SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8SZP2 Cluster: RE71854p; n=2; Sophophora|Rep: RE71854p...    66   6e-10
UniRef50_Q7QFK3 Cluster: ENSANGP00000017295; n=7; Endopterygota|...    64   4e-09
UniRef50_Q16VP6 Cluster: Putative uncharacterized protein; n=2; ...    63   7e-09
UniRef50_Q9VB86 Cluster: CG5812-PA; n=10; Endopterygota|Rep: CG5...    60   5e-08
UniRef50_Q9VMZ6 Cluster: CG14643-PA; n=2; Sophophora|Rep: CG1464...    57   4e-07
UniRef50_Q7QFK4 Cluster: ENSANGP00000017315; n=1; Anopheles gamb...    54   3e-06
UniRef50_Q16I50 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_Q8SZ76 Cluster: RE14272p; n=4; Diptera|Rep: RE14272p - ...    51   3e-05
UniRef50_Q8IR11 Cluster: CG32571-PA; n=2; Sophophora|Rep: CG3257...    47   5e-04
UniRef50_Q5BIE5 Cluster: RE40185p; n=2; Drosophila melanogaster|...    46   0.001
UniRef50_Q7PXS3 Cluster: ENSANGP00000011799; n=1; Anopheles gamb...    45   0.002
UniRef50_Q7PS59 Cluster: ENSANGP00000020057; n=2; Anopheles gamb...    44   0.003
UniRef50_Q8IH13 Cluster: LD21452p; n=2; Sophophora|Rep: LD21452p...    38   0.32 
UniRef50_Q9VMZ5 Cluster: CG14639-PA; n=3; Sophophora|Rep: CG1463...    37   0.42 
UniRef50_Q8IR08 Cluster: CG32574-PA; n=3; Sophophora|Rep: CG3257...    36   1.3  
UniRef50_Q3YZL1 Cluster: Phage protein-related; n=18; root|Rep: ...    35   1.7  
UniRef50_UPI00004997B8 Cluster: Rho GTPase activating protein; n...    35   2.2  
UniRef50_Q8LK15 Cluster: Extensin; n=3; rosids|Rep: Extensin - B...    35   2.2  
UniRef50_Q9VMG2 Cluster: CG31640-PA; n=2; Drosophila melanogaste...    35   2.2  
UniRef50_Q9LR38 Cluster: F26F24.8; n=2; Arabidopsis thaliana|Rep...    34   3.0  
UniRef50_O49295 Cluster: Putative uncharacterized protein T26J12...    34   3.0  
UniRef50_UPI000155632F Cluster: PREDICTED: similar to venom myot...    34   3.9  
UniRef50_UPI0000F20463 Cluster: PREDICTED: hypothetical protein;...    33   5.2  
UniRef50_Q2W837 Cluster: Membrane protein; n=5; Magnetospirillum...    33   5.2  
UniRef50_A2DHJ0 Cluster: Putative uncharacterized protein; n=1; ...    33   5.2  
UniRef50_A4R058 Cluster: Putative uncharacterized protein; n=1; ...    33   5.2  
UniRef50_UPI0000D56B02 Cluster: PREDICTED: similar to CG31020-PA...    33   6.8  
UniRef50_O39307 Cluster: 71; n=7; Equid herpesvirus 4|Rep: 71 - ...    33   6.8  
UniRef50_Q1DXD7 Cluster: Putative uncharacterized protein; n=1; ...    33   6.8  
UniRef50_A6R3I1 Cluster: Predicted protein; n=1; Ajellomyces cap...    33   6.8  
UniRef50_Q9H307 Cluster: Pinin; n=22; Tetrapoda|Rep: Pinin - Hom...    33   6.8  
UniRef50_P79149 Cluster: Pinin; n=3; Canis lupus familiaris|Rep:...    33   6.8  
UniRef50_Q1EU07 Cluster: Putative uncharacterized protein; n=1; ...    33   9.0  
UniRef50_Q0SAR2 Cluster: Putative uncharacterized protein; n=1; ...    33   9.0  
UniRef50_Q4P6C5 Cluster: Putative uncharacterized protein; n=1; ...    33   9.0  
UniRef50_Q2GZJ0 Cluster: Putative uncharacterized protein; n=1; ...    33   9.0  

>UniRef50_Q8SZP2 Cluster: RE71854p; n=2; Sophophora|Rep: RE71854p -
           Drosophila melanogaster (Fruit fly)
          Length = 197

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 1/44 (2%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIP-GVAPPQKHYKIIFIKGPN 560
           P++ KH+YVHVPPPEP E + PR P  V PPQKHYKI+FIK P+
Sbjct: 59  PVIHKHVYVHVPPPEP-EYQAPRKPLYVPPPQKHYKIVFIKAPS 101



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/20 (95%), Positives = 20/20 (100%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPEEQP+IIIPTPA
Sbjct: 122 VYVLVKKPEEQPEIIIPTPA 141


>UniRef50_Q7QFK3 Cluster: ENSANGP00000017295; n=7;
           Endopterygota|Rep: ENSANGP00000017295 - Anopheles
           gambiae str. PEST
          Length = 192

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 33/65 (50%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEP--VEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTK 605
           P++ KH+YVHVPPPEP  V  R P +  V PPQKHYKI+FIK P S  +  P    P  +
Sbjct: 56  PIIHKHVYVHVPPPEPEYVTTRKPIV--VPPPQKHYKIVFIKAP-SPPTQAPPVLPPIQQ 112

Query: 606 RREDT 620
             E T
Sbjct: 113 NEEKT 117


>UniRef50_Q16VP6 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 278

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 28/42 (66%), Positives = 31/42 (73%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPN 560
           +VQKHIYVHVPP EP E R  +I     P+KHYKIIFIK PN
Sbjct: 122 VVQKHIYVHVPPQEPEETRAQQIVSQGVPRKHYKIIFIKTPN 163



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 20/30 (66%), Positives = 23/30 (76%), Gaps = 1/30 (3%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPV-GYSYSAPR 195
           M+  VVLACVAMA  RPE P+ GY+Y APR
Sbjct: 1   MKILVVLACVAMAAARPEAPLHGYNYPAPR 30


>UniRef50_Q9VB86 Cluster: CG5812-PA; n=10; Endopterygota|Rep:
           CG5812-PA - Drosophila melanogaster (Fruit fly)
          Length = 286

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQR-LPRIPGVAPPQKHYKIIFIKGPNSSHSYCP 581
           LVQKHIYVHVPPPE  E R  P +P +   QKHYKIIFIK P+      P
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLP-IGQSQKHYKIIFIKAPSPPSYQAP 178



 Score = 40.7 bits (91), Expect = 0.034
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPE+Q DI+IPTPA
Sbjct: 192 VYVLVKKPEDQQDIVIPTPA 211



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>UniRef50_Q9VMZ6 Cluster: CG14643-PA; n=2; Sophophora|Rep:
           CG14643-PA - Drosophila melanogaster (Fruit fly)
          Length = 278

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPR-IPGVAPPQKHYKIIFIKGPNSSHS 572
           LV K IYVHVPP E  E R P+ +   APP+KHY+I+FIK P +S S
Sbjct: 112 LVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVS 158


>UniRef50_Q7QFK4 Cluster: ENSANGP00000017315; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017315 - Anopheles gambiae
           str. PEST
          Length = 199

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 25/43 (58%), Positives = 28/43 (65%)
 Frame = +3

Query: 444 KHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           KHIYVHVPPPEP +    +I      QKHYKIIFIK P+   S
Sbjct: 63  KHIYVHVPPPEPQQSFQQQIVAPGLRQKHYKIIFIKTPHQQPS 105



 Score = 33.1 bits (72), Expect = 6.8
 Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 1/21 (4%)
 Frame = +1

Query: 124 VLACVAMAYGRPEPPV-GYSY 183
           VLACVA+   RPEPPV GYS+
Sbjct: 9   VLACVAIVVARPEPPVGGYSH 29



 Score = 33.1 bits (72), Expect = 6.8
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +2

Query: 602 KTKRRHSVYVLVKKPEEQPDIIIPTPA 682
           +T+ +  VYVLVKKPE   DI +P PA
Sbjct: 115 QTEEKTIVYVLVKKPEAVGDISLPLPA 141


>UniRef50_Q16I50 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 164

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 25/42 (59%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query: 438 VQKHIYVHVPPPEPVEQRLPR-IPGVAPPQKHYKIIFIKGPN 560
           V KH+YVHVPP +  E   PR I  V+  QKHYKIIFIK P+
Sbjct: 63  VYKHVYVHVPPEDKEEYEAPRVIQPVSHKQKHYKIIFIKAPS 104


>UniRef50_Q8SZ76 Cluster: RE14272p; n=4; Diptera|Rep: RE14272p -
           Drosophila melanogaster (Fruit fly)
          Length = 198

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 24/42 (57%), Positives = 27/42 (64%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPN 560
           LV K++YVHVPP EP           A P+KHYKIIFIK PN
Sbjct: 69  LVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKIIFIKAPN 110



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTP 679
           VYVLVKKPEEQ  +I+P P
Sbjct: 131 VYVLVKKPEEQQPVILPAP 149


>UniRef50_Q8IR11 Cluster: CG32571-PA; n=2; Sophophora|Rep:
           CG32571-PA - Drosophila melanogaster (Fruit fly)
          Length = 346

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 18/45 (40%), Positives = 28/45 (62%)
 Frame = +3

Query: 438 VQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           + KH Y+H  P +  EQ++ R   V  PQK+Y+++FI  P S+ S
Sbjct: 147 INKHFYIHSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTAS 191


>UniRef50_Q5BIE5 Cluster: RE40185p; n=2; Drosophila
           melanogaster|Rep: RE40185p - Drosophila melanogaster
           (Fruit fly)
          Length = 392

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 5/47 (10%)
 Frame = +3

Query: 438 VQKHIYVHVPPPE-----PVEQRLPRIPGVAPPQKHYKIIFIKGPNS 563
           V KHIYVHVPP +      ++ R+    G  P QKHYKI+FIK P++
Sbjct: 159 VHKHIYVHVPPKDFEEEDAIQTRVHHQQG--PKQKHYKIVFIKAPSA 203



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTP 679
           +YVL KKPE++ DI+IPTP
Sbjct: 223 IYVLHKKPEQEQDIVIPTP 241


>UniRef50_Q7PXS3 Cluster: ENSANGP00000011799; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000011799 - Anopheles gambiae
           str. PEST
          Length = 197

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/41 (53%), Positives = 24/41 (58%)
 Frame = +3

Query: 438 VQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPN 560
           V KH+YVHV P E  E     I      QKHYKIIFIK P+
Sbjct: 82  VHKHVYVHVAPEEKEEIHQKVILPTYTKQKHYKIIFIKAPS 122



 Score = 32.7 bits (71), Expect = 9.0
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPAT 685
           VYVL KKPE + +I++P PAT
Sbjct: 143 VYVLHKKPELEQEIVVPAPAT 163


>UniRef50_Q7PS59 Cluster: ENSANGP00000020057; n=2; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000020057 - Anopheles gambiae
           str. PEST
          Length = 365

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/45 (44%), Positives = 29/45 (64%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSS 566
           P+V K+ Y HV P EP  +   +   + P +KHYK+IFIK P++S
Sbjct: 134 PVVLKNFYYHVAPEEPQAEAGAKTLTITP-RKHYKVIFIKAPSAS 177


>UniRef50_Q8IH13 Cluster: LD21452p; n=2; Sophophora|Rep: LD21452p -
           Drosophila melanogaster (Fruit fly)
          Length = 308

 Score = 37.5 bits (83), Expect = 0.32
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAP-PQKHYKIIFIKGPNSSHSYCPHNSYPTTKR 608
           P+V K+ ++H  P E  ++    +  +A  P+ HY ++F+K P  ++     N   T K+
Sbjct: 127 PIVTKNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAAALNLAKTLKQ 186

Query: 609 REDTPYM 629
            +   Y+
Sbjct: 187 EKTVVYV 193


>UniRef50_Q9VMZ5 Cluster: CG14639-PA; n=3; Sophophora|Rep:
           CG14639-PA - Drosophila melanogaster (Fruit fly)
          Length = 354

 Score = 37.1 bits (82), Expect = 0.42
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRL--PRIPGVAPPQKHYKIIFIKGPNSSHSY 575
           +V K IY+H  P E  E R   P +  V P +K+Y+I+FIK P+ +  Y
Sbjct: 138 IVTKDIYIHSAPEENEELRQDEPLLENV-PIRKNYRIVFIKAPSQNLKY 185


>UniRef50_Q8IR08 Cluster: CG32574-PA; n=3; Sophophora|Rep:
           CG32574-PA - Drosophila melanogaster (Fruit fly)
          Length = 388

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           P++ K  +    P E       +   +  PQK+Y+++FIK P+SS++
Sbjct: 171 PIIHKQFFTVAAPEEHENLERSKHLVIGRPQKNYRVVFIKAPSSSNA 217


>UniRef50_Q3YZL1 Cluster: Phage protein-related; n=18; root|Rep:
           Phage protein-related - Shigella sonnei (strain Ss046)
          Length = 1029

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = -3

Query: 416 TRISATESSITSEAQTAAA-AKGESTTETESIRRVSAAKGNA--ASRKAT*GSRMTTIA 249
           TR  +++++  S A +AA+ A   S ++ E+ R+ SAAKG+A  AS KAT  +   T A
Sbjct: 372 TRAESSKTAAASSASSAASSASSASASKDEATRQASAAKGSATTASTKATEAAGSATAA 430


>UniRef50_UPI00004997B8 Cluster: Rho GTPase activating protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: Rho GTPase
           activating protein - Entamoeba histolytica HM-1:IMSS
          Length = 374

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +3

Query: 456 VHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDTPY 626
           V+ P P+P+ + LP+ P   P Q+H  I+    P+   S  P     +    + TPY
Sbjct: 314 VNTPAPQPIHRPLPQTPSRNPSQQHQPILTKSEPSIGRSLPPIPQKRSGINIQHTPY 370


>UniRef50_Q8LK15 Cluster: Extensin; n=3; rosids|Rep: Extensin -
           Brassica napus (Rape)
          Length = 259

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNS-SHSYCPHNSY 593
           P  +KH YV+  PP PV+   PR+   +PP    K ++   P    H + PH+ Y
Sbjct: 195 PPPKKH-YVYKSPPPPVKHYSPRLVYHSPPPPKKKYVYKSPPPPVRHYFPPHHLY 248


>UniRef50_Q9VMG2 Cluster: CG31640-PA; n=2; Drosophila
           melanogaster|Rep: CG31640-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 808

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 6/54 (11%)
 Frame = +3

Query: 447 HIYVHVPPPEPVEQRLPRIPGVAPP--QKHY--KIIF--IKGPNSSHSYCPHNS 590
           ++ V   PP P+    PR P V PP  +K+Y    IF  +KGP S  S C  N+
Sbjct: 533 YVNVRRTPPPPLSSIFPRPPTVPPPPMEKYYATTAIFKPLKGPGSERSGCSSNT 586


>UniRef50_Q9LR38 Cluster: F26F24.8; n=2; Arabidopsis thaliana|Rep:
           F26F24.8 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1583

 Score = 34.3 bits (75), Expect = 3.0
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = -3

Query: 464 YVNIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVS 312
           Y+N D FL      + + +SA E+S++   Q AAA  G S T ++S+  VS
Sbjct: 103 YINWDTFL----PSLLSSVSAAEASLSQGVQAAAATAGSSATSSQSVVPVS 149


>UniRef50_O49295 Cluster: Putative uncharacterized protein T26J12.1;
           n=1; Arabidopsis thaliana|Rep: Putative uncharacterized
           protein T26J12.1 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 1075

 Score = 34.3 bits (75), Expect = 3.0
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = -3

Query: 464 YVNIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVS 312
           Y+N D FL      + + +SA E+S++   Q AAA  G S T ++S+  VS
Sbjct: 54  YINWDTFL----PSLLSSVSAAEASLSQGVQAAAATAGSSATSSQSVVPVS 100


>UniRef50_UPI000155632F Cluster: PREDICTED: similar to venom
           myotoxin inhibitor DM64; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to venom myotoxin
           inhibitor DM64 - Ornithorhynchus anatinus
          Length = 479

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 18/64 (28%), Positives = 28/64 (43%)
 Frame = +2

Query: 80  GSVSFRPSTKCALSWYSPVWLWPMAALNLQWDTATPLPEVTQEASALPLSAADTELLLWW 259
           G  + R S +C   W    W  P + L++    A+PLP+    A   PL      ++LW 
Sbjct: 64  GKANHRGSYRCYY-WLKEGWCGPSSFLDIT--AASPLPKPRLSAKPYPLLLPKENVMLWC 120

Query: 260 SFWI 271
             W+
Sbjct: 121 RVWV 124


>UniRef50_UPI0000F20463 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 550

 Score = 33.5 bits (73), Expect = 5.2
 Identities = 21/64 (32%), Positives = 31/64 (48%)
 Frame = -3

Query: 437 KRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMT 258
           K++T  +T    T ++   E  T AA + +STT TE     +AA+    + KAT    M 
Sbjct: 440 KKNTTATTEEKNTTATTEEEKNTTAAKEEKSTTGTEEKMITTAAEEEQKNTKATEEEPMI 499

Query: 257 TIAT 246
           T  T
Sbjct: 500 TTTT 503


>UniRef50_Q2W837 Cluster: Membrane protein; n=5;
           Magnetospirillum|Rep: Membrane protein -
           Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
          Length = 289

 Score = 33.5 bits (73), Expect = 5.2
 Identities = 16/45 (35%), Positives = 28/45 (62%)
 Frame = -3

Query: 410 ISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT 276
           + + +++ TS+A TAA A+    +ET +    S+A GNAA+  A+
Sbjct: 79  VQSADAAGTSKAATAANAQAARLSETNAAASASSASGNAAAANAS 123


>UniRef50_A2DHJ0 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 682

 Score = 33.5 bits (73), Expect = 5.2
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +3

Query: 456 VHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           + +PPP+PV+++ PR   VAPP+   K   I+ PN   S
Sbjct: 356 IPIPPPQPVQEQHPR-SSVAPPEMVNKEETIQKPNKVRS 393


>UniRef50_A4R058 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 1181

 Score = 33.5 bits (73), Expect = 5.2
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 4/66 (6%)
 Frame = -3

Query: 428 TRVSTRISATESSITSEAQTAAAAKGESTTETESI----RRVSAAKGNAASRKAT*GSRM 261
           T  ++   +T SSITS+  T++A +  S+TET ++       S+   +A +   T  S  
Sbjct: 569 TATASSSDSTTSSITSDVPTSSATETSSSTETSTVSSSDETTSSVVSDATTASTTESSSA 628

Query: 260 TTIATV 243
           T  ATV
Sbjct: 629 TETATV 634


>UniRef50_UPI0000D56B02 Cluster: PREDICTED: similar to CG31020-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31020-PA - Tribolium castaneum
          Length = 402

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = +3

Query: 441 QKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKG-PNSSHSYCPHNSYPTTKRRED 617
           QK  Y ++P  E   Q    I    PPQ HY   F++G PN  + Y P  S P +  R  
Sbjct: 86  QKSRYEYIPMQE---QNRYIICQKQPPQVHYAEEFVQGRPNHRYEYIPEESPPKSVTRNR 142

Query: 618 TPYM 629
             Y+
Sbjct: 143 YEYI 146


>UniRef50_O39307 Cluster: 71; n=7; Equid herpesvirus 4|Rep: 71 -
           Equid herpesvirus 4 (Equine herpesvirus 4)
          Length = 750

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKGES-TTETESIRRVSAAKGNAASRKAT*GSRMTT 255
           ST  +T  S +ES  ++ A TAA    ES TTE+ +    +AA   AA+  A   +  TT
Sbjct: 113 STSTTTSTSVSESPTSTTATTAATTTTESTTTESTTAATTTAATTTAATTTAATTTAATT 172

Query: 254 IA 249
            A
Sbjct: 173 TA 174


>UniRef50_Q1DXD7 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 863

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 6/60 (10%)
 Frame = +3

Query: 465 PPP----EPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCP--HNSYPTTKRREDTPY 626
           PPP    +PVE  + R+P V P ++   +     P  S  Y P  H SYP  ++  +  Y
Sbjct: 780 PPPSRYEDPVEPPM-RMPSVRPVRREVSVYIDDEPRQSREYAPVDHVSYPAARQAREERY 838


>UniRef50_A6R3I1 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 117

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +2

Query: 122 WYSPVWLWPMAA---LNLQWDTATPLPEVTQEASALPLSAADTELLLWWSFWIPRW 280
           W   V LW + +   L  +W   TP+P++T E+ A+ +   D E  L +   I RW
Sbjct: 23  WNIAVLLWDLVSPGHLFGKWKNLTPIPDITLESLAIDVQGEDKEGFLSFLRKILRW 78


>UniRef50_Q9H307 Cluster: Pinin; n=22; Tetrapoda|Rep: Pinin - Homo
           sapiens (Human)
          Length = 717

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+   S+ D
Sbjct: 631 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGSSRD 674


>UniRef50_P79149 Cluster: Pinin; n=3; Canis lupus familiaris|Rep:
           Pinin - Canis familiaris (Dog)
          Length = 773

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+   S+ D
Sbjct: 687 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGSSRD 730


>UniRef50_Q1EU07 Cluster: Putative uncharacterized protein; n=1;
           Clostridium oremlandii OhILAs|Rep: Putative
           uncharacterized protein - Clostridium oremlandii OhILAs
          Length = 683

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 13/53 (24%), Positives = 26/53 (49%)
 Frame = +2

Query: 143 WPMAALNLQWDTATPLPEVTQEASALPLSAADTELLLWWSFWIPRWPFWRQHF 301
           WP   LN++W+    L ++ ++   +    ++ +  +  S   P+W  WRQ F
Sbjct: 604 WPKEDLNIEWEPIWALSKIKRDYWKVHFIGSNIDERMRLSKEYPKWKKWRQEF 656


>UniRef50_Q0SAR2 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. RHA1|Rep: Putative uncharacterized
           protein - Rhodococcus sp. (strain RHA1)
          Length = 288

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 20/66 (30%), Positives = 28/66 (42%)
 Frame = -3

Query: 482 NWFWGRYVNIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAK 303
           NW WGR   +   +  R TR  TR             TAAAA   +TT   ++R+ S + 
Sbjct: 201 NWAWGRRGLVGHGISCRPTRFPTRGPRDPVRQRKIVHTAAAASATTTTHITTVRKCSLSA 260

Query: 302 GNAASR 285
            +   R
Sbjct: 261 RSCCMR 266


>UniRef50_Q4P6C5 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 928

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 15/44 (34%), Positives = 28/44 (63%)
 Frame = -3

Query: 437 KRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAA 306
           +RSTR+ST   A   + ++ +++  A+   S++ T S+ R+SAA
Sbjct: 289 RRSTRLSTSNQADALASSTSSKSKTASSSSSSSSTSSLTRISAA 332


>UniRef50_Q2GZJ0 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 562

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = -3

Query: 434 RSTRVSTRISATESS--ITSEAQTAAAAKGESTTETESIRRVSAAKGNAAS 288
           R+   S   + TE+S  ITSE    A    E+T+ T +    S+A GNAAS
Sbjct: 186 RTVTASGATATTENSAAITSETSVIATTGTETTSATSTATTTSSAMGNAAS 236


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 555,517,491
Number of Sequences: 1657284
Number of extensions: 9129428
Number of successful extensions: 38196
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 35456
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38053
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 56198352344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).