+Q  V I V +G      DN LLG+F L GI PA RG   IEVTFDI A+GI+ VSA 
Sbjct: 434 TDDQTSVRIAVLQGGSERAIDNELLGEFVLDGIRPARRGEVSIEVTFDISADGIVGVSAK 493

Query: 230 EKSTNKENRSPLPTT 274
           + +T +     +  T
Sbjct: 494 DVATGQRQSITVTAT 508


>UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2;
           Gammaproteobacteria|Rep: Molecular chaperone HscA -
           Vesicomyosocius okutanii subsp. Calyptogena okutanii
           (strain HA)
          Length = 614

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 42/138 (30%), Positives = 66/138 (47%), Gaps = 4/138 (2%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           + D Q  + I V +GER + +D   L KF+L GIP    G  +I + F +D +G+L+VSA
Sbjct: 424 FKDGQTAMSIHVLQGERELVRDCRSLAKFDLYGIPAMVAGNARIRIEFQVDVDGLLSVSA 483

Query: 227 IEK-STNKENRSPLPT---TKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILL 394
           +E+ S  K N S  P+   T V   +     +L  +   +TR   + +    +    I  
Sbjct: 484 VEQISGVKTNISIKPSYGLTDVQKEKMLKDSFLFAKTDIQTRKLHETQVEANRTIEAIDS 543

Query: 395 ASA*SATMEDEKLKEKIL 448
           A      M D+K+   IL
Sbjct: 544 AIKKDKNMLDDKMLNNIL 561


>UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC15CB UniRef100 entry -
           Rattus norvegicus
          Length = 490

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 39/77 (50%), Positives = 50/77 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPG   QV+E ERA+T DNNLLG F L+ I  AP  VP++EV FDIDA+     + 
Sbjct: 346 YSDNQPG--FQVYEHERAVT-DNNLLGSF-LSDILSAPHAVPRMEVIFDIDAS---VRAE 398

Query: 227 IEKSTNKENRSPLPTTK 277
            + ST K N++ +   K
Sbjct: 399 TDWSTGKANKNTITNDK 415



 Score = 40.3 bits (90), Expect = 0.035
 Identities = 16/25 (64%), Positives = 22/25 (88%)
 Frame = +1

Query: 259 TITNDKGRLSKEEIERMVNEAEKYR 333
           TITNDKG+LS + +ERM+ EAE+Y+
Sbjct: 410 TITNDKGQLSTDRMERMIQEAEQYK 434


>UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 593

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/60 (51%), Positives = 41/60 (68%)
 Frame = +2

Query: 56  NQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEK 235
           NQ  + I V EGER ++ DN  LG+F L  +P AP G  +I+V+F ID NGIL VSA++K
Sbjct: 424 NQTLIKILVLEGERPLSTDNRALGEFVLK-VPKAPIGTVKIDVSFTIDENGILTVSAVDK 482



 Score = 33.1 bits (72), Expect = 5.3
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           ++I I     RL+ EEI+ MV EAE++R  D+K
Sbjct: 488 KEIIIEGQNRRLTNEEIKAMVKEAEEFRAVDEK 520


>UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27;
           Proteobacteria|Rep: Chaperone protein hscA homolog -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 622

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/68 (41%), Positives = 41/68 (60%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           + D Q  + I V +GER +  D   L +FEL GIPP   G  +I VT+ +DA+G+L+V A
Sbjct: 432 FKDGQTAMAIHVVQGERELVSDCRSLARFELRGIPPMTAGAARIRVTYQVDADGLLSVFA 491

Query: 227 IEKSTNKE 250
            E+ +  E
Sbjct: 492 REQHSGVE 499


>UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera
           aphidicola|Rep: Chaperone protein hscA - Buchnera
           aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon
           pisumsymbiotic bacterium)
          Length = 611

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/70 (38%), Positives = 43/70 (61%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y DNQ  +LI + +GER + KD   L +F L  I P   G+ +I VTF +D +G+++V  
Sbjct: 420 YKDNQTSILIHIVQGERELVKDCISLSRFVLRDIKPQKAGLVRILVTFQVDTDGLIHVKI 479

Query: 227 IEKSTNKENR 256
           +E  ++KE +
Sbjct: 480 LENYSSKEKK 489


>UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma
           marginale str. St. Maries|Rep: Heat shock protein -
           Anaplasma marginale (strain St. Maries)
          Length = 602

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 35/114 (30%), Positives = 58/114 (50%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+D Q  + I V +GER M   N  L +F++ G+PP P G  +++V F +D +G+L VS 
Sbjct: 425 YTDGQTAIHIHVCQGEREMADANRSLARFDI-GVPPLPAGEARVKVEFRVDMDGLLVVSV 483

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGI 388
            EKST  E    +   + ++P       L    + +  M  ++ + +  EC  I
Sbjct: 484 REKSTGLEKCVEVNQLEGITPADVERHVLSAVENFDEDMIARELSAERLECARI 537


>UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 603

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 26/59 (44%), Positives = 40/59 (67%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           DNQ      VFEGE   T++NN L  F ++G+P   +G+ + +VTF++D NG+L+VSA+
Sbjct: 436 DNQEIARFSVFEGESQKTEENNYLDGFTISGLPRMKKGLVKFKVTFNVDINGMLSVSAV 494


>UniRef50_Q1NCH4 Cluster: Putative NAD-specific glutamate
           dehydrogenase encoded in antisense gene pair with dnaKJ;
           n=1; Sphingomonas sp. SKA58|Rep: Putative NAD-specific
           glutamate dehydrogenase encoded in antisense gene pair
           with dnaKJ - Sphingomonas sp. SKA58
          Length = 1021

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 27/73 (36%), Positives = 44/73 (60%)
 Frame = -2

Query: 223 GNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVG 44
           G+++  VG++VE D +LRH TRR  +  Q+E  +Q+++  H TL L++ D +  L++  G
Sbjct: 536 GHIDQAVGVNVESDFDLRHTTRRGRNADQVELAQQLIVRRHFTLALEHADRHGLLIVISG 595

Query: 43  GECLSLFSGDGSV 5
              L L  GD  V
Sbjct: 596 RIGLRLLGGDRGV 608


>UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock
           cognate 71 kDa protein (Heat shock 70 kDa protein 8);
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           Heat shock cognate 71 kDa protein (Heat shock 70 kDa
           protein 8) - Canis familiaris
          Length = 393

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 36/86 (41%), Positives = 51/86 (59%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMKC 411
           +V+++ + ITITNDKG LSK++IERMV EAEKY+ ED+K + D    +       F+MK 
Sbjct: 274 QVYEENK-ITITNDKGHLSKKDIERMVQEAEKYKAEDEKQR-DKMSSKNSLESYAFNMKV 331

Query: 412 YHGG*EAQGKDSPEL*QADHSSNKCN 489
                + QGK + E        +KCN
Sbjct: 332 TVDDEKLQGKINDE--DKQKILDKCN 355



 Score = 33.1 bits (72), Expect = 5.3
 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGER-AMTKDNNLLGKFEL 139
           YSDN PGVLIQV+E  +  +T D   L K ++
Sbjct: 264 YSDNYPGVLIQVYEENKITITNDKGHLSKKDI 295


>UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 586

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 28/78 (35%), Positives = 45/78 (57%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V + +++GE  + +DN  +G F + G+  AP G  +I +  ++D NGIL V+A+E
Sbjct: 405 DNQEAVEVNIYQGEEPLAEDNIFIGNFMVQGLSEAPAG-NKIILNLELDINGILKVTAVE 463

Query: 233 KSTNKENRSPLPTTKVVS 286
           K+T       + T  V S
Sbjct: 464 KNTGLSKEVTMDTKDVES 481


>UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14;
           Alphaproteobacteria|Rep: Glutamate dehydrogenase -
           Methylobacterium extorquens PA1
          Length = 728

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 32/72 (44%), Positives = 43/72 (59%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGG 41
           +V+D VG+DVEG L+LRHA  RR +  ++E  EQ+V+  H  LTL+  D    LV+   G
Sbjct: 195 HVDDAVGVDVEGHLDLRHAAGRRRNADEIELAEQLVVCRHLALTLEDPDGDRVLVVLGRG 254

Query: 40  ECLSLFSGDGSV 5
           E L L   D  V
Sbjct: 255 EDLGLLGRDRGV 266


>UniRef50_Q47AH4 Cluster: Molecular chaperone-like protein
           precursor; n=1; Dechloromonas aromatica RCB|Rep:
           Molecular chaperone-like protein precursor -
           Dechloromonas aromatica (strain RCB)
          Length = 148

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/64 (42%), Positives = 41/64 (64%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + + +F G   +TK  N +    + GIPPAPRG+PQ+ VT  ++ NG +++SAI+
Sbjct: 76  DRQTEIKLFIFRGIAEVTKKANKVVAVAVVGIPPAPRGIPQVAVTLSVE-NGQISLSAID 134

Query: 233 KSTN 244
           K TN
Sbjct: 135 KGTN 138


>UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera
           aphidicola str. Cc (Cinara cedri)|Rep: Molecular
           chaperone - Buchnera aphidicola subsp. Cinara cedri
          Length = 499

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/76 (36%), Positives = 45/76 (59%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           + DNQ G  I +++GE   TK+  LL KF++  I P P G  +I+V F ID +G+L++  
Sbjct: 413 FKDNQTGFCINIYQGEDKYTKNCQLLTKFKIKNIIPKPAGKIKIKVIFQIDTDGLLSIII 472

Query: 227 IEKSTNKENRSPLPTT 274
            EK ++  +   + TT
Sbjct: 473 EEKKSDIIHNIKIDTT 488


>UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate
           dehydrogenase encoded in antisense gene pair with dnaKJ;
           n=1; Brucella ovis ATCC 25840|Rep: Putative NAD-specific
           glutamate dehydrogenase encoded in antisense gene pair
           with dnaKJ - Brucella ovis (strain ATCC 25840 / 63/290 /
           NCTC 10512)
          Length = 1124

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/72 (41%), Positives = 42/72 (58%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGG 41
           NV+D VG+DVEG  +LRH  R   +  ++E ++Q+VI  H TL L+  D +  LV+   G
Sbjct: 198 NVDDAVGVDVEGHFDLRHTARCGRNANEVELSKQLVIGCHFTLALEDADRHGRLVVLSRG 257

Query: 40  ECLSLFSGDGSV 5
           E L L   D  V
Sbjct: 258 EGLRLLGRDSGV 269


>UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacifica
           SIR-1|Rep: Chaperone DnaK - Plesiocystis pacifica SIR-1
          Length = 539

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/67 (41%), Positives = 43/67 (64%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V IQV +GE +    N  LG+  L+G+  APRG   + VTF+I+ +G+L V A+
Sbjct: 439 ADNQRFVRIQVCQGESSEFGGNTKLGEVTLSGLRQAPRGSVTVAVTFEINTDGLLEVRAL 498

Query: 230 EKSTNKE 250
           ++ T +E
Sbjct: 499 DQDTGQE 505


>UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;
           Orientia tsutsugamushi Boryong|Rep: Heat shock chaperone
           protein hscA - Orientia tsutsugamushi (strain Boryong)
           (Rickettsia tsutsugamushi)
          Length = 616

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 27/65 (41%), Positives = 38/65 (58%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y++NQ  +   + +GER M  D   L KF L+ +P  P G   +EVTF ID +G+L VS 
Sbjct: 424 YANNQTAINFHIVQGEREMAADCRSLAKFTLSNLPLGPAGSISVEVTFAIDVDGLLFVST 483

Query: 227 IEKST 241
            E+ T
Sbjct: 484 SEQRT 488


>UniRef50_A4J964 Cluster: Heat shock protein 70; n=2;
           Clostridiales|Rep: Heat shock protein 70 -
           Desulfotomaculum reducens MI-1
          Length = 619

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 28/67 (41%), Positives = 40/67 (59%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q    I++++GE    K+N+ LG+F L GIP    G   +EVT+  + NGIL V+A 
Sbjct: 425 ADGQTSASIEIYQGEHGWVKNNHRLGEFLLDGIPANGAGKEAVEVTYRYNLNGILEVTAR 484

Query: 230 EKSTNKE 250
             ST KE
Sbjct: 485 CVSTGKE 491


>UniRef50_A7BPD2 Cluster: Molecular chaperone DnaK; n=1; Beggiatoa
           sp. SS|Rep: Molecular chaperone DnaK - Beggiatoa sp. SS
          Length = 226

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 30/67 (44%), Positives = 43/67 (64%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQ  V ++VF+GE      N  +G+F + G+   P+G P I +  ++D NGIL+VSAI
Sbjct: 51  SDNQEKVDVRVFQGENRDALSNIQIGEFLVEGLSRVPQGNP-ILLKLELDLNGILHVSAI 109

Query: 230 EKSTNKE 250
           EK+T  E
Sbjct: 110 EKNTGFE 116


>UniRef50_Q6RV34 Cluster: HSP70; n=2; Chironomus|Rep: HSP70 -
           Chironomus duplex
          Length = 108

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 25/33 (75%), Positives = 30/33 (90%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           E ITI NDKGRLSK EI+RM++EAEKYR+ED+K
Sbjct: 8   ETITIKNDKGRLSKAEIDRMLSEAEKYRDEDEK 40


>UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena
            thermophila SB210|Rep: dnaK protein - Tetrahymena
            thermophila SB210
          Length = 1213

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 2/69 (2%)
 Frame = +2

Query: 53   DNQPGVL-IQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDID-ANGILNVSA 226
            DNQ   L +++F+GER +TKDN  + + EL  IP   +G  ++E+T  I+   G++N++A
Sbjct: 1026 DNQQQKLRLKIFQGERLLTKDNFFIDELELK-IPQIQQGKIEVEITAQIEWMGGLVNITA 1084

Query: 227  IEKSTNKEN 253
            +EKSTN  N
Sbjct: 1085 VEKSTNVMN 1093



 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +2

Query: 53  DNQPGVL-IQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           DNQ   L ++ F+GER +TKDN  + + EL  IP   +G  ++E+T  +  +G + V+A+
Sbjct: 447 DNQQQKLRLKFFQGERLLTKDNFFIDELELK-IPQIQQGKIEVEITAQMICDGTVQVTAV 505

Query: 230 EKSTNKEN 253
           EKSTN  N
Sbjct: 506 EKSTNVMN 513


>UniRef50_A7CRR2 Cluster: Glutamate dehydrogenase; n=1; Opitutaceae
           bacterium TAV2|Rep: Glutamate dehydrogenase -
           Opitutaceae bacterium TAV2
          Length = 705

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -2

Query: 223 GNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSG-LVIRV 47
           G+VED VG+DV+GD +LR A     D  + E  E +V+  H  L L   D+++G L++  
Sbjct: 217 GDVEDAVGVDVKGDFDLRSAAGGGRDAVEFEGAEHLVVARHGALALGD-DDFNGRLIVGG 275

Query: 46  GGECLSLFSGDGSV 5
           GG+ L LF  DG V
Sbjct: 276 GGKTLGLFVRDGGV 289


>UniRef50_Q670L1 Cluster: Heat shock cognate protein 71; n=12;
           Fungi/Metazoa group|Rep: Heat shock cognate protein 71 -
           Felis silvestris catus (Cat)
          Length = 52

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNL 121
           YSDNQPGVLIQV+EGERAMTKDNNL
Sbjct: 27  YSDNQPGVLIQVYEGERAMTKDNNL 51


>UniRef50_Q9S9I7 Cluster: Heat shock protein 70 homolog; n=1; Zea
           mays|Rep: Heat shock protein 70 homolog - Zea mays
           (Maize)
          Length = 121

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/35 (68%), Positives = 31/35 (88%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           Q  +ITITNDKGRLSKEEIE+++ EAEKY+ ED++
Sbjct: 28  QKNKITITNDKGRLSKEEIEKILQEAEKYKAEDEE 62



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/38 (52%), Positives = 27/38 (71%)
 Frame = +2

Query: 164 GVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTK 277
           G  QI V FD+DANGILNVSA +K+T ++N+  +   K
Sbjct: 1   GASQITVCFDMDANGILNVSAEDKTTGQKNKITITNDK 38


>UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31366-PA - Tribolium castaneum
          Length = 614

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           + Q  + I ++EGER   + N  LG  ++T + PAP G  ++ V   +D NGIL   A E
Sbjct: 434 NQQSAMSINIYEGERTDVRKNRHLGTLKITNLTPAPPGQCEVHVIMSVDQNGILTFRAKE 493

Query: 233 KSTNKENRSPLPTTK 277
           K  N E    L  T+
Sbjct: 494 KFRNNEKDLKLLYTR 508


>UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: Similarity to
           HSP70-RELATED PROTEIN - Encephalitozoon cuniculi
          Length = 687

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 30/69 (43%), Positives = 39/69 (56%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I+V +G     KDN  +G  EL      PRGVP+I VT +ID +G + V A++
Sbjct: 502 DNQTKVRIRVAQGGLESFKDNIYIGDIELDLPGNQPRGVPRIAVTLEIDTHGKIYVKAVD 561

Query: 233 KSTNKENRS 259
              NKE  S
Sbjct: 562 LQNNKEASS 570


>UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4;
           Planctomycetaceae|Rep: Chaperone protein HscC -
           Rhodopirellula baltica
          Length = 587

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/57 (43%), Positives = 34/57 (59%)
 Frame = +2

Query: 56  NQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           NQ  V ++VF+G+     DN  LG+ E+ G+PP P G P I V F  D +G+L V A
Sbjct: 426 NQTNVTLRVFQGDARKVADNTALGQLEVKGLPPGPAGSP-IYVRFTYDLSGVLEVEA 481


>UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n=2;
           Cystobacterineae|Rep: Heat shock protein 70 family
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 535

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/78 (33%), Positives = 47/78 (60%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  V I+V++GE     +  +LG+FE  G     RG  +IEVTF+I+ +G+++VSA +
Sbjct: 429 DGQEKVKIRVYQGESNRADECEMLGEFEFAGFRIGYRGEVKIEVTFEINTDGLVHVSACD 488

Query: 233 KSTNKENRSPLPTTKVVS 286
            +T ++  + +  +  +S
Sbjct: 489 TATGQKTSTSITLSSGMS 506


>UniRef50_Q1CY00 Cluster: DnaK family protein; n=2;
            Cystobacterineae|Rep: DnaK family protein - Myxococcus
            xanthus (strain DK 1622)
          Length = 1146

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +2

Query: 53   DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
            DN+  + + +F+GE +    N  LG   + G+P  P+G  ++ VT  +D+  +L+V A E
Sbjct: 1027 DNEVFLELSIFQGEDSHISANEYLGTVRIEGLPKGPKGSVRVAVTLKLDSECVLHVEARE 1086

Query: 233  KSTNKENRSPLPT 271
             ST KE ++ L T
Sbjct: 1087 YSTRKEVKATLAT 1099


>UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 759

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 27/82 (32%), Positives = 44/82 (53%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q    + VF+GE     +   LG   L G+PP PRG+ +I V F++ A  +L V+A E
Sbjct: 615 DGQTEFELAVFQGESGAAAECEYLGTLRLEGLPPGPRGMVKIAVGFELGAECLLTVTARE 674

Query: 233 KSTNKENRSPLPTTKVVSPRKR 298
            +T +E R+ +   +  +  +R
Sbjct: 675 LNTGREVRAVMSAREGAAAARR 696


>UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodospira
           halophila SL1|Rep: Heat shock protein 70 -
           Halorhodospira halophila (strain DSM 244 / SL1)
           (Ectothiorhodospirahalophila (strain DSM 244 / SL1))
          Length = 577

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 30/91 (32%), Positives = 47/91 (51%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + ++VF+GE     +N  +G F + G+   P G   I  TF +D NGIL+VS++E
Sbjct: 410 DGQEAIDVRVFQGEDPDALNNTQIGSFRIEGLSDVPAG-NVIITTFSLDVNGILHVSSVE 468

Query: 233 KSTNKENRSPLPTTKVVSPRKRSSVWLMRQR 325
           K T K  R  +      +  +R  +   R+R
Sbjct: 469 KLTGK--RKEITIDSATARFEREEMGAARER 497


>UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Conserved
           region 2266 - Anaeromyxobacter dehalogenans (strain
           2CP-C)
          Length = 782

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q    + V +GE A   D   LG   L G+PP PRG+ +I VTF++ A  +L V+A E
Sbjct: 649 DGQTEFELVVLQGEGAHADDCEYLGTLRLEGLPPGPRGMVKIAVTFELGAECLLTVTARE 708

Query: 233 KSTNKENRSPLPTTK-VVSPRKR 298
            +T ++ ++ +   +   S R+R
Sbjct: 709 LNTGRKVQAVMSAREGAASARRR 731


>UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;
           delta proteobacterium MLMS-1|Rep: Glutamate
           dehydrogenase precursor - delta proteobacterium MLMS-1
          Length = 656

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGG 41
           +VED VG+ +EG L+L ++T  R    Q+E  + +VI GH  LTL++++    LV+    
Sbjct: 165 DVEDPVGVQIEGYLDLGYSTGGRRQVRQIEPADGLVIGGHLPLTLEHVNGDRRLVVGRRR 224

Query: 40  ECLSLFSGDGSV 5
           E L+L SGDG V
Sbjct: 225 ENLTLLSGDGGV 236


>UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1;
           Methanospirillum hungatei JF-1|Rep: Heat shock protein
           70 - Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 571

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI-DANGILNVSAI 229
           D  P V+I V++GE  M +DN  LG+F ++ + P P    +IEVTF + +  GILNV A 
Sbjct: 403 DYVPEVIIAVYQGEEEMAEDNEYLGQFYIS-VEPMPAEENKIEVTFAVGEEFGILNVRAY 461

Query: 230 EKSTNKENRSPLPTTKVVSPRKRSSVWLMR 319
           +  +  E      +   +S +K  S W+ +
Sbjct: 462 DTDSGNERTVKFESRSRLS-KKEKSKWMKK 490


>UniRef50_Q43372 Cluster: Heat shock protein 70 homologue; n=2;
           Magnoliophyta|Rep: Heat shock protein 70 homologue -
           Allium cepa (Onion)
          Length = 131

 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 23/32 (71%), Positives = 29/32 (90%)
 Frame = +1

Query: 259 TITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           TITN KGRLSKE+IE+MV EAEKY++ED++ K
Sbjct: 1   TITNXKGRLSKEDIEKMVQEAEKYKSEDEEHK 32


>UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26;
           Bacteria|Rep: Chaperone protein hscC - Bacillus
           anthracis
          Length = 566

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 25/69 (36%), Positives = 39/69 (56%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + I V++GE     +N  LG+ ++  IPPAP G   +++ +  D NGIL V  I 
Sbjct: 404 DKQQFITIDVYQGENRRVVNNLKLGELKIK-IPPAPAGNESVDIRYTYDINGILEVEVIS 462

Query: 233 KSTNKENRS 259
            ST ++ R+
Sbjct: 463 TSTGEKKRT 471


>UniRef50_UPI0000588703 Cluster: PREDICTED: similar to heat shock
           protein protein; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 154

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 20/34 (58%), Positives = 30/34 (88%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDD 345
           +  +ITITND GR+SKE+I+RM+N+AE+++ EDD
Sbjct: 12  RSNKITITNDSGRISKEDIDRMINDAERFKAEDD 45


>UniRef50_A0C707 Cluster: Chromosome undetermined scaffold_153,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_153,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 224

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 26/68 (38%), Positives = 43/68 (63%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  + I+++ G R +TKD   L +F LTGI PA +GVP+I +T +ID++  L ++A 
Sbjct: 23  NDYQSEIQIKIYLGYRYLTKDCLFLEQFNLTGIFPALKGVPEILITSEIDSDYTLTMTAQ 82

Query: 230 EKSTNKEN 253
           +  +   N
Sbjct: 83  DLCSKNSN 90


>UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 607

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + + V+EGER +   N  LG+  L  I P  RG   +++T ++D NGIL  +A++
Sbjct: 429 DFQTSINVPVYEGERVLCSHNRQLGEISLP-IQPKRRGESVVDITLEVDYNGILQATALD 487

Query: 233 KSTNK 247
            +T K
Sbjct: 488 LNTKK 492


>UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermophila
            SB210|Rep: DnaK protein - Tetrahymena thermophila SB210
          Length = 969

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 26/69 (37%), Positives = 37/69 (53%)
 Frame = +2

Query: 53   DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
            DNQ  V I++  G       N LL K  LT I P P+GVP+I++T  I    IL V+  +
Sbjct: 874  DNQTSVSIKIILGVNPQANQNKLLYKINLTDIKPLPKGVPEIKITLTIKDKDILVVNVKD 933

Query: 233  KSTNKENRS 259
             ++ KE  +
Sbjct: 934  MNSLKEQEA 942


>UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia
           burgdorferi group|Rep: Heat shock protein 70 - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 491

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 24/68 (35%), Positives = 39/68 (57%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  + I + +GE      N  +G+F    I  A +G+P+IEV F ++ +GIL+V+A 
Sbjct: 397 NDYQDEIEIHILQGEYKKASLNYSIGRFSFGNIQKALKGIPKIEVLFTLNESGILSVNAK 456

Query: 230 EKSTNKEN 253
           +  TN  N
Sbjct: 457 DLETNSSN 464


>UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus
           weihenstephanensis KBAB4|Rep: Heat shock protein Hsp70 -
           Bacillus weihenstephanensis KBAB4
          Length = 578

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFE--LTGIPPAPRGVPQIEVTFDIDANGILNVS 223
           +D Q  V+IQV++GE     +N  L K +  L GIP    G  +IE+ F  D NGIL V 
Sbjct: 417 NDYQDQVIIQVYQGENEKVVENTKLNKDDIILDGIPKHLAGHEEIEIQFTYDINGILQVE 476

Query: 224 AIEKSTNKE 250
           A   ST K+
Sbjct: 477 ATIVSTGKK 485


>UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Molecular chaperone DnaK - Syntrophomonas wolfei subsp.
           wolfei (strain Goettingen)
          Length = 498

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 4/71 (5%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNN----LLGKFELTGIPPAPRGVPQIEVTFDIDANGILNV 220
           D Q  V+I + + +     D +     LGKF L+GI  A  G   I+VTF ID NGIL+V
Sbjct: 402 DKQEEVIIHILQRDEMSDVDGSEDYISLGKFHLSGIRKAAVGEANIDVTFAIDRNGILHV 461

Query: 221 SAIEKSTNKEN 253
           SA++  T  +N
Sbjct: 462 SAMDIDTGIQN 472


>UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 509

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 19/69 (27%), Positives = 42/69 (60%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + +++ +G+   + +N LLG+F  +G+ P   G  ++E+ F+++  GIL +SA +
Sbjct: 434 DGQSQLAMRIHQGDHPFSVENELLGEFTFSGVRPGRAGDVRLEILFEVNVEGILTMSARD 493

Query: 233 KSTNKENRS 259
             T ++ ++
Sbjct: 494 LDTGRQMKT 502


>UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG07033;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07033 - Caenorhabditis
           briggsae
          Length = 547

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           D Q  + + V+EGER +   N  LG+  L  I P  RG   +++T ++D NGIL  +A++
Sbjct: 362 DFQTLINVPVYEGERVLCSHNRQLGEISLP-IHPKKRGESVVDITLEVDHNGILQATALD 420

Query: 233 KSTNK 247
            +T K
Sbjct: 421 LNTKK 425


>UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 623

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 6/69 (8%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAP------RGVPQIEVTFDIDANG 208
           Y   Q  V I VF+GE +  KDN L G+  LTGIPPA       R  P I+VT  +D  G
Sbjct: 435 YLGRQTAVAINVFQGEGSTAKDNTLFGRLVLTGIPPASVWNWGWRWRP-IQVTVKVDELG 493

Query: 209 ILNVSAIEK 235
            ++V A +K
Sbjct: 494 DIHVEATDK 502


>UniRef50_Q54BE1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 94

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 21/40 (52%), Positives = 29/40 (72%)
 Frame = +2

Query: 158 PRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTK 277
           PRG PQIEV FD+D+NGILNV+A +K++ K  +  +   K
Sbjct: 7   PRGTPQIEVMFDVDSNGILNVAAEDKTSKKVEKITITNDK 46



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 18/33 (54%), Positives = 27/33 (81%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           E+ITITNDKGR S ++I +MV +AEK++ +D +
Sbjct: 38  EKITITNDKGRPSLKDINKMVEDAEKFKEQDQQ 70


>UniRef50_UPI0000DA3FE5 Cluster: PREDICTED: similar to heat shock
           protein 8; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to heat shock protein 8 - Rattus norvegicus
          Length = 105

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/61 (42%), Positives = 37/61 (60%)
 Frame = +1

Query: 226 YREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSM 405
           Y +   +  +IT+TNDK  LSKE+IE MV EA+KY+ ED+K + D    +       F+M
Sbjct: 38  YEKSTGKENKITVTNDKVHLSKEDIEGMVQEAKKYKAEDEKQR-DKVSSKNSVESCAFNM 96

Query: 406 K 408
           K
Sbjct: 97  K 97



 Score = 33.9 bits (74), Expect = 3.1
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 4/104 (3%)
 Frame = +2

Query: 134 ELTGIPPAPRGVPQIEVTFD-IDANGILNVS---AIEKSTNKENRSPLPTTKVVSPRKRS 301
           ELT  PP P+    ++  F+  + N  +N     A EKST KEN+  +   KV   ++  
Sbjct: 3   ELTSTPPFPKIQKLLQDFFNGKELNKSINPDEAVAYEKSTGKENKITVTNDKVHLSKEDI 62

Query: 302 SVWLMRQRSTETRMTRQKETIQGQECIGILLASA*SATMEDEKL 433
              +   +  +    +Q++ +  +  +     +   AT+EDEKL
Sbjct: 63  EGMVQEAKKYKAEDEKQRDKVSSKNSVESCAFNM-KATVEDEKL 105


>UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter
           usitatus Ellin6076|Rep: Heat shock protein 70 -
           Solibacter usitatus (strain Ellin6076)
          Length = 619

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 31/113 (27%), Positives = 57/113 (50%), Gaps = 3/113 (2%)
 Frame = +2

Query: 47  YSDNQPG---VLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILN 217
           Y  + PG   V IQ+F+G+     +N L+G F++ G+     G+ ++     +D  GIL+
Sbjct: 406 YYTSHPGQTVVEIQIFQGDDEDALNNLLVGDFKVEGLTWT-EGLNEVLCRMSLDVEGILH 464

Query: 218 VSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQE 376
           VSAIEK T K  +  +     +  +  + +   R+R  E   TR+   ++ ++
Sbjct: 465 VSAIEKRTGKSKQ--ITIAGALQAKSDAEIAAARRRVEELFQTREDSMLEDED 515


>UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera
           aphidicola (Baizongia pistaciae)|Rep: Chaperone protein
           hscA - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 511

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 26/65 (40%), Positives = 35/65 (53%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           + D Q  +LI V +GE  +      L +F L  IP  P G   + V F ID NG+L+V+A
Sbjct: 428 FKDKQTTMLIHVLQGEHKLVNKCQSLCRFVLKEIPKKPAGKIIVLVNFQIDVNGLLSVTA 487

Query: 227 IEKST 241
             KST
Sbjct: 488 EIKST 492


>UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomonas
           putida W619|Rep: Glutamate dehydrogenase - Pseudomonas
           putida W619
          Length = 710

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/72 (34%), Positives = 43/72 (59%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGG 41
           +V+D VG++VEG  +LR+ TR   D  Q+E  +++V+     LTL++++ +  LV+    
Sbjct: 219 DVQDAVGVNVEGHFDLRNTTRCWRDVSQVELAQRLVLRSLLALTLQHVNGHCALVVVGSR 278

Query: 40  ECLSLFSGDGSV 5
           E L L   +G V
Sbjct: 279 EHLRLLGRNGGV 290


>UniRef50_A0UQH1 Cluster: Glutamate dehydrogenase; n=14;
           Proteobacteria|Rep: Glutamate dehydrogenase -
           Burkholderia multivorans ATCC 17616
          Length = 1240

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 23/56 (41%), Positives = 33/56 (58%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVI 53
           +V+D V +DVEG  +LRHA R   D  ++E  EQ+V   H    L +LD +  LV+
Sbjct: 708 DVQDAVRVDVEGHFDLRHAARCGRDAFEVELAEQLVAGRHFAFALIHLDRHGRLVV 763


>UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella
           natans|Rep: Chaperone HSP70 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 610

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 25/69 (36%), Positives = 42/69 (60%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           S+ Q   L++ + G RA+TKD + LG+F +  + P  R   ++ V  DIDA+G+L VSA+
Sbjct: 417 SEFQEATLLKWWRG-RALTKDCHELGQFTIN-VTPQARKDSKVMVVLDIDADGLLEVSAM 474

Query: 230 EKSTNKENR 256
           +  +   N+
Sbjct: 475 DMKSKNSNK 483


>UniRef50_A5AXV7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 321

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 21/32 (65%), Positives = 27/32 (84%)
 Frame = +2

Query: 161 RGVPQIEVTFDIDANGILNVSAIEKSTNKENR 256
           R +PQIEVTFDI+ANGI+ VSA +K+T KE +
Sbjct: 221 RDMPQIEVTFDINANGIVTVSAKDKATAKEQQ 252


>UniRef50_A2YD08 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 148

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 28/85 (32%), Positives = 45/85 (52%)
 Frame = +1

Query: 88  G*ACYDQR*QLAR*IRADRDPTGAAWRASN*GHLRHRCQRYPQRFRYREVHQQGEQITIT 267
           G A +D+    A  +R  R   G    A++ G LRH  +R+PQR  + + H+Q  +    
Sbjct: 61  GRAKHDEGQPAAWQVRLHRHRVGVERAAADRGDLRHGRERHPQRVGHGQGHRQVGEDHYL 120

Query: 268 NDKGRLSKEEIERMVNEAEKYRNED 342
             +     EEI+RMV++AE++  ED
Sbjct: 121 RRQPTPEPEEIDRMVSKAEEFAEED 145


>UniRef50_Q2INJ2 Cluster: Putative NAD-specific glutamate
           dehydrogenase; n=1; Anaeromyxobacter dehalogenans
           2CP-C|Rep: Putative NAD-specific glutamate dehydrogenase
           - Anaeromyxobacter dehalogenans (strain 2CP-C)
          Length = 655

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = -2

Query: 220 NVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGG 41
           +++D V +   GDL+ R A R   D  Q E  ++  + G   L L ++D ++GL + VGG
Sbjct: 159 DLQDAVRVHGVGDLHPRDAGRHGRDALQREAGQRAAVAGQLALALHHVDHHAGLAVGVGG 218

Query: 40  ECLSLFSGDGSV 5
           E L     DG V
Sbjct: 219 ELLRGRGRDGGV 230


>UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock
           protein 8; n=2; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 8 - Canis familiaris
          Length = 476

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/25 (76%), Positives = 23/25 (92%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNL 121
           YSDNQPGVLIQ ++GE A+TKD+NL
Sbjct: 359 YSDNQPGVLIQDYDGEGAITKDDNL 383


>UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 527

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPP-APRGVPQIEVTFDIDANGILNVSA 226
           S+NQ  + + + EGE +     + +G F +  +P   P+G P +EVT+  DANG ++ SA
Sbjct: 432 SENQQRIHVIILEGEASDPDACSTIGDFRILNLPANLPKGSP-VEVTYRYDANGRIHASA 490

Query: 227 IEKSTNKENRSPL 265
            E + N E+ + +
Sbjct: 491 RELTGNNESATEI 503


>UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 605

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 6/88 (6%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA-- 226
           D Q  + I ++EGE+ +  +N  LG FE+    P P+  P + V F ID++G+  V A  
Sbjct: 445 DGQKTLSIDIYEGEKDICPENLKLGNFEIQIDKPQPKKTP-VNVRFIIDSSGLFTVEAKI 503

Query: 227 ----IEKSTNKENRSPLPTTKVVSPRKR 298
               IEK+   E++    T +V+   K+
Sbjct: 504 EGLGIEKTLIVEDKKRKRTKEVIQSLKQ 531


>UniRef50_Q07658 Cluster: Putative uncharacterized protein YDL228C;
           n=2; Saccharomycetaceae|Rep: Putative uncharacterized
           protein YDL228C - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 213

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 26/76 (34%), Positives = 38/76 (50%)
 Frame = -2

Query: 229 DSGNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIR 50
           D  N++DTV I+ E        +   WD  Q+EFT+Q V F  +T TL   +   GLV+ 
Sbjct: 124 DGSNLQDTVSINFEDSFQDWFTSWHHWDVLQVEFTQQSVFFTVNTFTLVDWELNGGLVVS 183

Query: 49  VGGECLSLFSGDGSVT 2
              +  SL   + SV+
Sbjct: 184 TCSKGSSLDGWNSSVS 199


>UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshimeri
           serovar 6b str. SLCC5334|Rep: Complete genome - Listeria
           welshimeri serovar 6b (strain ATCC 35897 / DSM 20650
           /SLCC5334)
          Length = 561

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SD Q  + + +++GE  M KDN  LG   +   P +  G P I++ F  D NGIL V   
Sbjct: 398 SDLQSYIEVGIYQGESRMVKDNLKLGNLTIEMPPNSKAGFP-IDIRFTYDKNGILEVIVK 456

Query: 230 EKSTNKENR 256
             +T +E +
Sbjct: 457 IPATGEEKQ 465


>UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: 70 kD heat
           shock protein - Saccharopolyspora erythraea (strain NRRL
           23338)
          Length = 538

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 29/75 (38%), Positives = 39/75 (52%), Gaps = 4/75 (5%)
 Frame = +2

Query: 53  DNQPGVLIQVFEG----ERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNV 220
           DNQ    I+V+E     E     DN  +G+  L GIPP P G  +IE+TF +   G L V
Sbjct: 441 DNQRMAEIEVWEQKGQEESEDLADNTRVGRGVLKGIPPRPAGT-RIEITFRMSGTGTLAV 499

Query: 221 SAIEKSTNKENRSPL 265
            A E+ + +E R  L
Sbjct: 500 HAQEQESGQEVRFEL 514


>UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 545

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 6/73 (8%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEG------ERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGI 211
           +DNQ  +L+++ EG      +     D N++ +  +  IPP+P+G P IEV +  +  GI
Sbjct: 444 TDNQTSILLRIMEGGIMGENDTCDPLDCNMIAQGSIRDIPPSPKGSP-IEVAYKYNDIGI 502

Query: 212 LNVSAIEKSTNKE 250
           L V  I   + KE
Sbjct: 503 LEVHGIHLPSGKE 515


>UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK6 - Clostridium kluyveri DSM 555
          Length = 490

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DN+  + I++++GE    + N  +G   + G+  +P+G   I VTF I+ +  + V   +
Sbjct: 420 DNEREISIEIYQGEHKECQHNKKIGVINVLGLKESPKGTLNIPVTFYINKDQTIKVIVEQ 479

Query: 233 KSTN 244
           K +N
Sbjct: 480 KESN 483


>UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2;
           Actinomycetales|Rep: Heat shock protein HSP70 -
           Saccharopolyspora erythraea (strain NRRL 23338)
          Length = 555

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 6/71 (8%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMT----KDNNLL--GKFELTGIPPAPRGVPQIEVTFDIDANGIL 214
           + Q GV I++FE    +      +N  L  GK  + G+PP P G P +++   +DA G+L
Sbjct: 456 EGQQGVEIELFEQSGVVAGPELAENKALNEGKGLIDGLPPMPVGSP-VDIRMTVDAEGLL 514

Query: 215 NVSAIEKSTNK 247
            ++A E ST K
Sbjct: 515 ELNATEPSTGK 525


>UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 708

 Score = 41.1 bits (92), Expect = 0.020
 Identities = 16/59 (27%), Positives = 33/59 (55%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           D+Q  V   +F+GE  +   N+ +G + +TGIP    G   I++   +D +G+ +++ +
Sbjct: 535 DDQDTVDACIFQGESPVASQNSYIGTYRITGIPKKKAGEVMIKIILSLDRSGVFSLTPL 593


>UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3;
           Actinomycetales|Rep: Heat shock protein Hsp70 - Frankia
           sp. EAN1pec
          Length = 586

 Score = 40.7 bits (91), Expect = 0.027
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 4/105 (3%)
 Frame = +2

Query: 53  DNQPGVLIQVFEG----ERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNV 220
           D+Q  V + V E     E     DN ++ + E+TGIPP      QIE+ F +  +GIL V
Sbjct: 435 DDQDTVTVYVVEQAGGVESPRVGDNKVIAEAEITGIPPGYPAGTQIEIMFRMGFDGILEV 494

Query: 221 SAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQK 355
           +A  +        PL T +V +    S   + R+R    R  R++
Sbjct: 495 TARHEGLADR---PL-TVRVETSAALSQADVAREREQVARARRER 535


>UniRef50_A1XM69 Cluster: Heat shock protein Hsp70-8; n=1;
           Blastocladiella emersonii|Rep: Heat shock protein
           Hsp70-8 - Blastocladiella emersonii (Aquatic fungus)
          Length = 144

 Score = 40.3 bits (90), Expect = 0.035
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +   ITI  DK RLS +EIERM+ EA+++  +D   K
Sbjct: 5   KSNSITINKDKSRLSADEIERMIQEAKEFEEQDKLVK 41


>UniRef50_A7KK88 Cluster: Heat shock protein; n=8; Melampsora
           medusae f. sp. deltoidis|Rep: Heat shock protein -
           Melampsora medusae f. sp. deltoidis
          Length = 153

 Score = 39.9 bits (89), Expect = 0.047
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKA 351
           +T  + +GRLS   IERMVN+AEKY++ED+ A
Sbjct: 9   LTSFSFQGRLSXXXIERMVNDAEKYKSEDEAA 40


>UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 39.5 bits (88), Expect = 0.062
 Identities = 19/63 (30%), Positives = 32/63 (50%)
 Frame = +2

Query: 59  QPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKS 238
           +P + + V+EG +       L+ K     IP  P+ +    + F ID NGILNV+ ++  
Sbjct: 472 EPCIRMDVYEGGKEANSPKTLVSKIN---IPNVPKDLTSFSMKFIIDHNGILNVAVLDSD 528

Query: 239 TNK 247
            N+
Sbjct: 529 NNE 531


>UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas sp.
           MWYL1|Rep: 2-alkenal reductase - Marinomonas sp. MWYL1
          Length = 552

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 19/67 (28%), Positives = 38/67 (56%)
 Frame = +2

Query: 59  QPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKS 238
           Q  VLI++++GE  + KDN  +G  E+  + P  + + ++ +T+  D NG++ V      
Sbjct: 400 QEKVLIKIYQGENYLPKDNVYMGDLEI-DLEPLNQ-IQELYLTYTYDLNGVIEVEVTNVI 457

Query: 239 TNKENRS 259
           + K+ R+
Sbjct: 458 SGKKYRT 464


>UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_13599_12049 - Giardia lamblia
           ATCC 50803
          Length = 516

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 26/61 (42%), Positives = 33/61 (54%)
 Frame = -2

Query: 214 EDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGEC 35
           E+ VG DV GD  L  AT R  +  ++E TEQVV+     L L+  D    LV+ VG E 
Sbjct: 16  ENAVGGDVVGDFYLWCATGRGGNAAEVERTEQVVVLRERPLALEDPDCNGCLVVGVGREG 75

Query: 34  L 32
           L
Sbjct: 76  L 76


>UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031574 - Anopheles gambiae
           str. PEST
          Length = 503

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 17/48 (35%), Positives = 31/48 (64%)
 Frame = +2

Query: 77  QVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNV 220
           +++EGE A+  DN  LG+ +L G      G+  + ++F++D NG+L+V
Sbjct: 417 RLYEGESAIVSDNITLGRLQLEG--SFGEGLEDVGLSFNVDLNGVLHV 462


>UniRef50_A4R0D3 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 279

 Score = 37.9 bits (84), Expect = 0.19
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 6/91 (6%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMKC 411
           E  ++ E+     D+    K+E  +   E E+ + E+D+   D+   +  W +  F+ KC
Sbjct: 108 EDQKKKEEERKKKDEEERKKDEERKKKEEEERKKKEEDEKNKDNKDNKGDWKIKNFNRKC 167

Query: 412 YHGG---*EAQGKDSP---EL*QADHSSNKC 486
            +GG    E++ KD     E+ Q   S++KC
Sbjct: 168 TNGGNGNDESKDKDCTIRFEIEQPGKSTSKC 198


>UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena CCY
           9414|Rep: DnaK protein - Nodularia spumigena CCY 9414
          Length = 578

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 11/99 (11%)
 Frame = +2

Query: 71  LIQVFEGERAMTKDNNLLG-KFELTGIPPAPRGVP-QIEVTFDIDANGILNVSA----IE 232
           L Q   G+  +  D    G   E+T IPPAP G P  IE+ F  D NG+  ++A    I 
Sbjct: 422 LYQDHTGKARLPGDTQYTGISGEITDIPPAPNGNPYPIEIEFSYDINGMAKLTASIPDIR 481

Query: 233 KST-----NKENRSPLPTTKVVSPRKRSSVWLMRQRSTE 334
           +S      +  NR     T+ VS  +  S+W   +R+ +
Sbjct: 482 RSIEFAFGHSNNRMSQQETR-VSTERIESLWKRHERAKQ 519


>UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 557

 Score = 36.7 bits (81), Expect = 0.43
 Identities = 18/73 (24%), Positives = 37/73 (50%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DN   + I ++EG  ++   N+L+ +   + +         IE+TF+ D +G L +S I+
Sbjct: 435 DNVENIKISLYEGNYSVASMNDLIDEIIFSNLAKVSIDDAYIEMTFECDKSGSLKISVID 494

Query: 233 KSTNKENRSPLPT 271
            + + E +  + T
Sbjct: 495 FNNDVEQQVQIRT 507


>UniRef50_Q4XH99 Cluster: Putative uncharacterized protein; n=2;
           Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 141

 Score = 36.7 bits (81), Expect = 0.43
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +QITI +  G LSKEEIE+MV EAE  R +D   K
Sbjct: 10  QQITIQSSGG-LSKEEIEKMVQEAELNREKDQHKK 43


>UniRef50_A3BBU6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 317

 Score = 36.3 bits (80), Expect = 0.57
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 1/40 (2%)
 Frame = -3

Query: 255 LFS-LLVDFSIAETLRIPLASMSKVTSI*GTPRGAGGIPV 139
           +FS L V  S A TLR+   SMSKVTSI G+P  A  +PV
Sbjct: 66  IFSDLPVALSAAYTLRMSFTSMSKVTSICGSPLNANTMPV 105


>UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock
           protein 2; n=1; Pan troglodytes|Rep: PREDICTED: similar
           to heat shock protein 2 - Pan troglodytes
          Length = 640

 Score = 35.9 bits (79), Expect = 0.76
 Identities = 21/56 (37%), Positives = 27/56 (48%)
 Frame = +3

Query: 15  SPLNRLRHSPPTLITNPEYSSKYLRVSVL*PKITTCSVNSS*PGSHRRRVACLKLR 182
           SP +R R SPPT  T   Y  +Y R +   P+  TC  +S+ PG   R     K R
Sbjct: 423 SPPSRRRPSPPTRTTRAAYWCRYTRANGPXPRTITCWASSTXPGFPLRLAGSPKSR 478



 Score = 32.3 bits (70), Expect = 9.3
 Identities = 18/69 (26%), Positives = 30/69 (43%)
 Frame = +2

Query: 143 GIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQ 322
           G P    G P+  +   +     L +    ++  ++ +SP P TKVV  R   + W  R+
Sbjct: 466 GFPLRLAGSPKSRLPSTLTPMASLTLPPPTRAPVRKTKSPSPMTKVVXARTTLTGWCRRR 525

Query: 323 RSTETRMTR 349
             T  +M R
Sbjct: 526 SGTNRKMRR 534


>UniRef50_Q86ZP0 Cluster: Ribosome-associated Hsp70-like protein 3;
           n=2; Rhizopus stolonifer|Rep: Ribosome-associated
           Hsp70-like protein 3 - Rhizopus stolonifer (Rhizopus
           nigricans)
          Length = 141

 Score = 35.5 bits (78), Expect = 1.0
 Identities = 14/27 (51%), Positives = 22/27 (81%)
 Frame = +2

Query: 170 PQIEVTFDIDANGILNVSAIEKSTNKE 250
           P++  TFD+DANGIL V+A +K+T ++
Sbjct: 1   PELLCTFDLDANGILKVTAQDKTTGRK 27


>UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein;
           n=1; Dictyostelium discoideum AX4|Rep: Heat shock
           protein Hsp70 family protein - Dictyostelium discoideum
           AX4
          Length = 517

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           S+NQ  + + V++G   + KDN L+ +F     P        I+VTF+ID N  L + +
Sbjct: 456 SENQDNLNMAVYQGSAPLAKDNQLVSRFIFKSSP------NPIDVTFEIDNNNTLLIKS 508


>UniRef50_Q0E591 Cluster: 13.8 kDa; n=1; Spodoptera frugiperda
           ascovirus 1a|Rep: 13.8 kDa - Spodoptera frugiperda
           ascovirus 1a
          Length = 123

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +3

Query: 3   VTLPSPLNRLRHSPPTLITNPEYSSKYLRVSVL 101
           +T P PL+ L+ S PT    P YSS  +RVSV+
Sbjct: 54  ITTPPPLSSLQFSTPTDFIVPSYSSSAIRVSVM 86


>UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=2; Bacteria|Rep: DnaK protein (Heat
           shock protein), HSP70/DnaK family - Clostridium
           acetobutylicum
          Length = 551

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 4/81 (4%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERA-MTKD---NNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNV 220
           +NQ  V+I++ E E +    D    N +G+ EL      P+  P +++TF ++  G L +
Sbjct: 454 ENQENVMIKIVEDELSDKIVDIAYGNEIGEAELVLPENLPKNSP-VDITFKLNEEGRLEI 512

Query: 221 SAIEKSTNKENRSPLPTTKVV 283
            AIE    +E  + + T+ V+
Sbjct: 513 KAIEAVEKREISTSIETSSVI 533


>UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza
           sativa|Rep: OSIGBa0114M03.5 protein - Oryza sativa
           (Rice)
          Length = 581

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 19/70 (27%), Positives = 31/70 (44%)
 Frame = +2

Query: 74  IQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKEN 253
           I++F GE  +   N LLG+ EL     +  G    E+TF++  N ++ VS        + 
Sbjct: 400 IRIFLGEHVIVDHNTLLGEVELINNRRSYEGGVDYELTFEVSRNYLVEVSVSNADDGSKT 459

Query: 254 RSPLPTTKVV 283
               P  + V
Sbjct: 460 IKAFPIDEKV 469


>UniRef50_P77319 Cluster: Chaperone protein hscC; n=19;
           Gammaproteobacteria|Rep: Chaperone protein hscC -
           Escherichia coli (strain K12)
          Length = 556

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +2

Query: 59  QPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQ-IEVTFDIDANGILNVSAIEK 235
           Q  + + V++GE    K+N L+  F+   +P    G  Q I++ F  D NG+L V  + +
Sbjct: 402 QDSITVNVYQGENHKVKNNILVESFD---VPLKKTGAYQSIDIRFSYDINGLLEVDVLLE 458

Query: 236 STNKENR 256
             + ++R
Sbjct: 459 DGSVKSR 465


>UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=1;
           Yersinia mollaretii ATCC 43969|Rep: COG0443: Molecular
           chaperone - Yersinia mollaretii ATCC 43969
          Length = 571

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNV 220
           D+Q  V + +++GE     +N LLG+  L  +P    G   I++ F    +GIL V
Sbjct: 410 DHQQQVDVHIYQGEARKVAENILLGQLNLP-VPRRKAGEVSIDIRFTYTLDGILEV 464


>UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep:
           Heat shock protein 70 - Frankia sp. (strain CcI3)
          Length = 556

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 5/63 (7%)
 Frame = +2

Query: 53  DNQPGVLIQVFE----GERAMTKDNNLLGKFELTGIPPA-PRGVPQIEVTFDIDANGILN 217
           D+Q  V I+VFE     E     DN ++    ++GIPP  P G P +EVTF +  +  + 
Sbjct: 458 DDQAEVDIRVFEQGTTAESTAIDDNKVIVAGSISGIPPGHPLGTP-VEVTFTMGGDQTIQ 516

Query: 218 VSA 226
           V+A
Sbjct: 517 VTA 519


>UniRef50_A0LQV0 Cluster: Putative uncharacterized protein
           precursor; n=1; Acidothermus cellulolyticus 11B|Rep:
           Putative uncharacterized protein precursor -
           Acidothermus cellulolyticus (strain ATCC 43068 / 11B)
          Length = 245

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = -3

Query: 243 LVDFSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSSNLPSKLLSLVIARSPSNT 79
           L+  + A T  + L     +T     P  A G PV SN PS +  +VI RSP+ T
Sbjct: 27  LIAVTTAATAGVVLVGSQAITDHRAAPPAAAGYPVGSNAPSPV--VVIPRSPTTT 79


>UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 876

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 13/49 (26%), Positives = 28/49 (57%)
 Frame = +2

Query: 74  IQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNV 220
           +++F+G     +    +GK+ +TG+    +G   +E+TF +D   IL++
Sbjct: 708 LRIFQGNEQDIEKCKEIGKYLITGLEKKKKGEEHVEITFMVDEQNILHL 756


>UniRef50_A2DHP2 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 204

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +2

Query: 62  PGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKST 241
           P   IQ F+G+    ++N  +G+F L  IP  P     + +T  +  +GIL+VSA     
Sbjct: 71  PRACIQFFQGDNDDVRNNYPIGRFMLDDIPEIPDSKFTMNIT--VGDDGILSVSAYFVKN 128

Query: 242 NKEN 253
            K++
Sbjct: 129 GKKD 132


>UniRef50_A2EAL7 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 1031

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 35/146 (23%), Positives = 60/146 (41%), Gaps = 4/146 (2%)
 Frame = +2

Query: 107  KDNNLLGKFELTGIPPAP-RGVPQIE---VTFDIDANGILNVSAIEKSTNKENRSPLPTT 274
            K+N +  K     IP  P  G  +I    +T D+D     N    EK  N+EN+   P  
Sbjct: 717  KENKIRKKNNFVPIPAPPLEGEEEINTQPLTTDLDTTTNDNEEEKEKENNQENQEQKPEQ 776

Query: 275  KVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA*SATMEDEKLKEKILLN 454
            K V P K      + ++  E    + +E         I+  +    + E++K K+K+ + 
Sbjct: 777  KEVVPEKVEE--KVEEKVPENVQEKAQEEQVNNNVEQIIFPN----SNENDKEKDKVSVK 830

Query: 455  SDKQTIPRTSATSTHSSGWDFQSRLA 532
            S+  ++       + S G D  + LA
Sbjct: 831  SENSSVKIIPPKDSVSLGGDPTNALA 856


>UniRef50_Q10207 Cluster: Uncharacterized protein C17D1.01; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C17D1.01 - Schizosaccharomyces pombe (Fission yeast)
          Length = 584

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -3

Query: 309 HTLDLFLGET-TFVVGNGDLFSLLVDFSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSS 133
           H++   L ET T V GNG++     DFS+++ + + L + S   S   +P     + +SS
Sbjct: 392 HSIFSALSETPTPVSGNGNVADAPPDFSLSQVMPLDLIAPSMQPSAVSSPMSESHVQISS 451

Query: 132 NLPSKLLSLVIARSPS 85
            +P   +S +  R  S
Sbjct: 452 EMPRTGMSALPMRPRS 467


>UniRef50_Q4S8H7 Cluster: Chromosome 2 SCAF14705, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 2 SCAF14705, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 2759

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = -2

Query: 181 LNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDE 71
           ++L+H     W+P Q EF ++ +   ++++TLK LD+
Sbjct: 381 VSLKHIYENIWNPLQAEFCQRALAIANASITLKQLDQ 417


>UniRef50_Q58KF8 Cluster: ORF94; n=1; Leptospirillum
           ferrooxidans|Rep: ORF94 - Leptospirillum ferrooxidans
          Length = 94

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +2

Query: 320 QRSTETRMTRQKETIQGQECIGILLASA*SATMEDEKLKEKILLNSDK 463
           +RS +TR+ +++ + + ++   ILL S     MEDE+LK+KIL   DK
Sbjct: 26  ERSEKTRIAKKQRSEETRK--KILLGSYYMTKMEDEELKKKILAGLDK 71


>UniRef50_A7BVG3 Cluster: von Willebrand factor type A domain
           protein; n=1; Beggiatoa sp. PS|Rep: von Willebrand
           factor type A domain protein - Beggiatoa sp. PS
          Length = 280

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 4/87 (4%)
 Frame = +2

Query: 74  IQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTN--- 244
           + + +GE  +  +  +L ++  + I   P  +  I++ +  D NG++ VSA E+ T    
Sbjct: 3   VYILQGESEVPMECVILNQYTFSQITHVPDKLAIIDIEYAYDKNGVVTVSATERVTGQTL 62

Query: 245 -KENRSPLPTTKVVSPRKRSSVWLMRQ 322
            K+ + P   + +  P    SV L+ Q
Sbjct: 63  PKQAQIPDDLSWLSLPPSPESVTLVHQ 89


>UniRef50_A6LQ10 Cluster: Amino acid adenylation domain; n=1;
            Clostridium beijerinckii NCIMB 8052|Rep: Amino acid
            adenylation domain - Clostridium beijerinckii NCIMB 8052
          Length = 4034

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = +1

Query: 241  QQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPG 369
            + GE I +  +   ++ EE+++  N+  KY NE    +GD+ G
Sbjct: 2195 ENGESIAVIYEDETITYEELDKKSNQIAKYLNEQGVIRGDYVG 2237


>UniRef50_Q8IBX6 Cluster: Sin3 associated polypeptide p18-like
           protein, putative; n=1; Plasmodium falciparum 3D7|Rep:
           Sin3 associated polypeptide p18-like protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 728

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +1

Query: 208 YPQRFRYREVHQQGEQITITN-DKGRLSKEEIERMVNEAEKYRNEDDKAKGD 360
           YP+R  YRE       I+I   DK  L KE+  +  NE EKYRN D  +K D
Sbjct: 512 YPRRSSYRE------DISIKYYDKKDLEKEKYIKRYNENEKYRNNDFISKYD 557


>UniRef50_P18914 Cluster: Flagellin fljL; n=7;
           Alphaproteobacteria|Rep: Flagellin fljL - Caulobacter
           crescentus (Caulobacter vibrioides)
          Length = 273

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)
 Frame = +2

Query: 275 KVVSPRKRSSVWLMR--QRSTETRMTRQKETIQ-GQECIGILLASA*SATMEDEKLKEKI 445
           KV + +   ++W M   Q +T + +   K+++Q GQ  I + LA+  + T    K+KEK 
Sbjct: 37  KVANAKDNGAIWSMAKMQSATASSLNSVKDSLQRGQSTIDVALAAGDTITDLLTKMKEKA 96

Query: 446 LLNSD 460
           L  SD
Sbjct: 97  LAASD 101


>UniRef50_UPI00015B5E7D Cluster: PREDICTED: similar to adenylate
           cyclase type ix; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to adenylate cyclase type ix -
           Nasonia vitripennis
          Length = 1314

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +2

Query: 230 EKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTE--TRMTRQ--KETIQGQECIGILLA 397
           ++ TNK   S     K  S R ++  +L RQR+TE  T + R+  +  I  +   G++ A
Sbjct: 605 KEGTNKSPTSTASYGKKKSGRSKAWRYLQRQRTTEEMTPLDREDRRGVIVAEANQGLMAA 664

Query: 398 SA*SATMEDEKLKEKILLN 454
           SA SA++E   L++  + N
Sbjct: 665 SATSASLESNGLQKATVSN 683


>UniRef50_UPI00015546A1 Cluster: PREDICTED: similar to Chromosome 3
           open reading frame 31; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to Chromosome 3 open
           reading frame 31 - Ornithorhynchus anatinus
          Length = 609

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 19/69 (27%), Positives = 35/69 (50%)
 Frame = +1

Query: 145 DPTGAAWRASN*GHLRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAE 324
           DP G    A+   ++R +C    ++  + EV +   +  +   +  LS EE+ ++V EAE
Sbjct: 455 DPKGFDEPATLLKNIRSQCVVLAKKVGFEEVEEADVEELLEAHRDELSTEELLQLVEEAE 514

Query: 325 KYRNEDDKA 351
             R E++ A
Sbjct: 515 AERAEEEDA 523


>UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Clostridium acetobutylicum|Rep: DnaK protein (Heat shock
           protein), C-terminal region has VWA type A domain -
           Clostridium acetobutylicum
          Length = 698

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +2

Query: 56  NQPGVL-IQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           N+  VL + + +GE     D  +LGK+    I    R    I++ +  + NG+++V A +
Sbjct: 420 NRNNVLEVYMLQGESEEISDCTILGKYVFYDIEYVGRKPSIIDIEYSYNKNGVVDVFATQ 479

Query: 233 KSTNKE 250
           + T K+
Sbjct: 480 RETAKK 485


>UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK7 - Clostridium kluyveri DSM 555
          Length = 496

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 16/67 (23%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVS--A 226
           DNQ  + ++V++G     +DN  +G   + G+    +   +I++TF++  +  + V+   
Sbjct: 423 DNQTEIDVKVYQGTAKRARDNEHVGTVRVMGLKAVAKYQLEIKITFEVGRSQEVKVTIEE 482

Query: 227 IEKSTNK 247
           I+   NK
Sbjct: 483 IQSGINK 489


>UniRef50_A3K485 Cluster: Probable acyl-CoA dehydrogenase; n=1;
           Sagittula stellata E-37|Rep: Probable acyl-CoA
           dehydrogenase - Sagittula stellata E-37
          Length = 400

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = +2

Query: 179 EVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMT 346
           E+  DIDAN +L +S++ K  +  N  P+P++ +   R R     +RQ  TE  +T
Sbjct: 289 EIATDIDANDMLELSSMSKVQSGGNPGPVPSSTMKIERSR-----IRQSITELTVT 339


>UniRef50_Q6L612 Cluster: Transcription factor involved in
           conidiation; n=2; Hypocreales|Rep: Transcription factor
           involved in conidiation - Fusarium oxysporum
          Length = 550

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +1

Query: 307 MVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMK 408
           ++N    Y+  DD+A+   PGP +H +L  F +K
Sbjct: 439 VMNGMSPYKRRDDEAETPRPGPNVHDHLNNFDLK 472


>UniRef50_Q39FQ6 Cluster: Nucleoside diphosphate kinase; n=112;
           Bacteria|Rep: Nucleoside diphosphate kinase -
           Burkholderia sp. (strain 383) (Burkholderia cepacia
           (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 141

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = +2

Query: 68  VLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           V+IQV EGE A+ K+ +L+G    T    A +G  + +    IDAN +    A E
Sbjct: 72  VMIQVLEGEGAILKNRDLMG---ATDPKKAEKGTIRADFADSIDANAVHGSDAAE 123


>UniRef50_UPI000023F113 Cluster: hypothetical protein FG10529.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10529.1 - Gibberella zeae PH-1
          Length = 493

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 280 RLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMKCYHGG*EAQGKDSPEL* 459
           R  KEE E+   EAEK + E++K KG   G +     +    K    G + +G+D  E  
Sbjct: 325 RKKKEEEEKKAKEAEKKKKEEEKKKGKKGGDK---KKSDDKAKASEEGSDKKGEDKDEGK 381

Query: 460 QADHSSNK 483
           ++D  +++
Sbjct: 382 KSDSKADE 389


>UniRef50_Q1DAX0 Cluster: Putative uncharacterized protein; n=1;
           Myxococcus xanthus DK 1622|Rep: Putative uncharacterized
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 334

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%)
 Frame = +1

Query: 277 GRLSKEEIERMVNEA-EKYRNEDDKAKGDHPGPRM 378
           G LS+EE+ R+VNE+  ++  + ++A+G+ P  RM
Sbjct: 218 GSLSREELSRVVNESMSEHLRQAEQARGEAPSSRM 252


>UniRef50_A6DLB8 Cluster: RecA regulator RecX; n=1; Lentisphaera
           araneosa HTCC2155|Rep: RecA regulator RecX -
           Lentisphaera araneosa HTCC2155
          Length = 209

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 16/54 (29%), Positives = 26/54 (48%)
 Frame = +1

Query: 187 LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           L  +C++      +R +H +GE      DK   S   IE+++ E E Y   DD+
Sbjct: 58  LLSQCRKKASDLLFRRLHSRGELKKKLRDKQEFSMRLIEQVLEEMESYGYLDDR 111


>UniRef50_A0J752 Cluster: Putative uncharacterized protein; n=6;
           Alteromonadales|Rep: Putative uncharacterized protein -
           Shewanella woodyi ATCC 51908
          Length = 206

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = -2

Query: 226 SGNVEDTVGIDVEGDLNLRHA-TRRRWDPGQLEFTEQVVIFGH-STLTLK 83
           +GN  DT  IDV  D+N+ +  +   +  G+L  T+ +V FG  +T  LK
Sbjct: 99  NGNASDTKSIDVNNDVNVPNGISAELYKDGKLMMTKNIVGFGQKATFVLK 148


>UniRef50_Q7XMI5 Cluster: OSJNBb0006N15.14 protein; n=5; Oryza
           sativa|Rep: OSJNBb0006N15.14 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 307

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +1

Query: 151 TGAAWRASN*GHLRHRCQRYPQRFRYREVHQQGEQITITNDKGRLS 288
           TGA ++ SN  H ++        FR+ ++H   E +T TND+  +S
Sbjct: 152 TGAFYQPSN-SHSKNCSDENQMHFRHDQMHSSQESVTYTNDQSGIS 196


>UniRef50_Q6CUB0 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome C of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 983

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = -2

Query: 574 FPILSALCSYSSLLGQPGLEIPST*MGGCCTCSRNGLLVRVQENLFLELLILHGST 407
           FP+L    + SS LGQ G    +      CT S++  L  ++++L +EL +LH ST
Sbjct: 611 FPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKST 666


>UniRef50_Q58321 Cluster: Magnesium-chelatase subunit chlI homolog;
           n=10; cellular organisms|Rep: Magnesium-chelatase
           subunit chlI homolog - Methanococcus jannaschii
          Length = 365

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 11/28 (39%), Positives = 23/28 (82%)
 Frame = +1

Query: 280 RLSKEEIERMVNEAEKYRNEDDKAKGDH 363
           +L+KE++E+M+NE ++  N+D++ K +H
Sbjct: 327 QLNKEKLEQMINEFKQQNNKDNEEKEEH 354


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 670,119,946
Number of Sequences: 1657284
Number of extensions: 14277164
Number of successful extensions: 49954
Number of sequences better than 10.0: 183
Number of HSP's better than 10.0 without gapping: 47347
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49888
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43977329078
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).