SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5TTQ2 Cluster: ENSANGP00000026814; n=3; Endopterygota|...   145   1e-33
UniRef50_P48810 Cluster: Heterogeneous nuclear ribonucleoprotein...   143   4e-33
UniRef50_Q86ER1 Cluster: Clone ZZD1516 mRNA sequence; n=2; Schis...   124   3e-27
UniRef50_UPI00015560CE Cluster: PREDICTED: similar to heterogene...   122   1e-26
UniRef50_P09651 Cluster: Heterogeneous nuclear ribonucleoprotein...   122   1e-26
UniRef50_Q66IT0 Cluster: MGC84815 protein; n=1; Xenopus laevis|R...   118   1e-25
UniRef50_P51991 Cluster: Heterogeneous nuclear ribonucleoprotein...   117   4e-25
UniRef50_Q02926 Cluster: Ribonucleoprotein RB97D; n=7; Sophophor...   113   3e-24
UniRef50_UPI00005A4DCF Cluster: PREDICTED: similar to Heterogene...   108   2e-22
UniRef50_Q22037 Cluster: Heterogeneous nuclear ribonucleoprotein...   103   5e-21
UniRef50_Q13151 Cluster: Heterogeneous nuclear ribonucleoprotein...    96   1e-18
UniRef50_Q4SQV2 Cluster: Chromosome 1 SCAF14529, whole genome sh...    89   1e-16
UniRef50_A7RG33 Cluster: Predicted protein; n=1; Nematostella ve...    87   3e-16
UniRef50_A4V6N1 Cluster: HnRNP A2/B1 protein; n=1; Dugesia japon...    87   6e-16
UniRef50_UPI0000DA279E Cluster: PREDICTED: similar to Heterogene...    82   1e-14
UniRef50_Q8WSM6 Cluster: Putative uncharacterized protein; n=4; ...    80   5e-14
UniRef50_Q9VVE5 Cluster: CG32169-PA; n=9; Endopterygota|Rep: CG3...    79   9e-14
UniRef50_Q8MS04 Cluster: RH49436p; n=9; Endopterygota|Rep: RH494...    78   2e-13
UniRef50_A7SSE1 Cluster: Predicted protein; n=3; Nematostella ve...    78   2e-13
UniRef50_A7SIF0 Cluster: Predicted protein; n=1; Nematostella ve...    77   6e-13
UniRef50_Q21911 Cluster: Putative uncharacterized protein msi-1;...    76   1e-12
UniRef50_O94432 Cluster: mRNA cleavage factor complex subunit; n...    75   2e-12
UniRef50_Q8CD63 Cluster: 13 days embryo male testis cDNA, RIKEN ...    74   3e-12
UniRef50_A2YWJ2 Cluster: Putative uncharacterized protein; n=3; ...    74   4e-12
UniRef50_Q14103 Cluster: Heterogeneous nuclear ribonucleoprotein...    74   4e-12
UniRef50_P48809 Cluster: Heterogeneous nuclear ribonucleoprotein...    73   1e-11
UniRef50_Q99383 Cluster: Nuclear polyadenylated RNA-binding prot...    73   1e-11
UniRef50_O14979 Cluster: Heterogeneous nuclear ribonucleoprotein...    72   1e-11
UniRef50_O43347 Cluster: RNA-binding protein Musashi homolog 1; ...    72   2e-11
UniRef50_UPI0000F2CBBE Cluster: PREDICTED: similar to musashi ho...    71   2e-11
UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogene...    71   4e-11
UniRef50_UPI00005A196B Cluster: PREDICTED: similar to Heterogene...    70   7e-11
UniRef50_Q9VFT3 Cluster: CG9654-PA; n=4; Drosophila melanogaster...    69   1e-10
UniRef50_Q6CC04 Cluster: Yarrowia lipolytica chromosome C of str...    68   2e-10
UniRef50_Q9FM47 Cluster: Similarity to RNA binding protein; n=5;...    68   3e-10
UniRef50_Q6BL35 Cluster: Debaryomyces hansenii chromosome F of s...    68   3e-10
UniRef50_A3LZT4 Cluster: Predicted protein; n=1; Pichia stipitis...    68   3e-10
UniRef50_Q4WHA5 Cluster: Heterogeneous nuclear ribonucleoprotein...    67   4e-10
UniRef50_Q1ENZ5 Cluster: RNA-binding protein, putative; n=2; Mag...    67   5e-10
UniRef50_A4R1M8 Cluster: Putative uncharacterized protein; n=1; ...    67   5e-10
UniRef50_UPI0000502E70 Cluster: UPI0000502E70 related cluster; n...    66   7e-10
UniRef50_Q6PNM9 Cluster: AUF1 similar protein; n=3; Paracentrotu...    66   7e-10
UniRef50_Q94AC3 Cluster: AT4g36960/C7A10_400; n=11; Magnoliophyt...    66   9e-10
UniRef50_Q9U5E3 Cluster: CiMsi; n=1; Ciona intestinalis|Rep: CiM...    66   9e-10
UniRef50_Q9HEH4 Cluster: Related to heterogeneous nuclear ribonu...    66   9e-10
UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11; Magnoliophyt...    65   2e-09
UniRef50_UPI0000E4934F Cluster: PREDICTED: similar to musashi nr...    65   2e-09
UniRef50_Q9LHL2 Cluster: Similarity to RNA binding protein; n=13...    65   2e-09
UniRef50_Q8W4A6 Cluster: Putative uncharacterized protein MJH23....    65   2e-09
UniRef50_UPI00005A10B6 Cluster: PREDICTED: similar to Heterogene...    64   3e-09
UniRef50_Q4SEZ3 Cluster: Chromosome 1 SCAF14609, whole genome sh...    64   3e-09
UniRef50_Q9UAF2 Cluster: Musashi; n=1; Halocynthia roretzi|Rep: ...    64   3e-09
UniRef50_UPI0000F1F0C3 Cluster: PREDICTED: similar to LOC561459 ...    64   5e-09
UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39; Euteleo...    64   5e-09
UniRef50_Q9D3U4 Cluster: Adult male testis cDNA, RIKEN full-leng...    63   8e-09
UniRef50_UPI000023D975 Cluster: hypothetical protein FG10273.1; ...    62   1e-08
UniRef50_Q32LZ4 Cluster: Msi2h protein; n=4; Eutheria|Rep: Msi2h...    62   2e-08
UniRef50_Q9SU99 Cluster: HnRNP-like protein; n=10; core eudicoty...    62   2e-08
UniRef50_A7NUC5 Cluster: Chromosome chr18 scaffold_1, whole geno...    61   3e-08
UniRef50_Q26658 Cluster: Stage specific activator protein; n=3; ...    61   3e-08
UniRef50_Q6ZZX5 Cluster: Heterogeneous nuclear ribonucleoprotein...    60   4e-08
UniRef50_Q7XDI5 Cluster: RNA recognition motif family protein, e...    60   4e-08
UniRef50_Q9LNP1 Cluster: F1L3.34; n=2; Arabidopsis thaliana|Rep:...    60   8e-08
UniRef50_Q5CS11 Cluster: Musashi. RRM domain containing protein,...    60   8e-08
UniRef50_A7SCX6 Cluster: Predicted protein; n=1; Nematostella ve...    58   2e-07
UniRef50_UPI00005A129E Cluster: PREDICTED: similar to Heterogene...    58   2e-07
UniRef50_Q5K6W6 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q54D98 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_A3FQK0 Cluster: RNA recognition motif (RRM)-containing ...    57   4e-07
UniRef50_UPI0000E45D7B Cluster: PREDICTED: similar to heterogene...    57   6e-07
UniRef50_A4RXB1 Cluster: Predicted protein; n=2; Ostreococcus|Re...    57   6e-07
UniRef50_Q9SM01 Cluster: RNA binding protein; n=2; Arabidopsis t...    56   7e-07
UniRef50_Q4UI71 Cluster: RNA-binding (SR) protein, putative; n=2...    55   2e-06
UniRef50_Q4SJ02 Cluster: Chromosome 21 SCAF14577, whole genome s...    55   2e-06
UniRef50_Q4S8N9 Cluster: Chromosome 7 SCAF14703, whole genome sh...    55   2e-06
UniRef50_A6N9V7 Cluster: RNA binding protein; n=1; Ornithodoros ...    54   3e-06
UniRef50_UPI0001560FCC Cluster: PREDICTED: hypothetical protein;...    54   5e-06
UniRef50_UPI0000D5737C Cluster: PREDICTED: similar to RNA bindin...    54   5e-06
UniRef50_Q8W034 Cluster: Ribonucleoprotein 1; n=5; core eudicoty...    53   7e-06
UniRef50_Q501B0 Cluster: At2g46780; n=3; core eudicotyledons|Rep...    53   7e-06
UniRef50_A4V6K1 Cluster: DAZ-associated protein; n=2; Platyhelmi...    53   7e-06
UniRef50_Q13148 Cluster: TAR DNA-binding protein 43; n=36; Coelo...    53   7e-06
UniRef50_UPI0000DB6D53 Cluster: PREDICTED: similar to CG32169-PA...    53   9e-06
UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1; ...    53   9e-06
UniRef50_Q9BX46 Cluster: RNA-binding protein 24; n=52; Eumetazoa...    52   1e-05
UniRef50_Q6VYI5 Cluster: TARDBP S8; n=8; Coelomata|Rep: TARDBP S...    52   2e-05
UniRef50_Q05C33 Cluster: Tardbp protein; n=14; Coelomata|Rep: Ta...    52   2e-05
UniRef50_Q75KB4 Cluster: Putative RNA binding protein; n=4; Oryz...    52   2e-05
UniRef50_A5BSV4 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_Q08473 Cluster: RNA-binding protein squid; n=22; Endopt...    52   2e-05
UniRef50_Q9H0Z9 Cluster: RNA-binding protein 38; n=16; Eutheria|...    52   2e-05
UniRef50_A4V6K2 Cluster: PRM10 protein; n=1; Dugesia japonica|Re...    52   2e-05
UniRef50_Q94BU4 Cluster: At1g33470/F10C21_14; n=2; Arabidopsis t...    51   3e-05
UniRef50_A7RU25 Cluster: Predicted protein; n=1; Nematostella ve...    51   4e-05
UniRef50_UPI0000E4615D Cluster: PREDICTED: similar to heterogene...    50   5e-05
UniRef50_A7SIE8 Cluster: Predicted protein; n=2; Nematostella ve...    50   5e-05
UniRef50_UPI00005A96C6 Cluster: PREDICTED: similar to Heterogene...    50   6e-05
UniRef50_Q9M9E6 Cluster: F3F9.20; n=8; Arabidopsis thaliana|Rep:...    50   6e-05
UniRef50_A2YHR7 Cluster: Putative uncharacterized protein; n=2; ...    50   6e-05
UniRef50_Q0KHQ1 Cluster: CG33714-PA, isoform A; n=2; Diptera|Rep...    50   6e-05
UniRef50_A0C337 Cluster: Chromosome undetermined scaffold_146, w...    50   6e-05
UniRef50_UPI00005A358A Cluster: PREDICTED: similar to Heterogene...    50   8e-05
UniRef50_A0H648 Cluster: RNA-binding region RNP-1; n=3; Chlorofl...    50   8e-05
UniRef50_Q5CT90 Cluster: RRM domain containing protein; n=1; Cry...    50   8e-05
UniRef50_A7ART3 Cluster: Ribonucleoprotein, putative; n=1; Babes...    50   8e-05
UniRef50_Q9SVM8 Cluster: Glycine-rich RNA-binding protein 2, mit...    50   8e-05
UniRef50_UPI0000DB6DF2 Cluster: PREDICTED: similar to squid CG16...    49   1e-04
UniRef50_Q9SYP9 Cluster: F9H16.14 protein; n=6; core eudicotyled...    49   1e-04
UniRef50_Q9FI04 Cluster: Arabidopsis thaliana genomic DNA, chrom...    49   1e-04
UniRef50_Q4MZK1 Cluster: Nucleic acid binding factor, putative; ...    49   1e-04
UniRef50_Q9FI08 Cluster: Similarity to RNA-binding protein; n=1;...    49   1e-04
UniRef50_Q40437 Cluster: RGP-3; n=2; Nicotiana|Rep: RGP-3 - Nico...    49   1e-04
UniRef50_Q10N14 Cluster: RNA recognition motif family protein, e...    49   1e-04
UniRef50_Q5DH48 Cluster: SJCHGC06087 protein; n=1; Schistosoma j...    49   1e-04
UniRef50_O45189 Cluster: Suppressor protein 12; n=2; Caenorhabdi...    49   1e-04
UniRef50_A1L1U3 Cluster: Zgc:158370; n=5; Danio rerio|Rep: Zgc:1...    48   2e-04
UniRef50_Q6MCT2 Cluster: Probable nucleic acid-binding protein; ...    48   2e-04
UniRef50_Q0F212 Cluster: RNA-binding region RNP-1; n=1; Mariprof...    48   2e-04
UniRef50_UPI000156016B Cluster: PREDICTED: hypothetical protein;...    48   3e-04
UniRef50_Q54CU2 Cluster: RNA-binding region-containing protein; ...    48   3e-04
UniRef50_O45577 Cluster: Putative uncharacterized protein cpf-2;...    48   3e-04
UniRef50_Q9UN86-2 Cluster: Isoform B of Q9UN86 ; n=13; Euteleost...    48   3e-04
UniRef50_Q11SF1 Cluster: RNA binding protein; n=6; Bacteria|Rep:...    48   3e-04
UniRef50_Q7RNK1 Cluster: Ribonucleoprotein homolog F21B7.26-Arab...    48   3e-04
UniRef50_Q9UN86 Cluster: Ras GTPase-activating protein-binding p...    48   3e-04
UniRef50_UPI000065FE7B Cluster: RNA-binding protein 38 (RNA-bind...    47   4e-04
UniRef50_Q5JK61 Cluster: RNA recognition motif (RRM)-containing ...    47   4e-04
UniRef50_A7QX84 Cluster: Chromosome undetermined scaffold_215, w...    47   4e-04
UniRef50_Q5BXS3 Cluster: SJCHGC01369 protein; n=2; Schistosoma j...    47   4e-04
UniRef50_Q4H2Q6 Cluster: Ci-Tardbp protein; n=1; Ciona intestina...    47   4e-04
UniRef50_A3BDN9 Cluster: Putative uncharacterized protein; n=3; ...    47   6e-04
UniRef50_Q8ILZ7 Cluster: Putative uncharacterized protein; n=1; ...    47   6e-04
UniRef50_O45713 Cluster: Putative uncharacterized protein; n=5; ...    47   6e-04
UniRef50_Q04836 Cluster: 31 kDa ribonucleoprotein, chloroplast p...    47   6e-04
UniRef50_Q9D8T7-2 Cluster: Isoform 2 of Q9D8T7 ; n=2; Euarchonto...    46   8e-04
UniRef50_Q1IV44 Cluster: RNA-binding protein, RNP-1; n=2; Bacter...    46   8e-04
UniRef50_Q7XI13 Cluster: Glycine-rich RNA-binding protein-like; ...    46   8e-04
UniRef50_A7SMA3 Cluster: Predicted protein; n=3; Nematostella ve...    46   8e-04
UniRef50_A6RJZ8 Cluster: Putative uncharacterized protein; n=2; ...    46   8e-04
UniRef50_Q9D8T7 Cluster: SRA stem-loop-interacting RNA-binding p...    46   8e-04
UniRef50_UPI000065DEA8 Cluster: RNA-binding protein 24 (RNA-bind...    46   0.001
UniRef50_Q48A10 Cluster: RNA-binding protein; n=2; Alteromonadal...    46   0.001
UniRef50_A1SSM5 Cluster: RNP-1 like RNA-binding protein precurso...    46   0.001
UniRef50_A0HBM8 Cluster: RNA-binding region RNP-1; n=1; Comamona...    46   0.001
UniRef50_Q259G3 Cluster: H0124B04.13 protein; n=5; Oryza sativa|...    46   0.001
UniRef50_O24306 Cluster: Ribonucleoprotein; n=3; Pisum sativum|R...    46   0.001
UniRef50_Q6X9Z2 Cluster: HnRNP core protein A1; n=2; Laurasiathe...    46   0.001
UniRef50_A0BZZ4 Cluster: Chromosome undetermined scaffold_14, wh...    46   0.001
UniRef50_Q6ZR81 Cluster: CDNA FLJ46566 fis, clone THYMU3040829, ...    46   0.001
UniRef50_UPI0000E47947 Cluster: PREDICTED: similar to GA10247-PA...    46   0.001
UniRef50_UPI00006CFFFC Cluster: RNA binding protein; n=1; Tetrah...    46   0.001
UniRef50_Q552K5 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A7S6X1 Cluster: Predicted protein; n=1; Nematostella ve...    46   0.001
UniRef50_Q32P59 Cluster: SRA stem-loop-interacting RNA-binding p...    46   0.001
UniRef50_A4CFR2 Cluster: Putative uncharacterized protein; n=3; ...    45   0.002
UniRef50_A3J7P1 Cluster: RNA-binding protein; n=4; Gammaproteoba...    45   0.002
UniRef50_Q9SVM7 Cluster: RNA-binding protein like; n=1; Arabidop...    45   0.002
UniRef50_Q8VXC4 Cluster: Glycine rich RNA binding protein; n=20;...    45   0.002
UniRef50_Q8LPB0 Cluster: Glycine-rich RNA-binding protein; n=1; ...    45   0.002
UniRef50_Q6ID29 Cluster: At4g13860; n=9; cellular organisms|Rep:...    45   0.002
UniRef50_Q556F3 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_Q1JSB7 Cluster: RNA binding protein, putative; n=1; Tox...    45   0.002
UniRef50_A7SDQ4 Cluster: Predicted protein; n=1; Nematostella ve...    45   0.002
UniRef50_Q1LVU9 Cluster: Cold inducible RNA binding protein; n=8...    45   0.002
UniRef50_Q9FZ84 Cluster: F26I16.3 protein; n=2; Arabidopsis thal...    45   0.002
UniRef50_Q0DXG2 Cluster: Os02g0755400 protein; n=2; Oryza sativa...    45   0.002
UniRef50_A2X9R7 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q382X1 Cluster: RNA-binding protein, putative; n=3; Try...    45   0.002
UniRef50_Q5KBA9 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A5DJP2 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A3LSC1 Cluster: Predicted protein; n=2; Saccharomycetal...    45   0.002
UniRef50_UPI00015B5E70 Cluster: PREDICTED: similar to nucleolar ...    44   0.003
UniRef50_UPI0000DB7209 Cluster: PREDICTED: similar to CG6937-PA;...    44   0.003
UniRef50_UPI0000EB047B Cluster: Cleavage stimulation factor 64 k...    44   0.003
UniRef50_Q4S5L6 Cluster: Chromosome 9 SCAF14729, whole genome sh...    44   0.003
UniRef50_Q4KLD9 Cluster: MGC116464 protein; n=1; Xenopus laevis|...    44   0.003
UniRef50_A0KEF3 Cluster: RNA-binding protein; n=4; Gammaproteoba...    44   0.003
UniRef50_Q4W5P0 Cluster: Homologous to drosophila sqd (Squid) pr...    44   0.003
UniRef50_Q4FW55 Cluster: Poly(A) binding protein, putative; n=6;...    44   0.003
UniRef50_A3M0M8 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...    44   0.003
UniRef50_Q1DXH0 Cluster: Polyadenylate-binding protein, cytoplas...    44   0.003
UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=7...    44   0.003
UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=1...    44   0.003
UniRef50_Q9H0L4 Cluster: Cleavage stimulation factor 64 kDa subu...    44   0.003
UniRef50_Q14011 Cluster: Cold-inducible RNA-binding protein; n=6...    44   0.003
UniRef50_A5KRV2 Cluster: RNP-1 like RNA-binding protein; n=1; ca...    44   0.004
UniRef50_Q9SJ28 Cluster: Putative glycine-rich RNA binding prote...    44   0.004
UniRef50_Q5K249 Cluster: Putative glycine-rich RNA-binding prote...    44   0.004
UniRef50_Q012A5 Cluster: Ps16 protein; n=2; Ostreococcus|Rep: Ps...    44   0.004
UniRef50_O23189 Cluster: RNA-binding like protein; n=1; Arabidop...    44   0.004
UniRef50_A7PVU6 Cluster: Chromosome chr8 scaffold_34, whole geno...    44   0.004
UniRef50_A7PNS9 Cluster: Chromosome chr8 scaffold_23, whole geno...    44   0.004
UniRef50_A3C5F0 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q8IIT2 Cluster: Nucleic acid binding factor, putative; ...    44   0.004
UniRef50_Q86NL1 Cluster: RE27227p; n=5; Endopterygota|Rep: RE272...    44   0.004
UniRef50_A7APD8 Cluster: RNA recognition motif domain containing...    44   0.004
UniRef50_A6SSI6 Cluster: Putative uncharacterized protein; n=2; ...    44   0.004
UniRef50_Q13595 Cluster: Transformer-2 protein homolog; n=57; Eu...    44   0.004
UniRef50_P19683 Cluster: 31 kDa ribonucleoprotein, chloroplast p...    44   0.004
UniRef50_UPI0000E4A87D Cluster: PREDICTED: similar to RNA-bindin...    44   0.005
UniRef50_UPI0000E4857E Cluster: PREDICTED: similar to cold induc...    44   0.005
UniRef50_UPI0000519E48 Cluster: PREDICTED: similar to U1-snRNP b...    44   0.005
UniRef50_Q7NHK5 Cluster: RNA-binding protein; n=10; cellular org...    44   0.005
UniRef50_Q7MWI3 Cluster: RNA-binding protein; n=5; Bacteroidetes...    44   0.005
UniRef50_O83375 Cluster: RNA-binding protein, putative; n=1; Tre...    44   0.005
UniRef50_Q5EUH9 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_A7CQC8 Cluster: RNP-1 like RNA-binding protein; n=1; Op...    44   0.005
UniRef50_A3J4E6 Cluster: RNA binding protein; n=4; cellular orga...    44   0.005
UniRef50_Q1PES4 Cluster: RNA recognition motif-containing protei...    44   0.005
UniRef50_A7PX80 Cluster: Chromosome chr12 scaffold_36, whole gen...    44   0.005
UniRef50_A7PIB0 Cluster: Chromosome chr13 scaffold_17, whole gen...    44   0.005
UniRef50_Q8TA30 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q553V5 Cluster: Putative uncharacterized protein; n=4; ...    44   0.005
UniRef50_A5K494 Cluster: Nucleic acid binding factor, putative; ...    44   0.005
UniRef50_Q1DPW0 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_P62995 Cluster: Splicing factor, arginine/serine-rich 1...    44   0.005
UniRef50_P39697 Cluster: 40S ribosomal protein S19, mitochondria...    44   0.005
UniRef50_UPI0001555426 Cluster: PREDICTED: similar to hematopoie...    43   0.007
UniRef50_UPI0000E467CE Cluster: PREDICTED: hypothetical protein,...    43   0.007
UniRef50_UPI0000E46272 Cluster: PREDICTED: hypothetical protein;...    43   0.007
UniRef50_UPI0000498AD7 Cluster: enhancer binding protein 2; n=1;...    43   0.007
UniRef50_Q5PPI5 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_A2AEK1 Cluster: Cleavage stimulation factor, 3' pre-RNA...    43   0.007
UniRef50_Q7NCQ3 Cluster: RNA-binding protein; n=1; Gloeobacter v...    43   0.007
UniRef50_Q9LKA4 Cluster: Similarity to RNA-binding protein; n=5;...    43   0.007
UniRef50_Q3ED69 Cluster: Uncharacterized protein At1g22910.3; n=...    43   0.007
UniRef50_Q01L95 Cluster: OSIGBa0137L20.5 protein; n=7; Oryza sat...    43   0.007
UniRef50_A7QJF1 Cluster: Chromosome chr8 scaffold_106, whole gen...    43   0.007
UniRef50_A7P2N7 Cluster: Chromosome chr1 scaffold_5, whole genom...    43   0.007
UniRef50_A3AVD4 Cluster: Putative uncharacterized protein; n=3; ...    43   0.007
UniRef50_Q95QV8 Cluster: Putative uncharacterized protein; n=6; ...    43   0.007
UniRef50_A2E4P7 Cluster: Spliceosomal protein, putative; n=1; Tr...    43   0.007
UniRef50_Q00880 Cluster: Cutinase negative acting protein; n=2; ...    43   0.007
UniRef50_A1CJX8 Cluster: Glycine-rich RNA-binding protein, putat...    43   0.007
UniRef50_Q9GZT3 Cluster: SRA stem-loop-interacting RNA-binding p...    43   0.007
UniRef50_Q14498 Cluster: RNA-binding protein 39; n=55; Euteleost...    43   0.007
UniRef50_UPI0000EB42F3 Cluster: UPI0000EB42F3 related cluster; n...    43   0.010
UniRef50_Q6IRQ4 Cluster: MGC82187 protein; n=6; Tetrapoda|Rep: M...    43   0.010
UniRef50_Q9M9G6 Cluster: F14O23.18 protein; n=2; Arabidopsis tha...    43   0.010
UniRef50_Q8RWN5 Cluster: RNA-binding protein-like; n=3; Arabidop...    43   0.010
UniRef50_Q5ZAN0 Cluster: Putative uncharacterized protein OSJNBb...    43   0.010
UniRef50_Q01FM4 Cluster: FOG: RRM domain; n=1; Ostreococcus taur...    43   0.010
UniRef50_Q582F3 Cluster: RNA-binding protein, putative; n=1; Try...    43   0.010
UniRef50_Q54G90 Cluster: Putative uncharacterized protein; n=1; ...    43   0.010
UniRef50_Q54BM2 Cluster: RNA-binding region-containing protein; ...    43   0.010
UniRef50_Q18724 Cluster: Putative uncharacterized protein; n=2; ...    43   0.010
UniRef50_Q4PBV1 Cluster: Putative uncharacterized protein; n=1; ...    43   0.010
UniRef50_P49314 Cluster: 31 kDa ribonucleoprotein, chloroplast p...    43   0.010
UniRef50_Q9UUE4 Cluster: Peptidyl-prolyl cis-trans isomerase cyp...    43   0.010
UniRef50_UPI0000E22438 Cluster: PREDICTED: similar to Heterogene...    42   0.013
UniRef50_UPI0000211FC5 Cluster: PREDICTED: RNA binding motif pro...    42   0.013
UniRef50_O25501 Cluster: Ss-DNA binding protein 12RNP2; n=4; Hel...    42   0.013
UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce...    42   0.013
UniRef50_A4B4X2 Cluster: RNA-binding protein; n=1; Alteromonas m...    42   0.013
UniRef50_Q5ZAN1 Cluster: Putative uncharacterized protein OSJNBb...    42   0.013
UniRef50_Q109W0 Cluster: RNA recognition motif family protein, e...    42   0.013
UniRef50_Q014L5 Cluster: Cyclophilin-type peptidyl-prolyl cis-tr...    42   0.013
UniRef50_Q5CYN8 Cluster: Nop15p/nopp34; nucleolar protein with 1...    42   0.013
UniRef50_Q4XN28 Cluster: RNA binding protein, putative; n=6; Pla...    42   0.013
UniRef50_A7RRA7 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.013
UniRef50_A2DHF2 Cluster: Putative uncharacterized protein; n=2; ...    42   0.013
UniRef50_Q6CG61 Cluster: Similar to sp|P31209 Schizosaccharomyce...    42   0.013
UniRef50_Q4P7G1 Cluster: Putative uncharacterized protein; n=1; ...    42   0.013
UniRef50_O94290 Cluster: RNA-binding protein Cwf29; n=1; Schizos...    42   0.013
UniRef50_A1DEX9 Cluster: RNA binding domain protein; n=15; Peziz...    42   0.013
UniRef50_Q9ZQA8 Cluster: Probable polyadenylate-binding protein ...    42   0.013
UniRef50_UPI0000E47F77 Cluster: PREDICTED: hypothetical protein;...    42   0.017
UniRef50_Q9KVI6 Cluster: RNA-binding protein; n=17; Vibrionaceae...    42   0.017
UniRef50_Q2JQB3 Cluster: Putative RNA-binding protein; n=2; Syne...    42   0.017
UniRef50_Q3VI91 Cluster: RNA-binding region RNP-1; n=2; Bacteria...    42   0.017
UniRef50_Q8LFQ5 Cluster: RNA binding protein-like; n=4; Arabidop...    42   0.017
UniRef50_Q8GU29 Cluster: Glycin-rich RNA binding protein; n=6; c...    42   0.017
UniRef50_A7PXT7 Cluster: Chromosome chr15 scaffold_37, whole gen...    42   0.017
UniRef50_A7NYH5 Cluster: Chromosome chr6 scaffold_3, whole genom...    42   0.017
UniRef50_A2Y1R0 Cluster: Putative uncharacterized protein; n=7; ...    42   0.017
UniRef50_Q7RIJ3 Cluster: RNA recognition motif, putative; n=3; P...    42   0.017
UniRef50_Q70TB2 Cluster: Transformer-2 protein; n=1; Bactrocera ...    42   0.017
UniRef50_Q4QI29 Cluster: RNA-binding protein 5, putative; n=3; L...    42   0.017
UniRef50_A5K4S8 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_A0EG16 Cluster: Chromosome undetermined scaffold_94, wh...    42   0.017
UniRef50_Q6BY19 Cluster: Debaryomyces hansenii chromosome A of s...    42   0.017
UniRef50_Q09100 Cluster: RNA-binding protein rnp24; n=1; Schizos...    42   0.017
UniRef50_UPI000051A0F5 Cluster: PREDICTED: similar to Cleavage s...    42   0.022
UniRef50_UPI000065E5EA Cluster: Polyadenylate-binding protein 1-...    42   0.022
UniRef50_Q4TDL2 Cluster: Chromosome undetermined SCAF6181, whole...    42   0.022
UniRef50_Q67JJ7 Cluster: Glycine-rich RNA-binding protein; n=4; ...    42   0.022
UniRef50_Q7DHC0 Cluster: RNA-binding protein; n=7; Cyanobacteria...    42   0.022
UniRef50_A6GJJ1 Cluster: Probable nucleic acid-binding protein; ...    42   0.022
UniRef50_A6E941 Cluster: RNA binding protein; n=1; Pedobacter sp...    42   0.022
UniRef50_A7QII5 Cluster: Chromosome chr12 scaffold_103, whole ge...    42   0.022
UniRef50_A7PL41 Cluster: Chromosome chr7 scaffold_20, whole geno...    42   0.022
UniRef50_A5BLC5 Cluster: Putative uncharacterized protein; n=1; ...    42   0.022
UniRef50_Q9VHP3 Cluster: CG8021-PA; n=3; Diptera|Rep: CG8021-PA ...    42   0.022
UniRef50_Q4N6Y8 Cluster: RNA-binding protein, putative; n=2; The...    42   0.022
UniRef50_A7AQF7 Cluster: RNA recognition motif (RRM)-containing ...    42   0.022
UniRef50_A5K2K1 Cluster: RNA-binding protein, putative; n=8; Pla...    42   0.022
UniRef50_Q9UDG9 Cluster: ADP-RIBOSYLATED PROTEIN A.8=RIBONUCLEOP...    42   0.022
UniRef50_Q2UQ21 Cluster: Predicted protein; n=3; Pezizomycotina|...    42   0.022
UniRef50_P21187 Cluster: Polyadenylate-binding protein (Poly(A)-...    42   0.022
UniRef50_UPI000150A2AA Cluster: RNA binding protein; n=1; Tetrah...    41   0.029
UniRef50_UPI0000E4A54D Cluster: PREDICTED: hypothetical protein;...    41   0.029
UniRef50_UPI0000D9F579 Cluster: PREDICTED: similar to testes-spe...    41   0.029
UniRef50_UPI00004996C0 Cluster: RNA-binding protein; n=1; Entamo...    41   0.029
UniRef50_Q4S9B3 Cluster: Chromosome undetermined SCAF14699, whol...    41   0.029
UniRef50_Q8DIY8 Cluster: RNA binding protein; n=3; Cyanobacteria...    41   0.029
UniRef50_A6E8T2 Cluster: RNA-binding protein; n=1; Pedobacter sp...    41   0.029
UniRef50_Q8IE99 Cluster: Splicing factor, putative; n=1; Plasmod...    41   0.029
UniRef50_Q55D63 Cluster: Putative uncharacterized protein; n=1; ...    41   0.029
UniRef50_Q54NB8 Cluster: RNA-binding region-containing protein; ...    41   0.029
UniRef50_Q4D6R5 Cluster: Putative uncharacterized protein; n=2; ...    41   0.029
UniRef50_A7SSV8 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.029
UniRef50_A7SHQ6 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.029
UniRef50_A0CCB3 Cluster: Chromosome undetermined scaffold_167, w...    41   0.029
UniRef50_Q8SSA1 Cluster: NUCLEOLAR PROTEIN OF THE GAR FAMILY; n=...    41   0.029
UniRef50_Q6C6I9 Cluster: Yarrowia lipolytica chromosome E of str...    41   0.029
UniRef50_Q0CIN3 Cluster: Putative uncharacterized protein; n=1; ...    41   0.029
UniRef50_O74400 Cluster: RNA-binding protein; n=1; Schizosacchar...    41   0.029
UniRef50_A2QMQ9 Cluster: Function: AUF1 of H. sapiens is a compo...    41   0.029
UniRef50_P04147 Cluster: Polyadenylate-binding protein, cytoplas...    41   0.029
UniRef50_Q13310 Cluster: Polyadenylate-binding protein 4 (Poly(A...    41   0.029
UniRef50_O75526 Cluster: RNA-binding motif protein, X-linked-lik...    41   0.029
UniRef50_Q4RX96 Cluster: Chromosome 11 SCAF14979, whole genome s...    34   0.033
UniRef50_UPI0000E468DC Cluster: PREDICTED: hypothetical protein;...    41   0.039
UniRef50_UPI0000498B56 Cluster: RNA-binding protein; n=1; Entamo...    41   0.039
UniRef50_Q569S7 Cluster: LOC443584 protein; n=5; Xenopus|Rep: LO...    41   0.039
UniRef50_Q3B6Q3 Cluster: RNA-binding region RNP-1; n=6; Chlorobi...    41   0.039
UniRef50_A7MXD2 Cluster: Putative uncharacterized protein; n=1; ...    41   0.039
UniRef50_A3IQD4 Cluster: RNA-binding protein; n=1; Cyanothece sp...    41   0.039
UniRef50_Q9LZ65 Cluster: Rna binding protein-like; n=7; Magnolio...    41   0.039
UniRef50_Q67W00 Cluster: Putative RRM-containing protein; n=2; O...    41   0.039
UniRef50_Q5JJM4 Cluster: Peptidylprolyl cis-trans isomerase-like...    41   0.039
UniRef50_A2YQN8 Cluster: Putative uncharacterized protein; n=4; ...    41   0.039
UniRef50_Q5DA36 Cluster: SJCHGC06322 protein; n=3; Bilateria|Rep...    41   0.039
UniRef50_Q5CRM8 Cluster: T8M16_190-plant like protein with RRM d...    41   0.039
UniRef50_Q5CLX5 Cluster: Poly(A)-binding protein fabm; n=3; Cryp...    41   0.039
UniRef50_Q4D6X4 Cluster: Putative uncharacterized protein; n=2; ...    41   0.039
UniRef50_A7SN30 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.039
UniRef50_Q6FLF5 Cluster: Similar to sp|P53927 Saccharomyces cere...    41   0.039
UniRef50_Q5KP11 Cluster: Single-stranded DNA binding protein, pu...    41   0.039
UniRef50_Q4PAI2 Cluster: Putative uncharacterized protein; n=1; ...    41   0.039
UniRef50_Q2U508 Cluster: Predicted protein; n=7; Trichocomaceae|...    41   0.039
UniRef50_P78795 Cluster: Probable eukaryotic translation initiat...    41   0.039
UniRef50_UPI00004997F9 Cluster: RNA-binding protein; n=1; Entamo...    40   0.051
UniRef50_Q4T824 Cluster: Chromosome undetermined SCAF7912, whole...    40   0.051
UniRef50_Q9FVQ1 Cluster: NuM1 protein, putative; n=2; Arabidopsi...    40   0.051
UniRef50_Q10KP0 Cluster: RNA recognition motif family protein, e...    40   0.051
UniRef50_A3AAN7 Cluster: Putative uncharacterized protein; n=2; ...    40   0.051
UniRef50_A2YR27 Cluster: Putative uncharacterized protein; n=3; ...    40   0.051
UniRef50_Q7Q615 Cluster: ENSANGP00000020466; n=1; Anopheles gamb...    40   0.051
UniRef50_Q7K797 Cluster: Putative uncharacterized protein pab-1;...    40   0.051
UniRef50_Q5BW90 Cluster: SJCHGC05136 protein; n=1; Schistosoma j...    40   0.051
UniRef50_Q4UCX7 Cluster: RNA poly(A)-binding protein, putative; ...    40   0.051
UniRef50_Q4U9D6 Cluster: RNA binding protein, putative; n=2; The...    40   0.051
UniRef50_Q0ZAL4 Cluster: Nucleolar phosphoprotein; n=1; Bombyx m...    40   0.051
UniRef50_O96606 Cluster: Polyadenylate-binding protein 1; n=6; T...    40   0.051
UniRef50_A5K320 Cluster: Splicing factor, putative; n=5; Plasmod...    40   0.051
UniRef50_A1Z076 Cluster: ELAV-like protein; n=1; Bombyx mori|Rep...    40   0.051
UniRef50_Q7SGB3 Cluster: Predicted protein; n=5; Eukaryota|Rep: ...    40   0.051
UniRef50_Q6C6B0 Cluster: Similar to tr|O13829 Schizosaccharomyce...    40   0.051
UniRef50_Q0UE30 Cluster: Putative uncharacterized protein; n=1; ...    40   0.051
UniRef50_Q43349 Cluster: 29 kDa ribonucleoprotein, chloroplast p...    40   0.051
UniRef50_Q57014 Cluster: Putative RNA-binding protein rbpA; n=70...    40   0.051
UniRef50_Q8JIY8 Cluster: MKI67 FHA domain-interacting nucleolar ...    40   0.051
UniRef50_O04425 Cluster: Flowering time control protein FCA; n=1...    40   0.051
UniRef50_UPI0001555B84 Cluster: PREDICTED: similar to PP239 prot...    40   0.068
UniRef50_UPI0000E47D9B Cluster: PREDICTED: similar to TIA1 cytot...    40   0.068
UniRef50_UPI0000E1183F Cluster: hypothetical protein OM2255_1662...    40   0.068
UniRef50_UPI000065DD25 Cluster: Nucleolin (Protein C23).; n=1; T...    40   0.068
UniRef50_Q7ZUX2 Cluster: Cstf2 protein; n=2; Danio rerio|Rep: Cs...    40   0.068
UniRef50_P73557 Cluster: RNA-binding protein; n=2; Chroococcales...    40   0.068
UniRef50_A1ST31 Cluster: RNP-1 like RNA-binding protein; n=7; Ga...    40   0.068
UniRef50_Q9SX80 Cluster: F16N3.23 protein; n=12; Magnoliophyta|R...    40   0.068
UniRef50_Q9FJE9 Cluster: Similarity to RNA binding protein; n=2;...    40   0.068
UniRef50_Q7XLQ4 Cluster: OSJNBa0044M19.2 protein; n=2; Oryza sat...    40   0.068
UniRef50_Q762A1 Cluster: BRI1-KD interacting protein 113; n=4; O...    40   0.068
UniRef50_Q018Z0 Cluster: RNA binding protein; n=3; Ostreococcus|...    40   0.068
UniRef50_A2WN71 Cluster: Putative uncharacterized protein; n=2; ...    40   0.068
UniRef50_Q9VZE4 Cluster: CG1316-PA; n=5; Diptera|Rep: CG1316-PA ...    40   0.068
UniRef50_Q54QQ7 Cluster: Putative RNA splicing factor; n=1; Dict...    40   0.068
UniRef50_Q4U9S0 Cluster: RNA-binding protein, putative; n=2; The...    40   0.068
UniRef50_Q4QA46 Cluster: RNA-binding protein, putative, UPB1; n=...    40   0.068
UniRef50_Q4QA43 Cluster: RNA-binding protein, putative; n=3; Lei...    40   0.068
UniRef50_Q6ZP53 Cluster: CDNA FLJ26493 fis, clone KDN06317, high...    40   0.068
UniRef50_Q96V40 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    40   0.068
UniRef50_Q6BM70 Cluster: Debaryomyces hansenii chromosome F of s...    40   0.068
UniRef50_Q4PFD1 Cluster: Putative uncharacterized protein; n=1; ...    40   0.068
UniRef50_A4RHX9 Cluster: Putative uncharacterized protein; n=2; ...    40   0.068
UniRef50_A2QQZ9 Cluster: Similarity to oligouridylate binding pr...    40   0.068
UniRef50_O14102 Cluster: Spliceosome-associated protein 49; n=2;...    40   0.068
UniRef50_Q99069 Cluster: Glycine-rich RNA-binding protein 1; n=4...    40   0.068
UniRef50_Q804A9 Cluster: Deleted in azoospermia-like; n=14; Tetr...    40   0.068
UniRef50_UPI0000E4A88D Cluster: PREDICTED: similar to MGC88935 p...    40   0.089
UniRef50_UPI0000E4A86C Cluster: PREDICTED: hypothetical protein,...    40   0.089
UniRef50_UPI0000E47984 Cluster: PREDICTED: similar to RNA bindin...    40   0.089
UniRef50_Q1PEP5 Cluster: Nucleolin; n=2; Arabidopsis thaliana|Re...    40   0.089
UniRef50_Q10N84 Cluster: RNA-binding protein, putative, expresse...    40   0.089
UniRef50_Q0D9E5 Cluster: Os06g0724600 protein; n=3; Oryza sativa...    40   0.089
UniRef50_A4RWB3 Cluster: Predicted protein; n=2; Ostreococcus|Re...    40   0.089
UniRef50_A3BFI4 Cluster: Putative uncharacterized protein; n=4; ...    40   0.089
UniRef50_Q7QGW8 Cluster: ENSANGP00000012477; n=2; Anopheles gamb...    40   0.089
UniRef50_Q54Y98 Cluster: RNA-binding region-containing protein; ...    40   0.089
UniRef50_Q21900 Cluster: Putative uncharacterized protein tag-31...    40   0.089
UniRef50_Q1ECA2 Cluster: IP09238p; n=10; Coelomata|Rep: IP09238p...    40   0.089
UniRef50_Q9BU66 Cluster: MGC10433 protein; n=39; Eukaryota|Rep: ...    40   0.089
UniRef50_Q8SRE5 Cluster: CLEAVAGE STIMULATION FACTOR; n=2; Micro...    40   0.089
UniRef50_Q6BMT1 Cluster: Similar to CA5935|IPF2798 Candida albic...    40   0.089
UniRef50_Q0TVC9 Cluster: Putative uncharacterized protein; n=1; ...    40   0.089
UniRef50_A5E689 Cluster: Putative uncharacterized protein; n=1; ...    40   0.089
UniRef50_Q10422 Cluster: Uncharacterized RNA-binding protein C25...    40   0.089
UniRef50_Q9Y388 Cluster: RNA-binding motif protein, X-linked 2; ...    40   0.089
UniRef50_UPI0000E49171 Cluster: PREDICTED: hypothetical protein;...    39   0.12 
UniRef50_UPI0000E47201 Cluster: PREDICTED: similar to developmen...    39   0.12 
UniRef50_UPI00006CB36A Cluster: RNA binding motif protein; n=1; ...    39   0.12 
UniRef50_Q7U7Q8 Cluster: PutativeRNA-binding protein RbpD; n=9; ...    39   0.12 
UniRef50_A3XSE7 Cluster: RNA-binding protein; n=23; Gammaproteob...    39   0.12 
UniRef50_A0KRK6 Cluster: RNP-1-like RNA-binding protein; n=14; S...    39   0.12 
UniRef50_A0KJ75 Cluster: RNA-binding protein; n=5; Bacteria|Rep:...    39   0.12 
UniRef50_Q9SIX3 Cluster: Putative glycine-rich RNA-binding prote...    39   0.12 
UniRef50_Q9FFZ6 Cluster: Similarity to RNA-binding protein; n=2;...    39   0.12 
UniRef50_Q67XI5 Cluster: Putative uncharacterized protein At4g20...    39   0.12 
UniRef50_O64571 Cluster: Putative RNA-binding protein; n=3; Arab...    39   0.12 
UniRef50_A7QXI3 Cluster: Chromosome undetermined scaffold_225, w...    39   0.12 
UniRef50_A7PNK3 Cluster: Chromosome chr8 scaffold_23, whole geno...    39   0.12 
UniRef50_A5B3Z9 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_A4RUB8 Cluster: Predicted protein; n=2; Ostreococcus|Re...    39   0.12 
UniRef50_Q9VCY1 Cluster: CG6937-PA; n=3; Sophophora|Rep: CG6937-...    39   0.12 
UniRef50_Q8IP90 Cluster: CG31762-PB, isoform B; n=11; Coelomata|...    39   0.12 
UniRef50_Q7RDM4 Cluster: PolyA binding protein-related; n=5; Pla...    39   0.12 
UniRef50_Q5CSU2 Cluster: Cleavage stimulation factor subunit 2 t...    39   0.12 
UniRef50_Q552N9 Cluster: RNA-binding region-containing protein; ...    39   0.12 
UniRef50_Q4U8S8 Cluster: RNA-binding protein, putative; n=2; The...    39   0.12 
UniRef50_Q0H219 Cluster: Bruno-like; n=1; Schmidtea mediterranea...    39   0.12 
UniRef50_A7AWX7 Cluster: RNA recognition motif. (A.k.a. RRM, RBD...    39   0.12 
UniRef50_A7APK1 Cluster: RNA recognition motif domain containing...    39   0.12 
UniRef50_A1EAA0 Cluster: Polyadenylate-binding protein; n=3; Pla...    39   0.12 
UniRef50_A0BM94 Cluster: Chromosome undetermined scaffold_116, w...    39   0.12 
UniRef50_Q6BRG5 Cluster: Similar to CA0922|IPF12991 Candida albi...    39   0.12 
UniRef50_A6SJV1 Cluster: Putative uncharacterized protein; n=2; ...    39   0.12 
UniRef50_A6S9X8 Cluster: Putative uncharacterized protein; n=2; ...    39   0.12 
UniRef50_A5DBG2 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q10355 Cluster: Uncharacterized RNA-binding protein C22...    39   0.12 
UniRef50_UPI00015B621E Cluster: PREDICTED: hypothetical protein;...    39   0.16 
UniRef50_UPI00015B552E Cluster: PREDICTED: similar to bruno; n=1...    39   0.16 
UniRef50_UPI0000E476D6 Cluster: PREDICTED: hypothetical protein;...    39   0.16 
UniRef50_UPI0000D578A0 Cluster: PREDICTED: similar to CG12870-PA...    39   0.16 
UniRef50_UPI00006CB791 Cluster: hypothetical protein TTHERM_0034...    39   0.16 
UniRef50_A0WC53 Cluster: RNA-binding region RNP-1; n=2; Desulfur...    39   0.16 
UniRef50_Q9LU44 Cluster: Similarity to transcription or splicing...    39   0.16 
UniRef50_Q7XTU5 Cluster: OSJNBb0034I13.9 protein; n=4; Oryza sat...    39   0.16 
UniRef50_Q2V9B8 Cluster: RNA-binding protein AKIP1-like; n=1; So...    39   0.16 
UniRef50_Q0JFK8 Cluster: Os01g0974600 protein; n=4; Liliopsida|R...    39   0.16 
UniRef50_A7QJZ9 Cluster: Chromosome undetermined scaffold_109, w...    39   0.16 
UniRef50_A3QQP3 Cluster: Chloroplast single strand DNA binding p...    39   0.16 
UniRef50_Q8I2Y5 Cluster: RNA-binding protein, putative; n=4; Pla...    39   0.16 
UniRef50_Q6TMI9 Cluster: RNA-binding protein; n=3; Dictyostelium...    39   0.16 
UniRef50_Q5I705 Cluster: Transformer 2; n=2; Endopterygota|Rep: ...    39   0.16 
UniRef50_Q4QAF2 Cluster: Putative uncharacterized protein; n=5; ...    39   0.16 
UniRef50_Q4N5B6 Cluster: Spliceosome associated protein, putativ...    39   0.16 
UniRef50_A7ARN5 Cluster: Ser/Arg-rich splicing factor, putative;...    39   0.16 
UniRef50_Q7SBX5 Cluster: Putative uncharacterized protein NCU085...    39   0.16 
UniRef50_Q752C6 Cluster: AFR649Wp; n=1; Eremothecium gossypii|Re...    39   0.16 
UniRef50_Q6BPQ5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    39   0.16 
UniRef50_A7TF54 Cluster: Putative uncharacterized protein; n=1; ...    39   0.16 
UniRef50_A4RNA8 Cluster: Putative uncharacterized protein; n=1; ...    39   0.16 
UniRef50_Q44560 Cluster: Putative RNA-binding protein rbpA; n=4;...    39   0.16 
UniRef50_P38922 Cluster: Protein HRB1; n=6; Saccharomycetales|Re...    39   0.16 
UniRef50_P26378 Cluster: ELAV-like protein 4; n=100; Euteleostom...    39   0.16 
UniRef50_UPI0000E4688E Cluster: PREDICTED: similar to La ribonuc...    38   0.21 
UniRef50_UPI0000D5678A Cluster: PREDICTED: similar to CG10466-PA...    38   0.21 
UniRef50_UPI0000D561E7 Cluster: PREDICTED: similar to CG32062-PD...    38   0.21 
UniRef50_UPI0000EB05D2 Cluster: TAR DNA-binding protein 43 (TDP-...    38   0.21 
UniRef50_Q7ZT82 Cluster: RNA-binding protein; n=2; Danio rerio|R...    38   0.21 
UniRef50_Q66KL9 Cluster: MGC79565 protein; n=3; Xenopus|Rep: MGC...    38   0.21 
UniRef50_Q4S8P1 Cluster: Chromosome 7 SCAF14703, whole genome sh...    38   0.21 
UniRef50_Q8EZU3 Cluster: RNA-binding protein; n=4; Leptospira|Re...    38   0.21 
UniRef50_Q74DJ2 Cluster: RNA-binding protein; n=2; Geobacter|Rep...    38   0.21 
UniRef50_A6VVI5 Cluster: RNP-1 like RNA-binding protein; n=3; Ga...    38   0.21 
UniRef50_Q9SAB3 Cluster: F25C20.21 protein; n=39; Magnoliophyta|...    38   0.21 
UniRef50_Q6ERT8 Cluster: Epstein-Barr virus EBNA-1-like protein;...    38   0.21 
UniRef50_Q3E9P9 Cluster: Uncharacterized protein At4g36690.3; n=...    38   0.21 
UniRef50_O23212 Cluster: Splicing factor-like protein; n=22; Euk...    38   0.21 
UniRef50_A7NXI6 Cluster: Chromosome chr5 scaffold_2, whole genom...    38   0.21 
UniRef50_A2X3A5 Cluster: Putative uncharacterized protein; n=2; ...    38   0.21 
UniRef50_Q9VF55 Cluster: CG5213-PA; n=1; Drosophila melanogaster...    38   0.21 
UniRef50_Q9U2F5 Cluster: Putative uncharacterized protein; n=2; ...    38   0.21 
UniRef50_Q5CWM4 Cluster: U2 snRNP. Hsh49p, RRM domain containing...    38   0.21 
UniRef50_Q55GD6 Cluster: RNA-binding region-containing protein; ...    38   0.21 
UniRef50_Q54J52 Cluster: Putative uncharacterized protein; n=1; ...    38   0.21 
UniRef50_Q54EJ3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.21 
UniRef50_Q54D57 Cluster: Putative uncharacterized protein; n=1; ...    38   0.21 
UniRef50_Q4N6G9 Cluster: RNA-binding protein, putative; n=2; The...    38   0.21 
UniRef50_Q245K5 Cluster: Putative uncharacterized protein; n=1; ...    38   0.21 
UniRef50_Q20084 Cluster: Putative uncharacterized protein exc-7;...    38   0.21 
UniRef50_A4V6M1 Cluster: Bruno-like protein; n=1; Dugesia japoni...    38   0.21 
UniRef50_A0EH21 Cluster: Chromosome undetermined scaffold_96, wh...    38   0.21 
UniRef50_Q5JUB2 Cluster: ELAV (Embryonic lethal, abnormal vision...    38   0.21 
UniRef50_Q4P7H4 Cluster: Putative uncharacterized protein; n=1; ...    38   0.21 
UniRef50_P53927 Cluster: Uncharacterized RNA-binding protein YNL...    38   0.21 
UniRef50_P41891 Cluster: Protein gar2; n=12; Ascomycota|Rep: Pro...    38   0.21 
UniRef50_UPI00015B6013 Cluster: PREDICTED: similar to GA12086-PA...    38   0.27 

>UniRef50_Q5TTQ2 Cluster: ENSANGP00000026814; n=3;
           Endopterygota|Rep: ENSANGP00000026814 - Anopheles
           gambiae str. PEST
          Length = 358

 Score =  145 bits (351), Expect = 1e-33
 Identities = 62/85 (72%), Positives = 78/85 (91%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVMKDPKTKRS+GFGFITYS+++M+D+AQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 50  WGKVVDVVVMKDPKTKRSRGFGFITYSKSYMIDDAQASRPHKIDGRVVEPKRAVPRQDIN 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RPEA ++VKKLFV GL+ D +EE L
Sbjct: 110 RPEAGSSVKKLFVGGLRDDFDEEHL 134



 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 35/51 (68%), Positives = 45/51 (88%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           LREYFS +GN++S  +VTDK+ GKKRGFGFVEFDDYDPVD++ LQ++H I+
Sbjct: 134 LREYFSKYGNVISACIVTDKDNGKKRGFGFVEFDDYDPVDKIILQKSHTIQ 184



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 22/35 (62%), Positives = 27/35 (77%)
 Frame = +1

Query: 163 DYEEPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           +  EPEH RKLFIGGLDYRTTD +LK ++E   K+
Sbjct: 19  EIREPEHLRKLFIGGLDYRTTDDTLKAYFEKWGKV 53



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 14/61 (22%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G ++   ++ D    + +GFGF+ +     VD+    + H I  ++++ K+A+P++++ 
Sbjct: 141 YGNVISACIVTDKDNGKKRGFGFVEFDDYDPVDKIILQKSHTIQNKLLDVKKALPKQDMD 200

Query: 435 R 437
           R
Sbjct: 201 R 201



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ YF  +G +V V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 43  LKAYFEKWGKVVDVVVMKDPKTKRSRGFGFITYSKSYMIDDAQASRPHKI 92


>UniRef50_P48810 Cluster: Heterogeneous nuclear ribonucleoprotein
           87F; n=16; Coelomata|Rep: Heterogeneous nuclear
           ribonucleoprotein 87F - Drosophila melanogaster (Fruit
           fly)
          Length = 385

 Score =  143 bits (347), Expect = 4e-33
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>UniRef50_Q86ER1 Cluster: Clone ZZD1516 mRNA sequence; n=2;
           Schistosoma japonicum|Rep: Clone ZZD1516 mRNA sequence -
           Schistosoma japonicum (Blood fluke)
          Length = 313

 Score =  124 bits (298), Expect = 3e-27
 Identities = 56/85 (65%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WGEIVDVVVMKD +T RS+GFGFITY +  MVD AQ NRPH+IDG+ VE KRA+PRE+  
Sbjct: 40  WGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEIDGKTVEAKRAMPREDSN 99

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            PE+  TV KLFV GLK+D+  E+L
Sbjct: 100 SPESHMTVTKLFVGGLKKDVTHEEL 124



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 31/50 (62%), Positives = 36/50 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYFS +GNI    VV  KE+G+ RGFGFV FDDYDPVD+  L + H I
Sbjct: 124 LREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHI 173



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +L++++S +G IV V V+ D  T + RGFGF+ + + + VD     + H+I
Sbjct: 32  KLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRPHEI 82



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G I +  V+   ++  S+GFGF+T+     VD+A   +PH I     + K+A+ +E+I
Sbjct: 131 YGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILYKPHHIGSSRADVKKALSKEQI 189



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +1

Query: 133 LNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           +  + SE+ D     E  RKLFIGGL   TT++ LK+FY
Sbjct: 1   MGRRNSENND--RRTEQFRKLFIGGLTPLTTEAKLKDFY 37


>UniRef50_UPI00015560CE Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A1; n=4; Mammalia|Rep:
           PREDICTED: similar to heterogeneous nuclear
           ribonucleoprotein A1 - Ornithorhynchus anatinus
          Length = 280

 Score =  122 bits (294), Expect = 1e-26
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>UniRef50_P09651 Cluster: Heterogeneous nuclear ribonucleoprotein
           A1; n=390; Euteleostomi|Rep: Heterogeneous nuclear
           ribonucleoprotein A1 - Homo sapiens (Human)
          Length = 372

 Score =  122 bits (294), Expect = 1e-26
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>UniRef50_Q66IT0 Cluster: MGC84815 protein; n=1; Xenopus laevis|Rep:
           MGC84815 protein - Xenopus laevis (African clawed frog)
          Length = 291

 Score =  118 bits (285), Expect = 1e-25
 Identities = 52/85 (61%), Positives = 68/85 (80%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WGEI DVVVMKDP++ +S+GFGF+T+ +A  VD+AQ +RPHK+DG+ V+ KRA+PREE  
Sbjct: 36  WGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQADRPHKVDGKDVDSKRAMPREETS 95

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            PE  A VKK+FV GLK+D+  EDL
Sbjct: 96  -PEVHAAVKKIFVGGLKKDVTNEDL 119



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 26/50 (52%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L EYF  FGN+   S+V  K+T   RGF FV FDD D VD+V L + H I
Sbjct: 119 LAEYFGKFGNVTDASIVVAKDTNTSRGFAFVTFDDTDSVDKVILARPHMI 168



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G + D  ++    T  S+GF F+T+     VD+    RPH I G   + ++A+ REE++
Sbjct: 126 FGNVTDASIVVAKDTNTSRGFAFVTFDDTDSVDKVILARPHMIGGHKADVRKALSREELR 185

Query: 435 R 437
           +
Sbjct: 186 K 186



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR Y+S +G I  V V+ D  + K RGFGFV F +   VD+    + H++
Sbjct: 29  LRAYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQADRPHKV 78


>UniRef50_P51991 Cluster: Heterogeneous nuclear ribonucleoprotein
           A3; n=98; Coelomata|Rep: Heterogeneous nuclear
           ribonucleoprotein A3 - Homo sapiens (Human)
          Length = 378

 Score =  117 bits (281), Expect = 4e-25
 Identities = 52/85 (61%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP+TKRS+GFGF+TYS    VD A   RPHK+DGR+VEPKRAV RE+  
Sbjct: 58  WGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSV 117

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKK+FV G+K+D EE +L
Sbjct: 118 KPGAHLTVKKIFVGGIKEDTEEYNL 142



 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           LR+YF  +G I ++ V+ D+++GKKRGF FV FDD+D VD++ +Q+ H I   N  + KK
Sbjct: 142 LRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEV-KK 200

Query: 686 PISE 697
            +S+
Sbjct: 201 ALSK 204



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E G D +EPE  RKLFIGGL + TTD SL+E +E
Sbjct: 23  EEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE 56



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/60 (30%), Positives = 37/60 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + VM+D ++ + +GF F+T+     VD+    + H I+G   E K+A+ ++E++
Sbjct: 149 YGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQ 208



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LRE+F  +G +    V+ D +T + RGFGFV +   + VD     + H++
Sbjct: 51  LREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKV 100


>UniRef50_Q02926 Cluster: Ribonucleoprotein RB97D; n=7;
           Sophophora|Rep: Ribonucleoprotein RB97D - Drosophila
           melanogaster (Fruit fly)
          Length = 471

 Score =  113 bits (273), Expect = 3e-24
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>UniRef50_UPI00005A4DCF Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP-1) (Topoisomerase-inhibitor
           suppressed); n=2; Canis lupus familiaris|Rep: PREDICTED:
           similar to Heterogeneous nuclear ribonucleoprotein A1
           (Helix-destabilizing protein) (Single-strand binding
           protein) (hnRNP core protein A1) (HDP-1)
           (Topoisomerase-inhibitor suppressed) - Canis familiaris
          Length = 433

 Score =  108 bits (259), Expect = 2e-22
 Identities = 47/85 (55%), Positives = 61/85 (71%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG ++D V M+DP TK S+GFGF+ Y+    VD A   RPHK+DGR+VE KRAV +E+ +
Sbjct: 78  WGMLIDCVAMRDPNTKLSRGFGFVMYATMEEVDAAMKARPHKVDGRVVERKRAVSQEDSQ 137

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 138 RPGAHLTVKKIFVGGIKEDTEEHHL 162



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 31/77 (40%), Positives = 47/77 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           LR YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N  + +K
Sbjct: 162 LRYYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNDHNCEV-RK 220

Query: 686 PISEN*HVWAGVMIRGG 736
            +S+     A    RGG
Sbjct: 221 ALSKQEMASASSSQRGG 237



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 15/65 (23%), Positives = 35/65 (53%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++    E ++A+ ++E+ 
Sbjct: 169 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNDHNCEVRKALSKQEMA 228

Query: 435 RPEAS 449
              +S
Sbjct: 229 SASSS 233



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G ++    + D  T   RGFGFV +   + VD     + H++
Sbjct: 71  LRSHFEQWGMLIDCVAMRDPNTKLSRGFGFVMYATMEEVDAAMKARPHKV 120


>UniRef50_Q22037 Cluster: Heterogeneous nuclear ribonucleoprotein
           A1; n=5; Caenorhabditis|Rep: Heterogeneous nuclear
           ribonucleoprotein A1 - Caenorhabditis elegans
          Length = 346

 Score =  103 bits (247), Expect = 5e-21
 Identities = 44/85 (51%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D++VM+DP TKRS+GFGF+T+S    VD A   RPH IDG+ V+PKRAVPR++  
Sbjct: 46  FGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN 105

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R E++ + K+L+V+G+++D  E+ L
Sbjct: 106 RSESNVSTKRLYVSGVREDHTEDML 130



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    L EYF+ +G +    ++ DK T K RGFGFV FDD+D VD+  LQ++H +
Sbjct: 125 HTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMV 179



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +RE++S FG I  + V+ D  T + RGFGFV F     VD    Q+ H I
Sbjct: 39  MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHII 88



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = +1

Query: 154 SGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY-EHGE 261
           SGD   EPE+ RK+F+GGL   TTD  ++EFY + GE
Sbjct: 12  SGDASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGE 48



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 13/63 (20%), Positives = 35/63 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +    ++ D  T++ +GFGF+T+     VD+    + H ++G   + ++ + ++E+ 
Sbjct: 137 YGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMS 196

Query: 435 RPE 443
           + +
Sbjct: 197 KAQ 199


>UniRef50_Q13151 Cluster: Heterogeneous nuclear ribonucleoprotein
           A0; n=22; Mammalia|Rep: Heterogeneous nuclear
           ribonucleoprotein A0 - Homo sapiens (Human)
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>UniRef50_Q4SQV2 Cluster: Chromosome 1 SCAF14529, whole genome
           shotgun sequence; n=10; Euteleostomi|Rep: Chromosome 1
           SCAF14529, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 487

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 43/85 (50%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G + D VV+ + + +RS+ FGF+TYS     D A   RPH +DG  VE KRAV RE+  
Sbjct: 28  FGTLTDCVVVVNKQVQRSRCFGFVTYSTPEEADSAMAARPHTVDGNPVEVKRAVAREDAG 87

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +PEA A VKK+FV GLK D EE  L
Sbjct: 88  KPEALAKVKKIFVGGLKDDTEENHL 112



 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 39/85 (45%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++ D VV+K+ +  RS+ FGFITYS     D A    PH +DG  VE KRAV R++  
Sbjct: 281 YGQLSDCVVVKNKELGRSRCFGFITYSTPEEADSAMAASPHVVDGHNVELKRAVARQDAD 340

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            PE  A VKK+FV G++  +E E L
Sbjct: 341 NPEVLANVKKIFVGGVQDHVEAEHL 365



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 37/82 (45%), Positives = 48/82 (58%), Gaps = 2/82 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG I    V++DKETGKKRGFGFV F D D  D+  + + H I    + + KK
Sbjct: 112 LTEHFSQFGEIEKAEVISDKETGKKRGFGFVYFVDQDSADKSVVIKFHTINGHKVEV-KK 170

Query: 686 PISEN*HVWAGVMIRGG--PRS 745
            +++     AG   RGG  PRS
Sbjct: 171 ALTKQELQAAG---RGGMAPRS 189



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L +YFS FG +    +++DK TGKKRGFGFV F D D   +  L + H I
Sbjct: 365 LTDYFSQFGAVEKAEIISDKLTGKKRGFGFVFFVDTDSATKAVLTRYHTI 414



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 19/60 (31%), Positives = 36/60 (60%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI    V+ D +T + +GFGF+ +      D++   + H I+G  VE K+A+ ++E++
Sbjct: 119 FGEIEKAEVISDKETGKKRGFGFVYFVDQDSADKSVVIKFHTINGHKVEVKKALTKQELQ 178



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 17/59 (28%), Positives = 31/59 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D  T + +GFGF+ +       +A   R H I G  VE K+A+ ++E+
Sbjct: 372 FGAVEKAEIISDKLTGKKRGFGFVFFVDTDSATKAVLTRYHTISGNKVEAKKAMTKQEM 430



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR++F  FG +    VV +K+  + R FGFV +   +  D     + H +
Sbjct: 21  LRKHFEQFGTLTDCVVVVNKQVQRSRCFGFVTYSTPEEADSAMAARPHTV 70


>UniRef50_A7RG33 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 177

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 40/86 (46%), Positives = 56/86 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVD V+MK  +  RS+GFGF+TY  +  V+E    + H +D R +EPKR+VPR+E  
Sbjct: 23  WGTIVDCVIMK--RDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESG 80

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
            PEA +  +K+FV GL     EED++
Sbjct: 81  APEAMSKTRKIFVGGLASTTVEEDIK 106



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           L++YFS +G IV   ++  K  G+ RGFGFV ++  D V+ V  +++H
Sbjct: 16  LKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDH 61



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = +2

Query: 506 LREYFSTF------GNIVSVSVVTDKETGKK-RGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++EYF++       G ++ V +  D++  K+ RGF FV FD+ + V++VC  + H+I+
Sbjct: 105 IKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIR 162



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKD-PKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           GE++DV + +D    KR +GF F+T+    +V++    + H+I  +  E K+A P+
Sbjct: 119 GEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174


>UniRef50_A4V6N1 Cluster: HnRNP A2/B1 protein; n=1; Dugesia
           japonica|Rep: HnRNP A2/B1 protein - Dugesia japonica
           (Planarian)
          Length = 386

 Score = 86.6 bits (205), Expect = 6e-16
 Identities = 34/86 (39%), Positives = 58/86 (67%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++ DVV M+D    +S+GFGF+ + +A  VD  Q  RPH++ G+IV+ KRA+P+EE  
Sbjct: 41  YGDVCDVVAMRDKTGNKSRGFGFVVFKEAESVDRCQAERPHQLLGKIVDTKRAMPKEESL 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
            P+     K++F+ G+++   E+DL+
Sbjct: 101 NPDIHCNSKRIFIGGIRRFFTEDDLK 126



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/51 (47%), Positives = 33/51 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L++YFSTFG IV  ++  D  +G  RGF F+ F D D VD+V L + H I+
Sbjct: 125 LKDYFSTFGEIVDCTIKRDNVSGLSRGFAFITFTDRDIVDKVILSKPHAIR 175



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +R+YFS +G++  V  + DK   K RGFGFV F + + VDR   ++ HQ+
Sbjct: 34  MRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEAESVDRCQAERPHQL 83



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 23/61 (37%), Positives = 40/61 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEIVD  + +D  +  S+GF FIT++   +VD+   ++PH I   IV+ K+A+  EE++
Sbjct: 132 FGEIVDCTIKRDNVSGLSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 191

Query: 435 R 437
           +
Sbjct: 192 Q 192


>UniRef50_UPI0000DA279E Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand RNA-binding protein) (hnRNP core
           protein A1) (HDP); n=1; Rattus norvegicus|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand RNA-binding protein) (hnRNP core protein
           A1) (HDP) - Rattus norvegicus
          Length = 131

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 37/79 (46%), Positives = 51/79 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D  VM+DP TKR + FGF+T +    VD A N+RPHK+DGR+V+PKR V RE+ +
Sbjct: 29  WGTLTDCAVMRDPNTKRFRVFGFVTCATVVEVDVAVNSRPHKVDGRVVDPKRTVSREDSQ 88

Query: 435 RPEASATVKKLFVAGLKQD 491
           +P  S  +   F   +K D
Sbjct: 89  KPVYSEVIFVDFPNSVKLD 107


>UniRef50_Q8WSM6 Cluster: Putative uncharacterized protein; n=4;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 336

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 29/59 (49%), Positives = 45/59 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           WG +VD +V++DP TK S+GFGF+T++     + A N+RPHK+ G+ V+ KRA+PRE++
Sbjct: 93  WGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKLGGKTVDSKRAIPREQM 151



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR YF TFG +  V ++     G+ RG GFV ++D +  DR CL  N
Sbjct: 185 LRVYFETFGTLDQVEIL-----GQPRGLGFVIYEDKESADR-CLAHN 225



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +L  YFS +G +V   V+ D  T   RGFGFV F
Sbjct: 85  QLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTF 118



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 166 YEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           ++ P   RKLFIGGL + TTD  L  ++
Sbjct: 63  HDSPPQLRKLFIGGLSHDTTDEQLGNYF 90


>UniRef50_Q9VVE5 Cluster: CG32169-PA; n=9; Endopterygota|Rep:
           CG32169-PA - Drosophila melanogaster (Fruit fly)
          Length = 369

 Score = 79.4 bits (187), Expect = 9e-14
 Identities = 37/87 (42%), Positives = 55/87 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I + +VMKDP T+RS+GFGF+T+S  + VD+      H++DG+ V+PK A PR    
Sbjct: 52  YGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR--A 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
            P+     KK+FV GL      ED++S
Sbjct: 110 HPKMVTRTKKIFVGGLSAPTTLEDVKS 136



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/50 (44%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  +G+I    V+ D  T + RGFGFV F D + VD+V  Q  H++
Sbjct: 45  LRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHEL 94



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G I D ++M D +T R +GFGF+T+    +VD+      H+I+ ++VE K+A
Sbjct: 134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKA 193

Query: 414 VPRE 425
            P+E
Sbjct: 194 QPKE 197



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ YF  FG I    ++ DK+T + RGFGFV F   D VD+VC    H+I
Sbjct: 134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEI 183


>UniRef50_Q8MS04 Cluster: RH49436p; n=9; Endopterygota|Rep: RH49436p
           - Drosophila melanogaster (Fruit fly)
          Length = 634

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 35/94 (37%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + DV++MKDP T+RS+GFGFIT+ +   V++      H +DG+ ++PK A
Sbjct: 219 LKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHA 278

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+    RP  +   KK+FV G+ QD   E++++
Sbjct: 279 TPK---NRPRQANKTKKIFVGGVSQDTSAEEVKA 309



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ YFS FG +    ++ D++T + RGFGFV F++ D VDRVC    H IK
Sbjct: 307 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIK 357



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + + V++ D +TKR +GFGF+T+    +VD       H I  + VE K+A
Sbjct: 307 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKA 366

Query: 414 VPREEIKRPEASATVKKLFVAGL 482
            P+E +  P A    K++ +  L
Sbjct: 367 QPKEAV-TPAAQLLQKRIMLGTL 388



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +L+EYF+ FG +  V ++ D  T + RGFGF+ F +   V++V
Sbjct: 218 KLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKV 260


>UniRef50_A7SSE1 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 164

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 36/88 (40%), Positives = 55/88 (62%), Gaps = 2/88 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ D V+M DP TKRS+ FGFIT+    +V    +++PH++DG++++PK AVPR   +
Sbjct: 24  YGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQ 83

Query: 435 RPEASATVK--KLFVAGLKQDIEEEDLE 512
            P         K+FV GL     ++DLE
Sbjct: 84  GPPQGNQNNEFKIFVGGLAHSTSKQDLE 111



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 22/53 (41%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L +YF+ +G +VSV+++ D +T K RGFGFV F+  D V +   +  HQI
Sbjct: 107 KQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQI 159



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/49 (38%), Positives = 34/49 (69%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIV 398
           A+G++V V +M DP+T++ +GFGF+T+     V +A +   H+I+G+ V
Sbjct: 116 AYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ YF  +G +    ++TD  T + R FGF+ F D   V  V   + HQ+
Sbjct: 17  LQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQL 66


>UniRef50_A7SIF0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 190

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 37/91 (40%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQ----AHMVDEAQNNRPHKIDGRIVEPKRAVP 419
           A+GE+ DVVV+ D  TK+S+GFG++T++      +++ +   N  H+IDG+ VE KRA+P
Sbjct: 36  AYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIP 95

Query: 420 REEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           R++        T KK+FV GL +D  +ED++
Sbjct: 96  RDDNSATSHEKT-KKIFVGGLPEDATKEDIQ 125



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           LREYF  +G +  V V+ D  T K RGFG+V F DY
Sbjct: 30  LREYFEAYGELTDVVVICDSATKKSRGFGYVTFADY 65



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +3

Query: 267 VDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           VD+++ K+ +TK  +GF F+  +     DE    +   + G++VE K+A PR+
Sbjct: 139 VDLIMKKEDETKH-RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRD 190


>UniRef50_Q21911 Cluster: Putative uncharacterized protein msi-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein msi-1 - Caenorhabditis elegans
          Length = 320

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 34/86 (39%), Positives = 55/86 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + +VM+DP TKR++GFGFIT+     VD+  NNR H++DG+ ++PK A P+    
Sbjct: 68  FGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKR--T 125

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           + +     KK+F+ GL      ED++
Sbjct: 126 QAKLVTKTKKVFIGGLSATSTLEDMK 151



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 22/64 (34%), Positives = 41/64 (64%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T+R +GFGF+T+    + D+      H+I+G++VE K+A
Sbjct: 150 MKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKA 209

Query: 414 VPRE 425
            P+E
Sbjct: 210 QPKE 213



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF T+G +    ++ DK T + RGFGFV FD  +  D+VC    H+I
Sbjct: 150 MKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEI 199



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  FG +    V+ D  T + RGFGF+ F D   VD+V   + H++
Sbjct: 61  LRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHEL 110


>UniRef50_O94432 Cluster: mRNA cleavage factor complex subunit; n=1;
           Schizosaccharomyces pombe|Rep: mRNA cleavage factor
           complex subunit - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 474

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 35/87 (40%), Positives = 56/87 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++D  VM+D  T RS+GFGF+T+     V+E   ++ H +DG+I++PKRA+PREE +
Sbjct: 186 FGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVM-SKEHHLDGKIIDPKRAIPREEQE 244

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           +        K+FV G+  D  EE+  +
Sbjct: 245 K------TAKMFVGGVPGDCTEEEFRN 265



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 1/61 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G ++D  +M D  T R +GFGF+TY     V EA  ++P+  I G+ VE KRA P+  +
Sbjct: 270 FGRVLDATLMMDKDTGRPRGFGFVTYENESAV-EATMSQPYITIHGKPVEVKRATPKASL 328

Query: 432 K 434
           +
Sbjct: 329 R 329



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR+YF  FG ++  +V+ D  TG+ RGFGF+ F +   V+ V  +++H
Sbjct: 179 LRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVMSKEHH 226



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 16/44 (36%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           R +F+ FG ++  +++ DK+TG+ RGFGFV +++   V+    Q
Sbjct: 264 RNFFNQFGRVLDATLMMDKDTGRPRGFGFVTYENESAVEATMSQ 307



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 15/27 (55%), Positives = 22/27 (81%), Gaps = 1/27 (3%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYEH-GEKL 267
           K+FIGGL++ TTD SL++++E  GE L
Sbjct: 164 KMFIGGLNWETTDDSLRDYFEQFGEVL 190


>UniRef50_Q8CD63 Cluster: 13 days embryo male testis cDNA, RIKEN
           full-length enriched library, clone:6030413L18
           product:Musashi homolog 2 (Drosophila), full insert
           sequence; n=3; Deuterostomia|Rep: 13 days embryo male
           testis cDNA, RIKEN full-length enriched library,
           clone:6030413L18 product:Musashi homolog 2 (Drosophila),
           full insert sequence - Mus musculus (Mouse)
          Length = 192

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI + +VM+DP TKRS+GFGF+T++    VD+      H++D + ++PK A PR    
Sbjct: 44  FGEIRECMVMRDPTTKRSRGFGFVTFTDPASVDKVLGQPHHELDSKTIDPKVAFPRR--A 101

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +P+     KK+FV GL  +   ED++
Sbjct: 102 QPKMVTRTKKIFVGGLSANTVVEDVK 127



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YFS FG I    V+ D  T + RGFGFV F D   VD+V  Q +H++
Sbjct: 37  LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDPASVDKVLGQPHHEL 86


>UniRef50_A2YWJ2 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 424

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 35/86 (40%), Positives = 56/86 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEIVD V+M+D  T + +GFGFITYS   +VD   ++  H+ +G+ VE KR +P++ ++
Sbjct: 108 YGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRVMDD-IHEFNGKQVEIKRTIPKDSVQ 166

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL Q + E+D +
Sbjct: 167 SKDFK--TKKIFVGGLPQALTEDDFK 190



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 1/66 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE-AQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +VD  +M+D +TKRS+GFGFI +S   +VD+   N     + G  VE K+A P++  
Sbjct: 196 YGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLANGNMIDLAGAKVEIKKAEPKKSS 255

Query: 432 KRPEAS 449
             P +S
Sbjct: 256 NPPPSS 261



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 16/40 (40%), Positives = 25/40 (62%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           ++F  +G IV   ++ DK T + RGFGF+ + +   VDRV
Sbjct: 103 KHFGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRV 142



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           + +F  +G +V   ++ D +T + RGFGF+ F     VD +    N
Sbjct: 190 KHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLANGN 235


>UniRef50_Q14103 Cluster: Heterogeneous nuclear ribonucleoprotein
           D0; n=123; Deuterostomia|Rep: Heterogeneous nuclear
           ribonucleoprotein D0 - Homo sapiens (Human)
          Length = 355

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>UniRef50_P48809 Cluster: Heterogeneous nuclear ribonucleoprotein
           27C; n=11; Endopterygota|Rep: Heterogeneous nuclear
           ribonucleoprotein 27C - Drosophila melanogaster (Fruit
           fly)
          Length = 421

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>UniRef50_Q99383 Cluster: Nuclear polyadenylated RNA-binding protein
           4; n=7; Saccharomycetales|Rep: Nuclear polyadenylated
           RNA-binding protein 4 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 534

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 32/86 (37%), Positives = 55/86 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G + D+ +MKDP T RS+GFGF+++ +   VDE    + H +DG++++PKRA+PR+E  
Sbjct: 182 YGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRDEQD 240

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +        K+FV G+  D+  ++ E
Sbjct: 241 K------TGKIFVGGIGPDVRPKEFE 260



 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 22/45 (48%), Positives = 31/45 (68%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           +   E+FS +G I+   ++ DK+TG+ RGFGFV +D  D VDRVC
Sbjct: 257 KEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVC 301



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 25/56 (44%), Positives = 32/56 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           WG I+D  +M D  T +S+GFGF+TY  A  VD    N+      R +E KRA PR
Sbjct: 266 WGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LREYF  +G +  + ++ D  TG+ RGFGF+ F+    VD V   Q+
Sbjct: 175 LREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQH 221


>UniRef50_O14979 Cluster: Heterogeneous nuclear ribonucleoprotein
           D-like; n=24; Mammalia|Rep: Heterogeneous nuclear
           ribonucleoprotein D-like - Homo sapiens (Human)
          Length = 420

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 171 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 224

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 225 ALKGKEPPKKVFVGGLSPDTSEEQIK 250



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 248 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 298



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 308

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 309 QPKEVYRQQQ 318


>UniRef50_O43347 Cluster: RNA-binding protein Musashi homolog 1;
           n=65; Euteleostomi|Rep: RNA-binding protein Musashi
           homolog 1 - Homo sapiens (Human)
          Length = 362

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 33/86 (38%), Positives = 53/86 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + +VM+DP TKRS+GFGF+T+     VD+      H++D + ++PK A PR    
Sbjct: 43  FGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--A 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +P+     KK+FV GL  +   ED++
Sbjct: 101 QPKMVTRTKKIFVGGLSVNTTVEDVK 126



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 125 VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA 184

Query: 414 VPREEIKRPEASA 452
            P+ E+  P  SA
Sbjct: 185 QPK-EVMSPTGSA 196



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +    V+ D  T + RGFGFV F D   VD+V  Q  H++
Sbjct: 36  LREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHEL 85



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F+  D V++VC    H+I
Sbjct: 125 VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEI 174


>UniRef50_UPI0000F2CBBE Cluster: PREDICTED: similar to musashi
           homolog 1 (Drosophila),; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to musashi homolog 1 (Drosophila), -
           Monodelphis domestica
          Length = 432

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 33/86 (38%), Positives = 53/86 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + +VM+DP TKRS+GFGF+T+     VD+      H++D + ++PK A PR    
Sbjct: 128 FGEVKECLVMRDPLTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--A 185

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +P+     KK+FV GL  +   ED++
Sbjct: 186 QPKMVTRTKKIFVGGLSVNTTVEDVK 211



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +    V+ D  T + RGFGFV F D   VD+V  Q  H++
Sbjct: 121 LREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFVDQAGVDKVLAQSRHEL 170


>UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A2/B1 isoform 1; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A2/B1 isoform 1
           - Strongylocentrotus purpuratus
          Length = 360

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 38/97 (39%), Positives = 61/97 (62%), Gaps = 3/97 (3%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE---AQNNRPHKIDGRIVEP 404
           IK     +GEIVD  V+KDP + +SKGFGF+T++    V++   A+   PH++D R V+ 
Sbjct: 29  IKEYFGQFGEIVDCCVIKDPTSLKSKGFGFVTFASRKEVNKVMGARKENPHRLDNRAVDV 88

Query: 405 KRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
           +RA+ R+E K P+  +   K FV G+ ++  EE+L +
Sbjct: 89  RRAMARDE-KGPKNPSF--KCFVGGIPKETTEEELRA 122



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/37 (48%), Positives = 28/37 (75%), Gaps = 1/37 (2%)
 Frame = +1

Query: 154 SGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY-EHGE 261
           S ++Y+EPE  RKLF+GGL Y T + ++KE++ + GE
Sbjct: 2   SEENYKEPEQERKLFLGGLSYNTKEDNIKEYFGQFGE 38



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 19/43 (44%), Positives = 27/43 (62%)
 Frame = +3

Query: 306 SKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           SKGF FITY     VD+    + H I+G+ VE K+A  +EE++
Sbjct: 138 SKGFSFITYDDTDCVDQIVMKKFHHINGKKVEGKKAYSKEEMR 180



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           ++EYF  FG IV   V+ D  + K +GFGFV F     V++V
Sbjct: 29  IKEYFGQFGEIVDCCVIKDPTSLKSKGFGFVTFASRKEVNKV 70



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 20/50 (40%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR YFS FG IV +++   K      GF F+ +DD D VD++ +++ H I
Sbjct: 120 LRAYFSQFGQIVELALHLSK------GFSFITYDDTDCVDQIVMKKFHHI 163


>UniRef50_UPI00005A196B Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand binding protein) (hnRNP core protein A1)
           (HDP) - Canis familiaris
          Length = 286

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 42/131 (32%), Positives = 68/131 (51%), Gaps = 2/131 (1%)
 Frame = +2

Query: 281 NERPKNQEIKRIWIYYIFSSPYG**SSK**ASQN*RKNCRAKTSSSKGRD*KTRS*CHR* 460
           +ER K+Q ++R+W+ ++     G  S +  A+Q   K+C      +K R  K R   H  
Sbjct: 3   DERSKHQALQRLWVCHVCHRGGGGCSHECKATQGGWKSC-----GTKERCLKRRPGAHLT 57

Query: 461 --KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
             K+     E       LR YF  +G I  + ++TD+ +GKKRGF FV F+D+D  D++ 
Sbjct: 58  VKKIFVGGIEEDTEEHHLRGYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFNDHDSADKIV 117

Query: 635 LQQNHQIKRFN 667
           +Q+ H +   N
Sbjct: 118 IQKYHTVNGHN 128



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T++     D+    + H ++G   E  +A+ ++E K
Sbjct: 82  YGKIEVIEIMTDRGSGKKRGFAFVTFNDHDSADKIVIQKYHTVNGHNCEVGKALLKQEPK 141

Query: 435 RPE 443
           RP+
Sbjct: 142 RPK 144


>UniRef50_Q9VFT3 Cluster: CG9654-PA; n=4; Drosophila
           melanogaster|Rep: CG9654-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 428

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 29/61 (47%), Positives = 41/61 (67%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G + D VV++DP +  S+GFGF+TY     V+  Q  RPH ID +IVE K A+PR++ K
Sbjct: 55  FGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFK 114

Query: 435 R 437
           R
Sbjct: 115 R 115



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    +REYFS FG + SV ++ D+ETG++R FGF+EF D    ++    + H I
Sbjct: 147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWI 201



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +FS FG +    V+ D  +   RGFGFV + D   V+ V   + H I
Sbjct: 48  LRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G +  V ++ D +T R + FGF+ +      ++A   R H I   +VE KR+  + +
Sbjct: 159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216


>UniRef50_Q6CC04 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 367

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/84 (39%), Positives = 54/84 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+++  VM+D  + +S+GFGF+T+     V+ A   + H +DG+I++PKRA+PREE  
Sbjct: 22  FGEVLECTVMRDHFSGKSRGFGFLTFRDPKCVN-AVMAKEHYLDGKIIDPKRAIPREEQD 80

Query: 435 RPEASATVKKLFVAGLKQDIEEED 506
           +        K+FV G+  D+ EED
Sbjct: 81  K------TSKIFVGGVGSDVTEED 98



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 14/44 (31%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           +++F  +G ++   ++ DK++G+ RGFGFV FD    ++ +  Q
Sbjct: 100 KQFFEQYGTVIDAQLMIDKDSGRPRGFGFVTFDSEQAMNTILAQ 143



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           L  YF+ FG ++  +V+ D  +GK RGFGF+ F D   V+ V  ++++
Sbjct: 15  LTNYFAQFGEVLECTVMRDHFSGKSRGFGFLTFRDPKCVNAVMAKEHY 62


>UniRef50_Q9FM47 Cluster: Similarity to RNA binding protein; n=5;
           Magnoliophyta|Rep: Similarity to RNA binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 423

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEI 431
           +GEI D V+MKD KT + +GFGF+TY+ + +VD+  Q+N  H I G+ VE KR +PR  +
Sbjct: 65  YGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQDN--HIIIGKQVEIKRTIPRGSM 122

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
              +     KK+FV G+   +++++ +
Sbjct: 123 SSNDFK--TKKIFVGGIPSSVDDDEFK 147



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 428
           +GE+ +  +M+D  T RS+GFGF+TY    MVD   A+ NR  ++ G  VE K+A P   
Sbjct: 153 FGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNR-IELSGTQVEIKKAEP--- 208

Query: 429 IKRPEASATVKKLF 470
            K+P +  T  K F
Sbjct: 209 -KKPNSVTTPSKRF 221



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ D++TG+ RGFGFV + D   VD+V +Q NH I
Sbjct: 60  KHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKV-IQDNHII 106



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +E+F  FG +    ++ D  TG+ RGFGFV ++  D VD +  + N
Sbjct: 147 KEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGN 192


>UniRef50_Q6BL35 Cluster: Debaryomyces hansenii chromosome F of
           strain CBS767 of Debaryomyces hansenii; n=4;
           Saccharomycetales|Rep: Debaryomyces hansenii chromosome
           F of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 495

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 32/84 (38%), Positives = 52/84 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++D  +M+D  T +S+GFGF+T+     VDE      H +DG++++PKRA+ REE  
Sbjct: 193 YGEVIDHTIMRDNNTGKSRGFGFLTFKDPKSVDEVIKT-DHILDGKLIDPKRAIAREEQD 251

Query: 435 RPEASATVKKLFVAGLKQDIEEED 506
           +      V K+FV G+   + E+D
Sbjct: 252 K------VGKIFVGGIDPMVNEKD 269



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++FS FG+I+   ++ DK+TG+ RGFGF+ +D  D VDRV + +   +K
Sbjct: 272 DFFSQFGSIIDAQLMIDKDTGRSRGFGFITYDSPDAVDRVTVNKYLTLK 320



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/56 (44%), Positives = 33/56 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G I+D  +M D  T RS+GFGFITY     VD    N+   + G+ +E KRA PR
Sbjct: 277 FGSIIDAQLMIDKDTGRSRGFGFITYDSPDAVDRVTVNKYLTLKGKSMEVKRAEPR 332



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/42 (45%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L EYF+ +G ++  +++ D  TGK RGFGF+ F D   VD V
Sbjct: 186 LVEYFTKYGEVIDHTIMRDNNTGKSRGFGFLTFKDPKSVDEV 227


>UniRef50_A3LZT4 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 481

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 33/84 (39%), Positives = 52/84 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +MKD  T +S+GFGF+T+     VDE      H +DG++++PKRA+ REE  
Sbjct: 183 FGEVVDYTIMKDNNTGKSRGFGFLTFRDPKSVDEVIKT-DHILDGKLIDPKRAIAREEQD 241

Query: 435 RPEASATVKKLFVAGLKQDIEEED 506
           +      V K+FV G+   + E++
Sbjct: 242 K------VGKIFVGGIDPMVNEKE 259



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 20/48 (41%), Positives = 33/48 (68%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQ 643
           +   ++FS FG+I+   ++ DK++G+ RGFGF+ FD  D VDRV + +
Sbjct: 258 KEFHDFFSQFGSIIDAQLMIDKDSGRSRGFGFITFDSPDAVDRVTVNK 305



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/56 (41%), Positives = 33/56 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G I+D  +M D  + RS+GFGFIT+     VD    N+   + G+ +E KRA PR
Sbjct: 267 FGSIIDAQLMIDKDSGRSRGFGFITFDSPDAVDRVTVNKFLTLKGKAMEVKRAEPR 322



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L  YFS FG +V  +++ D  TGK RGFGF+ F D   VD V
Sbjct: 176 LVSYFSKFGEVVDYTIMKDNNTGKSRGFGFLTFRDPKSVDEV 217


>UniRef50_Q4WHA5 Cluster: Heterogeneous nuclear ribonucleoprotein
           HRP1; n=1; Aspergillus fumigatus|Rep: Heterogeneous
           nuclear ribonucleoprotein HRP1 - Aspergillus fumigatus
           (Sartorya fumigata)
          Length = 608

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 31/86 (36%), Positives = 54/86 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ +  VM+D  T RS+GFGF+T+     V+     + H +DG+I++PKRA+PR+E +
Sbjct: 128 FGEVQECTVMRDSATGRSRGFGFLTFKDPKTVNTVM-VKEHYLDGKIIDPKRAIPRDEQE 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +        K+FV G+ Q+  E++ +
Sbjct: 187 K------TSKIFVGGVSQEATEQEFK 206



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/48 (41%), Positives = 32/48 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR+YFS FG +   +V+ D  TG+ RGFGF+ F D   V+ V +++++
Sbjct: 121 LRDYFSQFGEVQECTVMRDSATGRSRGFGFLTFKDPKTVNTVMVKEHY 168



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/63 (38%), Positives = 37/63 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G ++D  +M D  T R +GFGF+T+     V EA  +RP  I G+ +E K+A PR  ++
Sbjct: 212 FGRVIDATLMIDKDTGRPRGFGFVTFDSEAAV-EAALSRPLAICGKPIEVKKAQPRGNLR 270

Query: 435 RPE 443
             E
Sbjct: 271 DEE 273



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 17/42 (40%), Positives = 29/42 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           +  +E+F+ FG ++  +++ DK+TG+ RGFGFV FD    V+
Sbjct: 203 QEFKEFFTQFGRVIDATLMIDKDTGRPRGFGFVTFDSEAAVE 244


>UniRef50_Q1ENZ5 Cluster: RNA-binding protein, putative; n=2;
           Magnoliophyta|Rep: RNA-binding protein, putative - Musa
           acuminata (Banana)
          Length = 465

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 36/104 (34%), Positives = 61/104 (58%), Gaps = 11/104 (10%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +++   A+GE+V+ V+MKD  T R++GFGF+ ++   + +     + H IDGR+VE K+A
Sbjct: 22  LRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVTERVVTEK-HTIDGRMVEAKKA 80

Query: 414 VPREE---IKRPEASAT--------VKKLFVAGLKQDIEEEDLE 512
           VPR++   + +  +S+          KK+FV GL   I E D +
Sbjct: 81  VPRDDHQFLNKNSSSSIHGSPVPGHTKKIFVGGLSSTITEGDFK 124



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/68 (47%), Positives = 43/68 (63%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416
           K+    +G I DVVVM D  T+R +GFGFITY     VD+   N  H+++G++VE KRAV
Sbjct: 124 KKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLNAFHELNGKMVEVKRAV 183

Query: 417 PREEIKRP 440
           P+E    P
Sbjct: 184 PKEPSPGP 191



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++YF  FG I  V V+ D  T + RGFGF+ +D  D VD+V L   H++
Sbjct: 124 KKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLNAFHEL 172



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YFS FG +V   ++ D+ TG+ RGFGFV F D    +RV  +++
Sbjct: 22  LRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVTERVVTEKH 68



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 133 LNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           LN   S S      P HT+K+F+GGL    T+   K++++
Sbjct: 89  LNKNSSSSIHGSPVPGHTKKIFVGGLSSTITEGDFKKYFD 128


>UniRef50_A4R1M8 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 530

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 30/86 (34%), Positives = 55/86 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+++  VM+D  T RS+GFGF+T+     V+     + H +DG+I++PKRA+PR+E +
Sbjct: 104 FGEVIECTVMRDGTTGRSRGFGFLTFKDPKTVNIVM-VKEHYLDGKIIDPKRAIPRDEQE 162

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +        K+FV G+ Q+  +++ +
Sbjct: 163 K------TSKIFVGGVSQETTDQEFK 182



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/48 (41%), Positives = 33/48 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR+YFS FG ++  +V+ D  TG+ RGFGF+ F D   V+ V +++++
Sbjct: 97  LRDYFSQFGEVIECTVMRDGTTGRSRGFGFLTFKDPKTVNIVMVKEHY 144



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 24/63 (38%), Positives = 37/63 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +VD  +M D  T R +GFGF+T+     V EA   R  +I G+++E K+A PR  ++
Sbjct: 188 FGRVVDATLMMDKDTGRPRGFGFVTFESEAGV-EACLARDLEIHGKLIEVKKAQPRGNLR 246

Query: 435 RPE 443
             E
Sbjct: 247 EEE 249



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/52 (36%), Positives = 35/52 (67%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  +++F+ FG +V  +++ DK+TG+ RGFGFV F+    V+  CL ++ +I
Sbjct: 179 QEFKDFFAQFGRVVDATLMMDKDTGRPRGFGFVTFESEAGVE-ACLARDLEI 229



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           +E E T K+F+GG+   TTD   K+F+
Sbjct: 159 DEQEKTSKIFVGGVSQETTDQEFKDFF 185


>UniRef50_UPI0000502E70 Cluster: UPI0000502E70 related cluster; n=2;
           Rattus norvegicus|Rep: UPI0000502E70 UniRef100 entry -
           Rattus norvegicus
          Length = 274

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 33/83 (39%), Positives = 50/83 (60%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G++ +  VM+D  TK S+GFGF+TY+    VD   N RPHK D  +   +  V R++ +R
Sbjct: 37  GKLTNSAVMRDSNTKHSRGFGFVTYTVTMRVDADMNARPHK-DEELWNEREPVTRKDSQR 95

Query: 438 PEASATVKKLFVAGLKQDIEEED 506
           P  + TVKK+ V G  +D +E +
Sbjct: 96  PGVNLTVKKIIV-GTGEDTKEHE 117


>UniRef50_Q6PNM9 Cluster: AUF1 similar protein; n=3; Paracentrotus
           lividus|Rep: AUF1 similar protein - Paracentrotus
           lividus (Common sea urchin)
          Length = 361

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 31/88 (35%), Positives = 54/88 (61%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D  + KD  TK+ +GFGFI +  A  V +  +   HK+D + ++PK A P   +
Sbjct: 72  AYGTVQDCEIKKDQVTKKPRGFGFILFESADSVTKVLDVPEHKVDDKTIDPKPANP---L 128

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLES 515
           K+PE     KK+F+ G+  D++++D++S
Sbjct: 129 KKPEKK---KKIFIGGIGSDLKDDDIKS 153



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/65 (36%), Positives = 33/65 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G +V+    +D  T R  GF F+ Y  +    +AQN+R H I  + VE   A
Sbjct: 151 IKSYFSQFGTVVETEFPEDKTTGRRLGFAFVKYETSDEAQKAQNSRFHTISNKKVEVSEA 210

Query: 414 VPREE 428
           V REE
Sbjct: 211 VSREE 215



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++YFS +G +    +  D+ T K RGFGF+ F+  D V +V     H++
Sbjct: 66  LQQYFSAYGTVQDCEIKKDQVTKKPRGFGFILFESADSVTKVLDVPEHKV 115



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ YFS FG +V      DK TG++ GF FV+++  D   +    + H I
Sbjct: 151 IKSYFSQFGTVVETEFPEDKTTGRRLGFAFVKYETSDEAQKAQNSRFHTI 200


>UniRef50_Q94AC3 Cluster: AT4g36960/C7A10_400; n=11;
           Magnoliophyta|Rep: AT4g36960/C7A10_400 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 379

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 33/94 (35%), Positives = 54/94 (57%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K  +  +G++ D +VMKD  T RS+GFG++T++ A     A     H +  RI+E K A
Sbjct: 19  LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALKGE-HFLGNRILEVKVA 77

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+EE+++P    T  ++FVA +   + E D  S
Sbjct: 78  TPKEEMRQPAKKVT--RIFVARIPSSVSESDFRS 109



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D+ + KD  +K+ +G GFIT+S A  V++   +  H + G  V   RA P+E+  
Sbjct: 114 YGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLMED-THDLGGTTVAVDRATPKEDDH 172

Query: 435 RP 440
            P
Sbjct: 173 PP 174



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I D  + KDPK    +GFGF+T+++  + D     R H+I G+ V    A P +E  
Sbjct: 263 FGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEICGQEVAIDSATPLDE-A 320

Query: 435 RPEASAT 455
            P A A+
Sbjct: 321 GPSAGAS 327



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  FG+I    +  D +    RGFGFV F +    DRV  +++H+I
Sbjct: 256 LRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEI 304



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 15/33 (45%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L++Y S FG++    V+ D+ TG+ RGFG+V F
Sbjct: 19  LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTF 51


>UniRef50_Q9U5E3 Cluster: CiMsi; n=1; Ciona intestinalis|Rep: CiMsi
           - Ciona intestinalis (Transparent sea squirt)
          Length = 393

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 29/91 (31%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ D V+MKD +T  S+GFGF+T++    V      RPH +D ++++PK    +   +
Sbjct: 33  YGEVSDCVLMKDKETGFSRGFGFVTFTNPSSVAAVVKARPHNLDNKMIDPKPCTTKAAQQ 92

Query: 435 RPEASAT----VKKLFVAGLKQDIEEEDLES 515
           + + S+T      K+F+ G+  +  E D++S
Sbjct: 93  QKKVSSTNYSKAHKIFIGGISMEASEADVQS 123



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/50 (40%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR YF  +G +    ++ DKETG  RGFGFV F +   V  V   + H +
Sbjct: 26  LRSYFENYGEVSDCVLMKDKETGFSRGFGFVTFTNPSSVAAVVKARPHNL 75



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKK--RGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ YF  +G +V V  V +KE   K  +GFGFV F+D   VD+   +  H IK
Sbjct: 121 VQSYFERYGTVVEVVFVVNKEDTSKPHKGFGFVTFEDESSVDQAIAKHYHIIK 173



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +3

Query: 255 WGEIVDVV--VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G +V+VV  V K+  +K  KGFGF+T+     VD+A     H I  + VE K+A  R++
Sbjct: 128 YGTVVEVVFVVNKEDTSKPHKGFGFVTFEDESSVDQAIAKHYHIIKDKRVEAKKAESRDK 187

Query: 429 I 431
           +
Sbjct: 188 M 188


>UniRef50_Q9HEH4 Cluster: Related to heterogeneous nuclear
           ribonucleoprotein; n=13; Fungi/Metazoa group|Rep:
           Related to heterogeneous nuclear ribonucleoprotein -
           Neurospora crassa
          Length = 503

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 31/84 (36%), Positives = 53/84 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+V+  VM+D  T RS+GFGF+T+     V+     + H +DG+I++PKRA+PR+E +
Sbjct: 22  FGEVVECTVMRDGATGRSRGFGFLTFKDPKTVNIVM-VKEHYLDGKIIDPKRAIPRDEQE 80

Query: 435 RPEASATVKKLFVAGLKQDIEEED 506
           +        K+FV G+ Q+  + +
Sbjct: 81  K------TSKIFVGGVSQETTDHE 98



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           REYF+ FG +V  +++ DK+TG+ RGFGFV F+    V+  CL  N +I
Sbjct: 100 REYFAQFGRVVDATLMMDKDTGRPRGFGFVTFESEAGVE-ACLSANLEI 147



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 21/48 (43%), Positives = 33/48 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR+YFS FG +V  +V+ D  TG+ RGFGF+ F D   V+ V +++++
Sbjct: 15  LRDYFSQFGEVVECTVMRDGATGRSRGFGFLTFKDPKTVNIVMVKEHY 62



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/70 (35%), Positives = 39/70 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +VD  +M D  T R +GFGF+T+     V EA  +   +I G+ +E K+A PR  + 
Sbjct: 106 FGRVVDATLMMDKDTGRPRGFGFVTFESEAGV-EACLSANLEIHGKPIEVKKAQPRGNL- 163

Query: 435 RPEASATVKK 464
           R EA    ++
Sbjct: 164 REEAEEAARR 173


>UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11;
           Magnoliophyta|Rep: AT3g07810/F17A17_15 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 494

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 12/106 (11%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K    ++GE+++ V++KD  T R++GFGF+ ++    V E      H IDGR+VE K+A
Sbjct: 22  LKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKA 80

Query: 414 VPREE---IKRPEASA---------TVKKLFVAGLKQDIEEEDLES 515
           VPR++   + R  +S+           +K+FV GL   + E D ++
Sbjct: 81  VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKT 126



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G   DVVVM D  T+R +GFGFITY     V++      H+++G++VE KRAVP+E   
Sbjct: 131 FGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSP 190

Query: 435 RPEAS 449
            P  S
Sbjct: 191 GPSRS 195



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 22/51 (43%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RL+EYFS+FG ++   ++ D+ TG+ RGFGFV F D   V  + + + H I
Sbjct: 21  RLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFAD-PAVAEIVITEKHNI 70



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG    V V+ D  T + RGFGF+ +D  + V++V L+  H++
Sbjct: 125 KTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHEL 173


>UniRef50_UPI0000E4934F Cluster: PREDICTED: similar to musashi
           nrp-1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to musashi nrp-1 - Strongylocentrotus
           purpuratus
          Length = 229

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/86 (34%), Positives = 50/86 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + V+M+D  T+RS+GFGF+T+S    V+       H++D + V+PK A P+    
Sbjct: 50  FGEVKECVIMRDTTTRRSRGFGFVTFSDPAHVETVIQRGTHEVDKKKVDPKVAFPKR--S 107

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
            P+  +  KK+FV G+     E  L+
Sbjct: 108 HPKPVSKTKKIFVGGIAASTTEPHLK 133



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 24/73 (32%), Positives = 43/73 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ +V +M D  T R +GFGF+ +     VD       H++DG++VE K+A
Sbjct: 132 LKKFFEKYGKVEEVTLMFDRTTNRHRGFGFVIFDNEKTVDSVCEEHFHELDGKLVEVKKA 191

Query: 414 VPREEIKRPEASA 452
            P+ E+  P+ +A
Sbjct: 192 QPK-EVMMPQNAA 203



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/50 (38%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+++F  +G +  V+++ D+ T + RGFGFV FD+   VD VC +  H++
Sbjct: 132 LKKFFEKYGKVEEVTLMFDRTTNRHRGFGFVIFDNEKTVDSVCEEHFHEL 181



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           LR+YF  FG +    ++ D  T + RGFGFV F D   V+ V  +  H++ +
Sbjct: 43  LRKYFCQFGEVKECVIMRDTTTRRSRGFGFVTFSDPAHVETVIQRGTHEVDK 94


>UniRef50_Q9LHL2 Cluster: Similarity to RNA binding protein; n=13;
           Magnoliophyta|Rep: Similarity to RNA binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 358

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/86 (36%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D V+M+D  T + +GFGFIT++   +VD+   +  H I+G+ VE KR +P+    
Sbjct: 42  YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED-THVINGKQVEIKRTIPKGAGG 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
                   KK+FV G+   + E++L+
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELK 126



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+++F+ +GN+V   V+ D ET + RGFGFV FD  + VD +  + N
Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGN 171



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 428
           +G +V+  V++D +T RS+GFGF+ +    +VDE  ++ N     D + VE K+A P++ 
Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQ-VEIKKAEPKKS 190

Query: 429 IKRPEAS 449
           + R   S
Sbjct: 191 LNRSPPS 197



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ D+ TG+ RGFGF+ F D   VD+V ++  H I
Sbjct: 37  KHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV-IEDTHVI 83


>UniRef50_Q8W4A6 Cluster: Putative uncharacterized protein MJH23.3;
           n=2; Arabidopsis thaliana|Rep: Putative uncharacterized
           protein MJH23.3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 231

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/86 (36%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D V+M+D  T + +GFGFIT++   +VD+   +  H I+G+ VE KR +P+    
Sbjct: 42  YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED-THVINGKQVEIKRTIPKGAGG 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
                   KK+FV G+   + E++L+
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELK 126



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+++F+ +GN+V   V+ D ET + RGFGFV FD  + VD +  + N
Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGN 171



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ D+ TG+ RGFGF+ F D   VD+V ++  H I
Sbjct: 37  KHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV-IEDTHVI 83



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE 356
           +G +V+  V++D +T RS+GFGF+ +    +VDE
Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDE 165


>UniRef50_UPI00005A10B6 Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP-1) (Topoisomerase-inhibitor
           suppressed); n=4; Eutheria|Rep: PREDICTED: similar to
           Heterogeneous nuclear ribonucleoprotein A1
           (Helix-destabilizing protein) (Single-strand binding
           protein) (hnRNP core protein A1) (HDP-1)
           (Topoisomerase-inhibitor suppressed) - Canis familiaris
          Length = 407

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 26/61 (42%), Positives = 42/61 (68%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KKPIS 694
           YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q++H +   N W  +K +S
Sbjct: 211 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKSHPVNGHN-WEVRKALS 269

Query: 695 E 697
           +
Sbjct: 270 K 270



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/36 (50%), Positives = 24/36 (66%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           P  + +  +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 139 PGNAQESPKEPEQLRKLFIGGLSFETTDESLRSHFE 174



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 215 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKSHPVNGHNWEVRKALSKQEMA 274

Query: 435 RPEAS 449
              +S
Sbjct: 275 SASSS 279



 Score = 36.7 bits (81), Expect = 0.63
 Identities = 14/20 (70%), Positives = 17/20 (85%)
 Frame = +3

Query: 348 VDEAQNNRPHKIDGRIVEPK 407
           VD A N RPHK+DGR+VEP+
Sbjct: 189 VDAATNARPHKVDGRVVEPE 208


>UniRef50_Q4SEZ3 Cluster: Chromosome 1 SCAF14609, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1
           SCAF14609, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 476

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 11/96 (11%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR---- 422
           +GE+VD V+MKD  T +S+GFGF+ +   + V      +PH +DGR ++PK   PR    
Sbjct: 23  YGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVRTVLETKPHNLDGRNIDPKPCTPRGMQP 82

Query: 423 EEIKRPEA-------SATVKKLFVAGLKQDIEEEDL 509
           E+ +  E        S   KK+FV G+  +  E +L
Sbjct: 83  EKSRTKEGWKGSKADSNKSKKIFVGGIPHNCGEPEL 118



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LR YFS +G +V   ++ DK T + RGFGFV+F D + V  V   + H +   NI
Sbjct: 16  LRNYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVRTVLETKPHNLDGRNI 70



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF+ FG +  V ++ D E  + RGFGF+ F+    VD+      H I
Sbjct: 118 LRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDI 167



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 18/46 (39%), Positives = 29/46 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G + +VV++ D + +R +GFGFIT+     VD+A N   H I G+
Sbjct: 125 FGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGK 170


>UniRef50_Q9UAF2 Cluster: Musashi; n=1; Halocynthia roretzi|Rep:
           Musashi - Halocynthia roretzi (Sea squirt)
          Length = 335

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 31/92 (33%), Positives = 55/92 (59%), Gaps = 5/92 (5%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           ++GE+V+ +VMKD  T  S+GFGF+ +S    V +   N PH +D + ++PK   P+  I
Sbjct: 31  SFGEVVESIVMKDKVTGFSRGFGFVKFSDQQSVSKVLKNGPHSLDNKKIDPKPCTPK-GI 89

Query: 432 KRPEASATVK-----KLFVAGLKQDIEEEDLE 512
           ++ + SA ++     K+F+ G+ Q    ED++
Sbjct: 90  QQEKKSAAMEHTQSHKIFIGGIAQSSTTEDVK 121



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR YF +FG +V   V+ DK TG  RGFGFV+F D   V +V     H +
Sbjct: 25  LRAYFESFGEVVESIVMKDKVTGFSRGFGFVKFSDQQSVSKVLKNGPHSL 74



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 38/59 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G + +VV + + +  R KGFGF+T++    V++A +   H+I  + +E KRA PRE++
Sbjct: 128 FGTVNEVVFVINKEDNRHKGFGFVTFANEQAVNKAVDMHFHEIGDKQIEAKRATPREKM 186



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF   FG +  V  V +KE  + +GFGFV F +   V++      H+I
Sbjct: 120 VKKYFEEGFGTVNEVVFVINKEDNRHKGFGFVTFANEQAVNKAVDMHFHEI 170


>UniRef50_UPI0000F1F0C3 Cluster: PREDICTED: similar to LOC561459
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           LOC561459 protein - Danio rerio
          Length = 329

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 27/67 (40%), Positives = 42/67 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD V+MKD  T +S+GFGF+ +   + V    + +PH +DGR ++PK   PR    
Sbjct: 46  YGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKPHNLDGRNIDPKPCTPRG--M 103

Query: 435 RPEASAT 455
           +PE + T
Sbjct: 104 QPEKTRT 110



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LR YFS +G +V   ++ DK T + RGFGFV+F D + V  V   + H +   NI
Sbjct: 39  LRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKPHNLDGRNI 93


>UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39;
           Euteleostomi|Rep: DAZ-associated protein 1 - Homo
           sapiens (Human)
          Length = 407

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 12/97 (12%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR---E 425
           +GE+VD V+MKD  T +S+GFGF+ +   + V     +RPH +DGR ++PK   PR    
Sbjct: 33  YGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQP 92

Query: 426 EIKRPEA---------SATVKKLFVAGLKQDIEEEDL 509
           E  RP+          ++   K+FV G+  +  E +L
Sbjct: 93  ERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETEL 129



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 25/57 (43%), Positives = 37/57 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + +VV++ D + +R +GFGFIT+     VD+A N   H I G+ VE KRA PR+
Sbjct: 136 FGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRD 192



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LR YFS +G +V   ++ DK T + RGFGFV+F D + V  V   + H +   NI
Sbjct: 26  LRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNI 80



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +  V ++ D E  + RGFGF+ F+D   VD+      H I
Sbjct: 129 LREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDI 178


>UniRef50_Q9D3U4 Cluster: Adult male testis cDNA, RIKEN full-length
           enriched library, clone:4933434H11 product:similar to
           telomeric and tetraplex DNA binding protein qTBP42 V;
           n=2; Murinae|Rep: Adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933434H11
           product:similar to telomeric and tetraplex DNA binding
           protein qTBP42 V - Mus musculus (Mouse)
          Length = 565

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 31/87 (35%), Positives = 50/87 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI+D ++  DP T  S+GFGF+ +  +  V++    + HK+DG+ +E KRA      K
Sbjct: 56  FGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKDHKVDGKKIEFKRA------K 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
             E+    KK+FV GL   + EE + +
Sbjct: 110 ALESQFPNKKIFVGGLNPRLSEEKIRA 136



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L EY S FG I+   + TD  TG  RGFGFV F D   V++V   ++H++
Sbjct: 49  LLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKDHKV 98



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++R YF TFG I ++ +    +T ++R FGF+++ D + V +V   + H I
Sbjct: 133 KIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLENRYHFI 183



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 19/61 (31%), Positives = 28/61 (45%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +     T+  + FGFI Y   + V +   NR H I     E K A P+E   
Sbjct: 141 FGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLENRYHFIGSSRCEVKMAYPKENPA 200

Query: 435 R 437
           R
Sbjct: 201 R 201


>UniRef50_UPI000023D975 Cluster: hypothetical protein FG10273.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10273.1 - Gibberella zeae PH-1
          Length = 552

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 32/91 (35%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI-----VEPKRAVP 419
           +GE+V+  VM+D  T RS+GFGF+T+  A  V+     + H +DG+I     ++PKRA+P
Sbjct: 144 FGEVVECTVMRDSSTGRSRGFGFLTFKDAKTVNIVM-VKEHFLDGKILILLQIDPKRAIP 202

Query: 420 REEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           R+E ++        K+FV G+ Q+  +++ +
Sbjct: 203 RDEQEK------TSKIFVGGVSQETTDQEFK 227



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/66 (37%), Positives = 39/66 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +VD  +M D  T R +GFGF+T+     VD A  N P +I G+ +E K+A PR  ++
Sbjct: 233 FGRVVDATLMMDKDTGRPRGFGFVTFENEAGVD-ACINVPLEIHGKPIEVKKAQPRGNLR 291

Query: 435 RPEASA 452
             E ++
Sbjct: 292 EEEEAS 297



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 32/47 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF+ FG +V  +V+ D  TG+ RGFGF+ F D   V+ V ++++
Sbjct: 137 LRDYFAQFGEVVECTVMRDSSTGRSRGFGFLTFKDAKTVNIVMVKEH 183



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           +  +EYF+ FG +V  +++ DK+TG+ RGFGFV F++   VD
Sbjct: 224 QEFKEYFAQFGRVVDATLMMDKDTGRPRGFGFVTFENEAGVD 265



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           +E E T K+F+GG+   TTD   KE++
Sbjct: 204 DEQEKTSKIFVGGVSQETTDQEFKEYF 230


>UniRef50_Q32LZ4 Cluster: Msi2h protein; n=4; Eutheria|Rep: Msi2h
           protein - Mus musculus (Mouse)
          Length = 193

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 25/56 (44%), Positives = 39/56 (69%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +GEI + +VM+DP TKRS+GFGF+T++    VD+      H++D + ++PK A PR
Sbjct: 44  FGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPR 99



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YFS FG I    V+ D  T + RGFGFV F D   VD+V  Q +H++
Sbjct: 37  LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL 86


>UniRef50_Q9SU99 Cluster: HnRNP-like protein; n=10; core
           eudicotyledons|Rep: HnRNP-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 524

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G I DVVVM D  T+R +GFGFIT+     VD   +   H+++G++VE KRAVP+E
Sbjct: 138 FGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPKE 194



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 36/104 (34%), Positives = 58/104 (55%), Gaps = 17/104 (16%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428
           +G++V+ V+M+D  T R++GFGFI ++   + +    ++ H IDGR VE K+AVPR++  
Sbjct: 31  YGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMDK-HIIDGRTVEAKKAVPRDDQQ 89

Query: 429 -IKR---------PE-----ASATVKKLFVAGLKQDIEEEDLES 515
            +KR         P        A  KK+FV GL   I E + ++
Sbjct: 90  VLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKN 133



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL+EYF  +G++V   ++ D+ TG+ RGFGF+ F D    +RV + ++
Sbjct: 23  RLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMDKH 70



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG I  V V+ D  T + RGFGF+ FD  + VD V  +  H++
Sbjct: 132 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHEL 180


>UniRef50_A7NUC5 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 494

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 27/57 (47%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G I DVVVM D  T+R +GFGFIT+     V+    N  ++++G+ VE KRAVP+E
Sbjct: 146 FGRITDVVVMHDSATRRPRGFGFITFESEESVEHVMQNNFYELNGKRVEVKRAVPKE 202



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           + YF  FG I  V V+ D  T + RGFGF+ F+  + V+ V +Q N
Sbjct: 140 KNYFERFGRITDVVVMHDSATRRPRGFGFITFESEESVEHV-MQNN 184



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL-QQNHQIK 658
           LR+YFS +G +V   +  D     + GFGFV F D   + R    QQ H I+
Sbjct: 21  LRDYFSKYGTVVETYIRRDSGRTPRGGFGFVTFADAASLSRALQDQQQHFIQ 72


>UniRef50_Q26658 Cluster: Stage specific activator protein; n=3;
           Strongylocentrotus purpuratus|Rep: Stage specific
           activator protein - Strongylocentrotus purpuratus
           (Purple sea urchin)
          Length = 382

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDP-KTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G++ D+++M D  K  ++KGFGF+T++    VD+  N + H ++G+ ++ KR   R   
Sbjct: 29  FGKLSDIILMMDKDKPGQNKGFGFVTFADPACVDDVTNEKNHNLEGKGLDCKRCKARGSE 88

Query: 432 KR-PEASATVKKLFVAGLKQDIEEEDL 509
           KR        KK+FV G+ Q   +EDL
Sbjct: 89  KRMGPGDQRTKKVFVGGISQQATKEDL 115



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L E F + GN+  V ++ D +TGK RGFGFV  D  + V+++    + ++K
Sbjct: 115 LYELFRSHGNVEDVHIMNDTDTGKHRGFGFVTLDSEEAVEKLVRMHHLELK 165



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKET-GKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           R YF  FG +  + ++ DK+  G+ +GFGFV F D   VD V  ++NH ++
Sbjct: 23  RAYFEKFGKLSDIILMMDKDKPGQNKGFGFVTFADPACVDDVTNEKNHNLE 73



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           G + DV +M D  T + +GFGF+T      V++       ++ G+ +E K+A P+
Sbjct: 123 GNVEDVHIMNDTDTGKHRGFGFVTLDSEEAVEKLVRMHHLELKGKSMEIKKAQPK 177


>UniRef50_Q6ZZX5 Cluster: Heterogeneous nuclear ribonucleoprotein;
           n=2; Euteleostomi|Rep: Heterogeneous nuclear
           ribonucleoprotein - Salmo salar (Atlantic salmon)
          Length = 120

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/46 (60%), Positives = 34/46 (73%)
 Frame = +3

Query: 372 PHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
           PH +DG  VE KRAV RE+  +PEA A VKK+F+ GLK DIE+E L
Sbjct: 6   PHVVDGTNVELKRAVAREDAGKPEALAKVKKIFIGGLKDDIEDEHL 51



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 26/50 (52%), Positives = 32/50 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L +YFS FG I    V+ +KETGKKRGFGFV F D D  D+  + + H I
Sbjct: 51  LNDYFSQFGEIEKAEVIAEKETGKKRGFGFVHFTDNDSADKAVVVKFHTI 100


>UniRef50_Q7XDI5 Cluster: RNA recognition motif family protein,
           expressed; n=5; Magnoliophyta|Rep: RNA recognition motif
           family protein, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 464

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/57 (47%), Positives = 37/57 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + DVVVM D  T+R +GFGFIT+     VD   +   H + G++VE KRA+PRE
Sbjct: 151 YGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHKTFHDLSGKMVEVKRALPRE 207



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/66 (42%), Positives = 42/66 (63%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G++    VM+D  T R +GFGF+ +S    VD A  + PH +DGR V+ KRA+ REE 
Sbjct: 28  AYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVDAALVD-PHTLDGRTVDVKRALSREEQ 86

Query: 432 KRPEAS 449
           +  +A+
Sbjct: 87  QAAKAA 92



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 22/49 (44%), Positives = 31/49 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R+YF T+G +  V V+ D+ T + RGFGF+ FD  D VDRV  +  H +
Sbjct: 145 RQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHKTFHDL 193



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 29/41 (70%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           +LR++F+ +G++   +V+ DK TG+ RGFGFV F D   VD
Sbjct: 21  KLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVD 61


>UniRef50_Q9LNP1 Cluster: F1L3.34; n=2; Arabidopsis thaliana|Rep:
           F1L3.34 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 392

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR-EEI 431
           +GE+VD V+M D  T   +GFGF+T++ +  V E      H ID R V+ KR +PR ++ 
Sbjct: 112 FGEVVDSVIMTDRITGNPRGFGFVTFADS-AVAEKVLEEDHVIDDRKVDLKRTLPRGDKD 170

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLES 515
              +A +  +K+FV GL   +EE++L++
Sbjct: 171 TDIKAVSKTRKIFVGGLPPLLEEDELKN 198



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/42 (45%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L+ YF  +G+I+   ++ D  TG+ RGFGFV F   D VDR+
Sbjct: 196 LKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRL 237



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           +K     +G+I++  +M D  T RS+GFGF+T+     VD    + + H++  + VE KR
Sbjct: 196 LKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKR 255

Query: 411 AVPR 422
           A P+
Sbjct: 256 AEPK 259



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           YF  FG +V   ++TD+ TG  RGFGFV F D    ++V L+++H I
Sbjct: 108 YFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKV-LEEDHVI 153


>UniRef50_Q5CS11 Cluster: Musashi. RRM domain containing protein,
           splicing related; n=2; Cryptosporidium|Rep: Musashi. RRM
           domain containing protein, splicing related -
           Cryptosporidium parvum Iowa II
          Length = 507

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 31/64 (48%), Positives = 43/64 (67%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEIVD VV+ +  T RS+GFGFIT++    VD A  + P  +DG+ ++ KRAVPR  I+
Sbjct: 46  YGEIVDSVVLTEKTTGRSRGFGFITFASEESVD-AVLSSPQIVDGKEIDCKRAVPRGVIQ 104

Query: 435 RPEA 446
             EA
Sbjct: 105 ANEA 108



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 1/59 (1%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ-QNHQIKRFNIWM 676
           +LRE+F  +G I ++SV+ D++T + RGFGFVE++  D V+ V     +HQI   N W+
Sbjct: 181 KLREHFGKYGTIKNLSVMVDRDTNRHRGFGFVEYESPDAVEEVMRHYYDHQID--NKWV 237



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPRE 425
           +G I ++ VM D  T R +GFGF+ Y     V+E   +   H+ID + VE K+A+PRE
Sbjct: 189 YGTIKNLSVMVDRDTNRHRGFGFVEYESPDAVEEVMRHYYDHQIDNKWVECKKALPRE 246



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +FS +G IV   V+T+K TG+ RGFGF+ F   + VD V
Sbjct: 39  LRTHFSPYGEIVDSVVLTEKTTGRSRGFGFITFASEESVDAV 80


>UniRef50_A7SCX6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 305

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 1/93 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKR 410
           +K     +GE+V V +  D  T R +GF F+ +      D   N   PH +DGR ++PK 
Sbjct: 45  LKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKP 104

Query: 411 AVPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
           A P   I +P     VKK+FV GLK +  +E +
Sbjct: 105 AAP---IGKP-PHLRVKKIFVGGLKPETSDEKI 133



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +2

Query: 503 RLREYFS-TFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++REYF   +  +  +  +T+  + ++RGF FV FD  D VD++C  Q H I+
Sbjct: 132 KIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIE 184



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/48 (41%), Positives = 27/48 (56%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           +  L+EYFS +G +V V +  D  TG+ RGF FV+F      D V  Q
Sbjct: 42  KESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQ 89



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 17/58 (29%), Positives = 33/58 (56%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           A+  + ++  + +  + R +GF F+++     VD+    + H I+G  VE KRA+P+E
Sbjct: 140 AYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 197



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY-EHGE 261
           KLF+GGL Y TT  SLKE++ ++GE
Sbjct: 30  KLFVGGLSYETTKESLKEYFSKYGE 54


>UniRef50_UPI00005A129E Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand binding protein) (hnRNP core protein A1)
           (HDP) - Canis familiaris
          Length = 200

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 22/45 (48%), Positives = 33/45 (73%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++  +
Sbjct: 113 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVFE 157



 Score = 50.0 bits (114), Expect(2) = 6e-06
 Identities = 20/37 (54%), Positives = 26/37 (70%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           WG + D V M+DP TKRS+GFGF+T +    VD A+N
Sbjct: 62  WGTLTDCVEMRDPNTKRSRGFGFVTNATVEEVDAARN 98



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLF+GGL + TTD SL+  +E
Sbjct: 33  KEPEQLRKLFMGGLSFETTDESLRSHFE 60



 Score = 23.0 bits (47), Expect(2) = 6e-06
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +3

Query: 459 KKLFVAGLKQDIEEEDL 509
           + +FV G+K+D EE  L
Sbjct: 97  RNIFVGGIKEDTEEHHL 113


>UniRef50_Q5K6W6 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 480

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/87 (37%), Positives = 50/87 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI    +M+DP + RS+GF F+TY     V +    + H +DG+ ++PKRA+PR E +
Sbjct: 135 FGEIDACTIMRDP-SGRSRGFAFLTYRDPASVTKVMA-QTHHLDGKQIDPKRAIPRAEHE 192

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           R        K+FV GL   +  E L+S
Sbjct: 193 R------TAKVFVGGLAPSVTGESLKS 213



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/63 (36%), Positives = 36/63 (57%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K  L  +G+++D  VM D +T RSKGF F T+     V  A      +++G+ +E K+A
Sbjct: 211 LKSFLCQFGQVMDATVMFDKETGRSKGFAFATFQDEESVGRAMAASGVELEGKQIEIKKA 270

Query: 414 VPR 422
            PR
Sbjct: 271 QPR 273



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L+ +   FG ++  +V+ DKETG+ +GF F  F D + V R
Sbjct: 211 LKSFLCQFGQVMDATVMFDKETGRSKGFAFATFQDEESVGR 251


>UniRef50_Q54D98 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 687

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMK-DPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +GE+ + +V+K   K  +S+GFGF+T+    ++DE      H I+G+ VE +RA+P+EE+
Sbjct: 129 FGEVKESIVIKATEKASKSRGFGFVTFVDPSVIDEVILIN-HSIEGKNVEIRRAIPKEEM 187

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLES 515
                    +KLFV GL + I  +D  +
Sbjct: 188 TEEPKK---QKLFVGGLPKHITSDDFNN 212



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIV-SVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           L++YFS FG +  S+ +   ++  K RGFGFV F D   +D V L  NH I+  N+
Sbjct: 122 LKDYFSNFGEVKESIVIKATEKASKSRGFGFVTFVDPSVIDEVIL-INHSIEGKNV 176



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI--KRFNI 670
           YFS FG I   +++T+K  G  +GFGF+ F D    + +  +Q H I  KR +I
Sbjct: 213 YFSEFGEISEYNLLTEKN-GTIKGFGFICFKDESVNEIILNEQQHIILGKRVDI 265


>UniRef50_A3FQK0 Cluster: RNA recognition motif (RRM)-containing
           protein; n=2; Cryptosporidium|Rep: RNA recognition motif
           (RRM)-containing protein - Cryptosporidium parvum Iowa
           II
          Length = 202

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/56 (48%), Positives = 37/56 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G I+D VVM D  + RS+GFGF+T+     V+  QN  PH I G++V+ KRA PR
Sbjct: 31  FGVILDAVVMYDNVSGRSRGFGFVTFKDPKTVEIVQNITPHIIMGKVVDCKRASPR 86



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC-LQQNHQIK 658
           YF  FGNI    ++TDK  G+ RGFGFV F+  D V+ V     NH +K
Sbjct: 139 YFQRFGNIKDAVLITDKNNGRPRGFGFVTFESVDAVNNVTKFYSNHYLK 187



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGRIVEPKRAVPREEI 431
           +G I D V++ D    R +GFGF+T+     V+        H + G+ VE KRA+PR+ I
Sbjct: 143 FGNIKDAVLITDKNNGRPRGFGFVTFESVDAVNNVTKFYSNHYLKGKWVECKRALPRDGI 202



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 20/42 (47%), Positives = 25/42 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L EYF  FG I+   V+ D  +G+ RGFGFV F D   V+ V
Sbjct: 24  LMEYFLQFGVILDAVVMYDNVSGRSRGFGFVTFKDPKTVEIV 65


>UniRef50_UPI0000E45D7B Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A3, partial; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A3, partial -
           Strongylocentrotus purpuratus
          Length = 614

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRS-KGFGFITYSQAHMVD---EAQNNRPHKIDGRIVEPKRAVPR 422
           +GE+ D  V++     R  +GFGF+TY+ +  VD   +A+ +  H +DGR ++ KRA+P+
Sbjct: 488 FGELTDCCVVRHKDGDRKPRGFGFVTYATSACVDKVIDAKKDSAHVLDGREIDVKRALPK 547

Query: 423 EEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
           EE    E++    K FV GL      EDL++
Sbjct: 548 EEGGSKEST---NKAFVGGLAPGTTAEDLKA 575



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/42 (47%), Positives = 28/42 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L+ YF+ +G +  VS+    E GKKR FGFV F+D D VD++
Sbjct: 573 LKAYFTNYGVVTDVSIPPSTE-GKKRVFGFVTFEDSDTVDKL 613



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 13/27 (48%), Positives = 21/27 (77%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           EPE  RK+F+GGL + TT+ S+ E+++
Sbjct: 460 EPEQMRKMFLGGLSFDTTEESVNEYFK 486



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKK-RGFGFVEFDDYDPVDRV 631
           + EYF  FG +    VV  K+  +K RGFGFV +     VD+V
Sbjct: 481 VNEYFKKFGELTDCCVVRHKDGDRKPRGFGFVTYATSACVDKV 523


>UniRef50_A4RXB1 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 218

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 25/63 (39%), Positives = 40/63 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +++V+VM+DP   +S+GFGFIT+ +     +   NR H + G+ VE K AVPR +  
Sbjct: 36  FGPVMEVLVMRDPHNHQSRGFGFITFQRDDSAKQVLQNRYHDMLGKRVEVKSAVPRGQAP 95

Query: 435 RPE 443
            P+
Sbjct: 96  PPQ 98



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI--KRFNIWM* 679
           +R +FS FG ++ V V+ D    + RGFGF+ F   D   +V   + H +  KR  +   
Sbjct: 29  VRNFFSQFGPVMEVLVMRDPHNHQSRGFGFITFQRDDSAKQVLQNRYHDMLGKRVEV--- 85

Query: 680 KKPISEN*HVWAGVMIRGGPRSTRG 754
           K  +       A    RG PRS++G
Sbjct: 86  KSAVPRG---QAPPPQRGPPRSSQG 107


>UniRef50_Q9SM01 Cluster: RNA binding protein; n=2; Arabidopsis
           thaliana|Rep: RNA binding protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 381

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G   DVVVM D  T R +GFGF+TY     V+    +  H++  + VE KRA+P+E I+
Sbjct: 143 FGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPKEGIQ 202

Query: 435 RPEASA 452
               +A
Sbjct: 203 SNNGNA 208



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/40 (50%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYDPV 622
           L++YFS +G ++   V  +K TGK RGFGFV F +D D V
Sbjct: 22  LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVV 61



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG    V V+ D  T + RGFGFV +D  D V+ V     H++
Sbjct: 137 KSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHEL 185



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 18/66 (27%), Positives = 39/66 (59%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G +++ VV K+  T + +GFGF+ ++    V +A  +  H I G+ V+ ++A
Sbjct: 22  LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKALRD-THFILGKPVDVRKA 80

Query: 414 VPREEI 431
           + + E+
Sbjct: 81  IRKHEL 86


>UniRef50_Q4UI71 Cluster: RNA-binding (SR) protein, putative; n=2;
           Theileria|Rep: RNA-binding (SR) protein, putative -
           Theileria annulata
          Length = 303

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE+    +++D  T RS+GFGF+T++    V+     + HKIDG   + K A
Sbjct: 44  LKEYFSKYGEVTHTEIVRDKNTGRSRGFGFVTFADRDSVNTVL-RKVHKIDGVEADVKLA 102

Query: 414 VPREEIK--RPEASATVKKLFVAGLKQDIEE 500
           V +E+ K   P+   T K++FV G+ + I E
Sbjct: 103 VRKEKSKILAPQYDQT-KRIFVGGVSEKITE 132



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 25/50 (50%), Positives = 34/50 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFS +G +    +V DK TG+ RGFGFV F D D V+ V L++ H+I
Sbjct: 44  LKEYFSKYGEVTHTEIVRDKNTGRSRGFGFVTFADRDSVNTV-LRKVHKI 92



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 13/40 (32%), Positives = 27/40 (67%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           R+YF+ +G I S + + D+ T + RG+GFV +++ +  ++
Sbjct: 136 RDYFARYGPITSYNYLVDRATNRPRGYGFVIYENMEDAEK 175


>UniRef50_Q4SJ02 Cluster: Chromosome 21 SCAF14577, whole genome
           shotgun sequence; n=2; Tetraodon nigroviridis|Rep:
           Chromosome 21 SCAF14577, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 278

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/47 (48%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG I    V+TD++TGK RG+GFV   D    DR C   N
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPN 73



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 18/53 (33%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +GEI + VV+ D +T +S+G+GF+T +     D A  +    IDGR
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPIIDGR 79



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 13/21 (61%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTDSSL++++E
Sbjct: 12  KIFVGGLPYHTTDSSLRKYFE 32


>UniRef50_Q4S8N9 Cluster: Chromosome 7 SCAF14703, whole genome
           shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 7
           SCAF14703, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 157

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 25/50 (50%), Positives = 32/50 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YFS FG I    V+ D  T + RGFGFV F D   VD+V  QQ+H++
Sbjct: 37  LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHEL 86



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/62 (37%), Positives = 39/62 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI + +VM+DP TKRS+GFGF+T++ A  VD+    + H++D +  +  +    E + 
Sbjct: 44  FGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTFKLLQCSVMESLD 103

Query: 435 RP 440
            P
Sbjct: 104 TP 105


>UniRef50_A6N9V7 Cluster: RNA binding protein; n=1; Ornithodoros
           parkeri|Rep: RNA binding protein - Ornithodoros parkeri
          Length = 88

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 25/62 (40%), Positives = 36/62 (58%)
 Frame = +2

Query: 473 SWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           SWT  +   + LR+YFS FG + S  V+ DK+TG  +G+GFV F + D       QQ H 
Sbjct: 16  SWTVGK---KELRDYFSQFGYVSSAMVIFDKDTGMSKGYGFVRFGNKDGYINATRQQQHD 72

Query: 653 IK 658
           ++
Sbjct: 73  LE 74


>UniRef50_UPI0001560FCC Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 501

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/85 (31%), Positives = 47/85 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD ++   P T  S+GFGF+ +  +  V++    + HK+DG+ ++ +RA      K
Sbjct: 119 FGEVVDFIIKIHPGTGLSRGFGFVLFKDSATVEKVLQVKEHKLDGKTIQLRRA------K 172

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
              +    KK+FV GL   + EE +
Sbjct: 173 AVVSRFPPKKVFVGGLNPRLSEEKI 197



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L +Y S FG +V   +     TG  RGFGFV F D   V++V   + H++
Sbjct: 109 KQGLLDYLSQFGEVVDFIIKIHPGTGLSRGFGFVLFKDSATVEKVLQVKEHKL 161



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 21/64 (32%), Positives = 32/64 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I++    +G I D+ +  + KT   + F FITY+    V +    R H+I  R  E K A
Sbjct: 197 IRQYFGTFGVIQDIKLPVNSKTNERRAFCFITYADEKAVRKLLETRYHRIGSRRCEVKIA 256

Query: 414 VPRE 425
            P+E
Sbjct: 257 FPKE 260



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = +2

Query: 461 KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           KV       R    ++R+YF TFG I  + +  + +T ++R F F+ + D   V ++   
Sbjct: 182 KVFVGGLNPRLSEEKIRQYFGTFGVIQDIKLPVNSKTNERRAFCFITYADEKAVRKLLET 241

Query: 641 QNHQI 655
           + H+I
Sbjct: 242 RYHRI 246


>UniRef50_UPI0000D5737C Cluster: PREDICTED: similar to RNA binding
           motif protein 24; n=3; Endopterygota|Rep: PREDICTED:
           similar to RNA binding motif protein 24 - Tribolium
           castaneum
          Length = 318

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/47 (48%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LRE+FS +G I    V+TD++TGK RG+GFV   D    DR C   N
Sbjct: 105 LREHFSVYGEIEEAVVITDRQTGKSRGYGFVIMGDKSSSDRACKDAN 151



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI + VV+ D +T +S+G+GF+        D A  +    IDGR
Sbjct: 112 YGEIEEAVVITDRQTGKSRGYGFVIMGDKSSSDRACKDANPIIDGR 157



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261
           KLF+GGL Y TTD SL+E F  +GE
Sbjct: 90  KLFVGGLPYHTTDQSLREHFSVYGE 114


>UniRef50_Q8W034 Cluster: Ribonucleoprotein 1; n=5; core
           eudicotyledons|Rep: Ribonucleoprotein 1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 411

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 25/51 (49%), Positives = 34/51 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LRE+F+ +G +    V+ DK TG+ RGFGFV F D   +DRV LQ+ H I
Sbjct: 21  KLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRV-LQEKHSI 70



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + DV +M D  T R +GFGF+++     VD   +   H + G+ VE KRA+P++
Sbjct: 133 YGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKD 189



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +GE+   +VM+D  T R +GFGF+ +S   ++D     + H ID R V+ KRA+ REE
Sbjct: 29  YGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQEK-HSIDTREVDVKRAMSREE 85



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R+YF  +G +  V+++ D+ T + RGFGFV FD  D VD V  +  H +
Sbjct: 127 RQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDL 175



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +1

Query: 133 LNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           LN   S  GD Y +   T+K+F+GGL    TD   ++++E
Sbjct: 95  LNTSRSSGGDAYNK---TKKIFVGGLPPTLTDEEFRQYFE 131


>UniRef50_Q501B0 Cluster: At2g46780; n=3; core eudicotyledons|Rep:
           At2g46780 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 336

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 22/50 (44%), Positives = 29/50 (58%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           R  +R YF  FG IV   V+TDK TG+ +G+GFV F + +   R C   N
Sbjct: 35  RDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMN 84



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/72 (37%), Positives = 37/72 (51%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++R    +GEIV+ VV+ D  T RSKG+GF+T+ +A     A  N    IDGR      A
Sbjct: 38  MRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMNPVIDGRRANCNLA 97

Query: 414 VPREEIKRPEAS 449
               +  RP  S
Sbjct: 98  CLGAQKPRPPTS 109


>UniRef50_A4V6K1 Cluster: DAZ-associated protein; n=2;
           Platyhelminthes|Rep: DAZ-associated protein - Dugesia
           japonica (Planarian)
          Length = 296

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 21/48 (43%), Positives = 32/48 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           L+ YFS FG++V  SV+ D  TG+ RGFG+V + D + V +V   ++H
Sbjct: 31  LKSYFSKFGDVVEASVMMDHRTGRSRGFGYVRYSDNEAVQKVMSTKHH 78



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/85 (30%), Positives = 46/85 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++V+  VM D +T RS+GFG++ YS    V +  + + H ++G+ ++PK       + 
Sbjct: 38  FGDVVEASVMMDHRTGRSRGFGYVRYSDNEAVQKVMSTK-HHLEGKEIDPKPC----NVN 92

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
               S    K+FV G+  +  EE L
Sbjct: 93  MKGRSRRQLKIFVGGIAPEHNEETL 117



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +2

Query: 461 KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           K+        H    LR++F  FGNI  ++++ D+   + RGF FV FDD
Sbjct: 102 KIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDD 151



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G I ++ +MKD    R +GF F+ +    +V +  N+    I  + VE K   P+
Sbjct: 124 FGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 179


>UniRef50_Q13148 Cluster: TAR DNA-binding protein 43; n=36;
           Coelomata|Rep: TAR DNA-binding protein 43 - Homo sapiens
           (Human)
          Length = 414

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>UniRef50_UPI0000DB6D53 Cluster: PREDICTED: similar to CG32169-PA
           isoform 2; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG32169-PA isoform 2 - Apis mellifera
          Length = 426

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 26/69 (37%), Positives = 39/69 (56%)
 Frame = +3

Query: 309 KGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQ 488
           KGFGFIT++    VD+      H++DG+ ++PK A PR     P+     KK+FV GL  
Sbjct: 139 KGFGFITFADPASVDKVLAQGNHELDGKKIDPKVAFPRR--THPKMVTRTKKIFVGGLSA 196

Query: 489 DIEEEDLES 515
               ED+++
Sbjct: 197 PTTLEDVKN 205



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G I D ++M D +T R +GFGF+T+    +VD+      H+I+ ++VE K+A
Sbjct: 203 VKNYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKA 262

Query: 414 VPRE 425
            P+E
Sbjct: 263 QPKE 266



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ YF  FG I    ++ DK+T + RGFGFV F   D VD+VC    H+I
Sbjct: 203 VKNYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEI 252


>UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 588

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++R    +GE+ +  +M+D  T RS+GF F+ +     V+     R H +DG++++PKRA
Sbjct: 185 LRRYFSQFGEVGNCAIMRDNMTGRSRGFAFLNFVDPKAVNTVMV-REHYLDGKVIDPKRA 243

Query: 414 VPREE 428
           +PR +
Sbjct: 244 IPRPQ 248



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G + D   M D +T + +GFGF+TY+    ++   N RP   DG+ V+ KRA  + +
Sbjct: 301 FGTLSDCTCMMDRETGKPRGFGFLTYADDSSLNHVLNTRPIVFDGKEVDVKRAQSKND 358



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR YFS FG + + +++ D  TG+ RGF F+ F D   V+ V +++++
Sbjct: 185 LRRYFSQFGEVGNCAIMRDNMTGRSRGFAFLNFVDPKAVNTVMVREHY 232



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           R +F  FG +   + + D+ETGK RGFGF+ + D   ++ V
Sbjct: 295 RTFFEQFGTLSDCTCMMDRETGKPRGFGFLTYADDSSLNHV 335


>UniRef50_Q9BX46 Cluster: RNA-binding protein 24; n=52;
           Eumetazoa|Rep: RNA-binding protein 24 - Homo sapiens
           (Human)
          Length = 236

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 22/47 (46%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 73



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +GEI + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 79



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 12  KIFVGGLPYHTTDASLRKYFE 32


>UniRef50_Q6VYI5 Cluster: TARDBP S8; n=8; Coelomata|Rep: TARDBP S8 -
           Mus musculus (Mouse)
          Length = 302

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++YFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 29/86 (33%), Positives = 49/86 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  +P  + +
Sbjct: 127 FGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCK--LPNSK-Q 182

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
            P+     +K+FV    +D+  E+L+
Sbjct: 183 SPDEPLRSRKVFVGRCTEDMTAEELQ 208


>UniRef50_Q05C33 Cluster: Tardbp protein; n=14; Coelomata|Rep:
           Tardbp protein - Mus musculus (Mouse)
          Length = 288

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++YFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 29/86 (33%), Positives = 49/86 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  +P  + +
Sbjct: 127 FGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCK--LPNSK-Q 182

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
            P+     +K+FV    +D+  E+L+
Sbjct: 183 SPDEPLRSRKVFVGRCTEDMTAEELQ 208


>UniRef50_Q75KB4 Cluster: Putative RNA binding protein; n=4; Oryza
           sativa|Rep: Putative RNA binding protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 291

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/56 (44%), Positives = 36/56 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G I D VVM++  T R++GFGFI++     V +   NR H ++GR VE K AVP+
Sbjct: 135 FGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLNRFHNLNGRDVEVKIAVPK 190



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L  YF  FG I    V+ ++ T + RGFGF+ FD ++ V ++ L + H +
Sbjct: 128 LISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLNRFHNL 177



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 18/35 (51%), Positives = 23/35 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR +F+ +G +V   VV D  +G  RGFGFVEF D
Sbjct: 21  LRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFAD 55



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 16/103 (15%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQ--AHMVDEAQNNRP-HKIDGRIVEPKRAVPRE 425
           +GE+V   V+ D  +  S+GFGF+ ++   A +   A +  P H   GR V+ KRA  R 
Sbjct: 28  YGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRALADDEMPNHVFRGRKVDVKRAERRH 87

Query: 426 EIKRPEASAT-------------VKKLFVAGLKQDIEEEDLES 515
           + K+   S                KK+FV GL + +  +DL S
Sbjct: 88  DHKQTSPSIKNQNDSVQKNQFIFQKKVFVGGLHETVTVKDLIS 130


>UniRef50_A5BSV4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 195

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +R +F  FG I+   ++TDK TGK +G+GFV F D +   R C+  N
Sbjct: 32  MRRHFEQFGEILEAVIITDKNTGKSKGYGFVTFRDPESARRACVDPN 78



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI++ V++ D  T +SKG+GF+T+        A  +    IDGR
Sbjct: 39  FGEILEAVIITDKNTGKSKGYGFVTFRDPESARRACVDPNPVIDGR 84


>UniRef50_Q08473 Cluster: RNA-binding protein squid; n=22;
           Endopterygota|Rep: RNA-binding protein squid -
           Drosophila melanogaster (Fruit fly)
          Length = 344

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235


>UniRef50_Q9H0Z9 Cluster: RNA-binding protein 38; n=16;
           Eutheria|Rep: RNA-binding protein 38 - Homo sapiens
           (Human)
          Length = 216

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG+I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 27  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 73



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +G+I + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 27  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 79



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 12  KIFVGGLPYHTTDASLRKYFE 32


>UniRef50_A4V6K2 Cluster: PRM10 protein; n=1; Dugesia japonica|Rep:
           PRM10 protein - Dugesia japonica (Planarian)
          Length = 325

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/93 (29%), Positives = 46/93 (49%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     WG++   V+  D  T  S+GFGF+T      + +      H++  + ++PK A
Sbjct: 88  LKNYFETWGKVAHCVIKLDKMTGNSRGFGFVTMDTEDSLKKVLEVPEHRLKNKKIDPKPA 147

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
            P +E   P      KK+FV GL  ++ EE ++
Sbjct: 148 KPTKE---PN-----KKIFVGGLSPEVTEEQIK 172



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           L+ YF T+G +    +  DK TG  RGFGFV  D  D + +V     H++K   I
Sbjct: 88  LKNYFETWGKVAHCVIKLDKMTGNSRGFGFVTMDTEDSLKKVLEVPEHRLKNKKI 142



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +1

Query: 136 NMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           N K     +  +E + +RKLF+GGL + TT+  LK ++E
Sbjct: 55  NDKADSINNKVDEDDDSRKLFVGGLSWETTEEDLKNYFE 93



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 13/51 (25%), Positives = 27/51 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYFS +G++ SV +  D   GK++ + F+ F   D      + +   +
Sbjct: 170 QIKEYFSQYGSVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIINEKQDV 220


>UniRef50_Q94BU4 Cluster: At1g33470/F10C21_14; n=2; Arabidopsis
           thaliana|Rep: At1g33470/F10C21_14 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 244

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           LR YF  FG+IV   V+TDK +G+ +G+GFV F D +   + C+
Sbjct: 23  LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACV 66



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  ++     +G+IV+ VV+ D  + RSKG+GF+T+       +A  +    IDGR
Sbjct: 19  HKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGR 75


>UniRef50_A7RU25 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 291

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDGRIVEPKRAVPREE 428
           +GEI    V  DP T+RS+GFGF+ + +    ++A+N  +  H+I GR+ E +   P+EE
Sbjct: 138 FGEIDFCEVKLDPNTRRSRGFGFVRFKKD---EDAKNVLSTSHRIQGRLCEVRLPRPKEE 194

Query: 429 IKRPEASATVKKLFVAGLKQDIEEEDL 509
           +  P      KKLFV  L +   E+ L
Sbjct: 195 LNVP------KKLFVGRLPESTTEKTL 215



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++EYF+ FG I    V  D  T + RGFGFV F   +    V L  +H+I+
Sbjct: 131 MKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNV-LSTSHRIQ 180


>UniRef50_UPI0000E4615D Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A3, partial; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A3, partial -
           Strongylocentrotus purpuratus
          Length = 697

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 22/64 (34%), Positives = 39/64 (60%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+V+V +  + K  + +GF F+T++   +V E    + H   GR VE KRA+ +E+++
Sbjct: 139 FGEVVEVEIPPNEKNGKPRGFAFVTFATKEIVGEVVATKYHTFLGRKVEVKRAIEKEQLR 198

Query: 435 RPEA 446
           R  A
Sbjct: 199 RDTA 202



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 29/92 (31%), Positives = 49/92 (53%), Gaps = 10/92 (10%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK---IDGRIVEPKRAVPRE 425
           +G IVDV++++ P  K  KGFGF+T+S+A+M++      P     +DG+ VE KR    E
Sbjct: 39  FGHIVDVLMVRGPNHK-PKGFGFVTFSKAYMMEAVITAHPDMRVIVDGKSVEIKRISEGE 97

Query: 426 E-------IKRPEASATVKKLFVAGLKQDIEE 500
                   +K    +    ++FV G+ ++  E
Sbjct: 98  PSRSKAALLKAAIPNENTNRIFVGGIPENTTE 129



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           F  FG +V V +  +++ GK RGF FV F   + V  V   + H
Sbjct: 136 FGKFGEVVEVEIPPNEKNGKPRGFAFVTFATKEIVGEVVATKYH 179


>UniRef50_A7SIE8 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 184

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQ-AHMVDEAQNN-RPHKIDGRIVEPKRAVPREEIK 434
           ++  V + K P+ K S+ F F+ +S  + ++D    N   H ID + VE KRA+PR++  
Sbjct: 41  DVSSVSLAKTPEGK-SRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDD-P 98

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
              A    KKLF+ GLK +  EED+++
Sbjct: 99  NELAHVRTKKLFIGGLKDEHSEEDVKT 125



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 14/49 (28%), Positives = 31/49 (63%)
 Frame = +3

Query: 267 VDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +++ +++D +T + KG+ F+ +   H+VD+    R  ++ G+ VE K+A
Sbjct: 136 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 184



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 16/48 (33%), Positives = 30/48 (62%)
 Frame = +2

Query: 539 VSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K 682
           + + +V D+ET K +G+ FV F +   VD++ L ++ Q+K  ++ M K
Sbjct: 136 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKK 183


>UniRef50_UPI00005A96C6 Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP), partial; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP), partial - Canis familiaris
          Length = 285

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 19/41 (46%), Positives = 29/41 (70%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           R+YF  +G I  + ++TD+ + KKRGF FV FDD D V+++
Sbjct: 245 RDYFEQYGKIEVIEIMTDQGSDKKRGFAFVTFDDQDSVEKI 285



 Score = 38.7 bits (86), Expect(2) = 0.026
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYS 335
           WG ++D VVM D  TK  +G+GF+TY+
Sbjct: 202 WGTLMDCVVMSDRNTKCPRGYGFVTYA 228



 Score = 21.8 bits (44), Expect(2) = 0.026
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +3

Query: 453 TVKKLFVAGLKQDIEE 500
           T   +FV G+K+D EE
Sbjct: 226 TYATIFVGGIKEDTEE 241


>UniRef50_Q9M9E6 Cluster: F3F9.20; n=8; Arabidopsis thaliana|Rep:
           F3F9.20 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 302

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +R YF  FG I+   ++TDK TGK +G+GFV F + D   R     N
Sbjct: 33  MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPN 79



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +GEI++ V++ D  T +SKG+GF+T+ ++     A  +    IDGR
Sbjct: 33  MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGR 85


>UniRef50_A2YHR7 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 377

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/58 (37%), Positives = 35/58 (60%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           ++G + DVVV+ D  T RS+GFGF+T+     V +   +  H + G  VE K A+P++
Sbjct: 166 SFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEHSFHDLKGTRVEAKIAIPKD 223



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           + YF +FG +  V V+ D  T + RGFGFV FD  + V +V     H +K
Sbjct: 161 KTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEHSFHDLK 210



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/48 (45%), Positives = 29/48 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR +F  +G + SV V+ DKETG  RGFGFVEF++ +   R      H
Sbjct: 36  LRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGDGEH 83



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 4/70 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQ----AHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G +  V+VM+D +T   +GFGF+ + +    A  + + ++ R H I GR+V+ KRA  R
Sbjct: 43  YGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGDGEHPR-HLICGRVVDVKRARAR 101

Query: 423 EEIKRPEASA 452
            +    + S+
Sbjct: 102 PQRNHDDQSS 111


>UniRef50_Q0KHQ1 Cluster: CG33714-PA, isoform A; n=2; Diptera|Rep:
           CG33714-PA, isoform A - Drosophila melanogaster (Fruit
           fly)
          Length = 90

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           + LR YF  FG +VS +V+ DK TG  +G+GFV F+    ++++  +Q H
Sbjct: 29  QELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKH 78



 Score = 36.7 bits (81), Expect = 0.63
 Identities = 13/53 (24%), Positives = 33/53 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G +V   V+ D +T  SKG+GF++++    +++ +N + H ++G  +  +++
Sbjct: 38  FGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLNIQKS 90


>UniRef50_A0C337 Cluster: Chromosome undetermined scaffold_146,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_146,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 388

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 19/41 (46%), Positives = 29/41 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L + FS++GN++S  V+TD +TGK +GFGFV FD  +   +
Sbjct: 300 LMDLFSSYGNVISARVMTDPKTGKSKGFGFVSFDKQESAQK 340



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 17/53 (32%), Positives = 33/53 (62%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKR 410
           ++G ++   VM DPKT +SKGFGF+++ +     +A+      +DG +++ K+
Sbjct: 306 SYGNVISARVMTDPKTGKSKGFGFVSFDKQESAQKAK----EAMDGHLIDKKK 354


>UniRef50_UPI00005A358A Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP) isoform 2; n=5; Eutheria|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand binding protein) (hnRNP core protein A1)
           (HDP) isoform 2 - Canis familiaris
          Length = 192

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 554 VTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           +TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 1   MTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHPVNGHN 38


>UniRef50_A0H648 Cluster: RNA-binding region RNP-1; n=3;
           Chloroflexus|Rep: RNA-binding region RNP-1 -
           Chloroflexus aggregans DSM 9485
          Length = 103

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L ++F  +G++ S  V+ D+ETG+ RGFGFVE D  D V +V  Q N Q
Sbjct: 19  LEQFFQAYGDVRSARVINDRETGRSRGFGFVEMDVTD-VAKVISQTNGQ 66


>UniRef50_Q5CT90 Cluster: RRM domain containing protein; n=1;
           Cryptosporidium parvum Iowa II|Rep: RRM domain
           containing protein - Cryptosporidium parvum Iowa II
          Length = 199

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE-AQNNRPHKIDGRIVEPKRAVPREEI 431
           +G+I D V+M D K+   +GFGF+T++   +VDE  +    H IDG+ VE KRA P   +
Sbjct: 108 FGQISDCVMMCDKKSGIGRGFGFVTFTSTSVVDEIIRAYDEHYIDGQWVEVKRASPENAL 167

Query: 432 K 434
           +
Sbjct: 168 R 168



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR+YF  FG I    ++ DK++G  RGFGFV F     VD +
Sbjct: 101 LRKYFEQFGQISDCVMMCDKKSGIGRGFGFVTFTSTSVVDEI 142


>UniRef50_A7ART3 Cluster: Ribonucleoprotein, putative; n=1; Babesia
           bovis|Rep: Ribonucleoprotein, putative - Babesia bovis
          Length = 306

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR YFS +G +V   +V DK TG+ RGFGFV F + D   +  L  +H+I
Sbjct: 48  LRNYFSKYGTVVHSEIVADKTTGRSRGFGFVTFSN-DAALKAVLAVSHKI 96



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +V   ++ D  T RS+GFGF+T+S    + +A     HKID  + + K+A+ +E  +
Sbjct: 55  YGTVVHSEIVADKTTGRSRGFGFVTFSNDAAL-KAVLAVSHKIDNVLADVKQAIKKERAR 113

Query: 435 -RPEASATVKKLFVAGLKQDIEEEDLE 512
                   V ++FV G+  +I E++ +
Sbjct: 114 DLLPTREEVNRIFVGGIADNISEDEFK 140



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 16/40 (40%), Positives = 28/40 (70%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           ++YF  +G++++ + + DK T K RGFGFV ++D   VD+
Sbjct: 140 KDYFGKYGSVLNYNFIVDKSTNKPRGFGFVVYEDPADVDK 179



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G +++   + D  T + +GFGF+ Y     VD+A  +  H   GR  E KRA PR
Sbjct: 146 YGSVLNYNFIVDKSTNKPRGFGFVVYEDPADVDKAIGH--HTKLGRNCEAKRAQPR 199


>UniRef50_Q9SVM8 Cluster: Glycine-rich RNA-binding protein 2,
           mitochondrial precursor; n=14; Magnoliophyta|Rep:
           Glycine-rich RNA-binding protein 2, mitochondrial
           precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 158

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 19/35 (54%), Positives = 27/35 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR+ F+ FG++V   V+ D+ETG+ RGFGFV F+D
Sbjct: 51  LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFND 85



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431
           +G++VD  V+ D +T RS+GFGF+ ++       A +    K ++GR +    A  R   
Sbjct: 58  FGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSA 117

Query: 432 KR 437
            R
Sbjct: 118 PR 119


>UniRef50_UPI0000DB6DF2 Cluster: PREDICTED: similar to squid
           CG16901-PC, isoform C; n=2; Apocrita|Rep: PREDICTED:
           similar to squid CG16901-PC, isoform C - Apis mellifera
          Length = 320

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/87 (33%), Positives = 48/87 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP T  S+GF F+ ++    +D+   +  H I+ R V+PKR       K
Sbjct: 82  FGEIESISVKIDPYTGISRGFAFMVFTNPKTIDKLLASGEHYINKRKVDPKRV-----SK 136

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           +P+      K+FV GL  +I +ED+++
Sbjct: 137 KPQHG----KIFVGGLTPEITDEDIKT 159



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 21/54 (38%), Positives = 31/54 (57%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           + LR++FS FG I S+SV  D  TG  RGF F+ F +   +D++     H I +
Sbjct: 73  KELRDHFSKFGEIESISVKIDPYTGISRGFAFMVFTNPKTIDKLLASGEHYINK 126



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 13/39 (33%), Positives = 22/39 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           ++ YF  +G IV +    DK   +++GF F+ FD  + V
Sbjct: 157 IKTYFGQYGTIVELQAPFDKVKNQRKGFCFITFDSKEVV 195


>UniRef50_Q9SYP9 Cluster: F9H16.14 protein; n=6; core
           eudicotyledons|Rep: F9H16.14 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 288

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           LR +F  +G+I+   V+TDK TG+ +G+GFV F D +   R C+
Sbjct: 40  LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACV 83



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +G+I++ VV+ D  T RSKG+GF+T+        A  +    IDGR
Sbjct: 40  LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGR 92


>UniRef50_Q9FI04 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MGN6; n=3; Arabidopsis
           thaliana|Rep: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MGN6 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 100

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/53 (47%), Positives = 31/53 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +GEIV   V+ D  T+RSKGFGF+T+ +      A  N  H IDGR V  K A
Sbjct: 32  FGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/50 (44%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L  YF  FG IV   VV D  T + +GFGFV F + +   R C   NH I
Sbjct: 25  LISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTI 74


>UniRef50_Q4MZK1 Cluster: Nucleic acid binding factor, putative;
           n=2; Theileria|Rep: Nucleic acid binding factor,
           putative - Theileria parva
          Length = 421

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGR 392
           +GE++DV + KDP T++ KGFGFIT++  + +  A + +  H +DGR
Sbjct: 361 FGEVIDVYIPKDPHTQKGKGFGFITFANKNSIHSALDPSLKHVVDGR 407



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR YFS FG ++ V +  D  T K +GFGF+ F
Sbjct: 354 LRTYFSQFGEVIDVYIPKDPHTQKGKGFGFITF 386


>UniRef50_Q9FI08 Cluster: Similarity to RNA-binding protein; n=1;
           Arabidopsis thaliana|Rep: Similarity to RNA-binding
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 169

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L  +F  FG I+ V+VV D+ET + +G+GFV F D +   R C   N  I+
Sbjct: 29  LINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIE 79



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI+ V V+ D +T RS+G+GF+T+  A     A  +    I+GRI   K A    ++K
Sbjct: 36  FGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLAFVGAKVK 95


>UniRef50_Q40437 Cluster: RGP-3; n=2; Nicotiana|Rep: RGP-3 -
           Nicotiana sylvestris (Wood tobacco)
          Length = 144

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 18/35 (51%), Positives = 27/35 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR+ F+TFG++V   V+ D+++G+ RGFGFV F D
Sbjct: 54  LRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSD 88



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G++VD  V+ D  + RS+GFGF+ +S     +EA
Sbjct: 61  FGDVVDARVIVDRDSGRSRGFGFVNFSDDECANEA 95


>UniRef50_Q10N14 Cluster: RNA recognition motif family protein,
           expressed; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: RNA recognition motif family
           protein, expressed - Oryza sativa subsp. japonica (Rice)
          Length = 310

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 18/43 (41%), Positives = 29/43 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           LRE+F  FG+I+   +++DK TG+ +G+GFV F + D   + C
Sbjct: 49  LREHFERFGDILEAVIISDKLTGRSKGYGFVTFKEADAAKKAC 91



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 18/57 (31%), Positives = 34/57 (59%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  ++     +G+I++ V++ D  T RSKG+GF+T+ +A    +A  +    I+GR
Sbjct: 45  HKDTLREHFERFGDILEAVIISDKLTGRSKGYGFVTFKEADAAKKACEDATPVINGR 101


>UniRef50_Q5DH48 Cluster: SJCHGC06087 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06087 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 390

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/92 (25%), Positives = 45/92 (48%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     WG++   ++  D  T  S+GFGF+T      V +  +   H +  + ++PK+A
Sbjct: 75  LKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKIDPKKA 134

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P  E         ++K+FV G+  ++ E+ +
Sbjct: 135 KPSRE--------PLRKIFVGGIDPEVTEDQI 158



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           L+EYFS +G +    +  D+ TG  RGFGFV  +  D V +V     H +K   I
Sbjct: 75  LKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKI 129



 Score = 36.7 bits (81), Expect = 0.63
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)
 Frame = +1

Query: 142 KPSESGDDY---EEPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           KP+    D    E  + +RKLF+GGL + T +S LKE++    K+
Sbjct: 41  KPTNGAGDSVTDENDDDSRKLFVGGLSWETNESDLKEYFSRWGKV 85



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++REYFS+FG + S+ +  D + GK++ + FV F
Sbjct: 157 QIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSF 190


>UniRef50_O45189 Cluster: Suppressor protein 12; n=2;
           Caenorhabditis|Rep: Suppressor protein 12 -
           Caenorhabditis elegans
          Length = 248

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/49 (42%), Positives = 27/49 (55%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           + L EYF  FG+I    V+TD+ T K RG+GFV   D    +R C   N
Sbjct: 49  KTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN 97



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G+I + VV+ D  T++S+G+GF+T       + A  +    IDGR
Sbjct: 58  FGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGR 103


>UniRef50_A1L1U3 Cluster: Zgc:158370; n=5; Danio rerio|Rep:
           Zgc:158370 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 507

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/42 (47%), Positives = 28/42 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L+++F TFGN+V + + T    GK   FGFV FDD +PV R+
Sbjct: 369 LKDFFMTFGNVVELRINTKSTGGKIPNFGFVVFDDSEPVQRI 410


>UniRef50_Q6MCT2 Cluster: Probable nucleic acid-binding protein;
           n=1; Candidatus Protochlamydia amoebophila UWE25|Rep:
           Probable nucleic acid-binding protein - Protochlamydia
           amoebophila (strain UWE25)
          Length = 112

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +L+ +F  FG +VS  +VTD+ TGK +GFGFVE +  +  +    + N
Sbjct: 17  QLKAHFEAFGKVVSAKIVTDQMTGKSKGFGFVEMESANDAENAIRELN 64


>UniRef50_Q0F212 Cluster: RNA-binding region RNP-1; n=1;
           Mariprofundus ferrooxydans PV-1|Rep: RNA-binding region
           RNP-1 - Mariprofundus ferrooxydans PV-1
          Length = 81

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/35 (60%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LRE FS FG + S +VVT+ ET + RGFGFVE  D
Sbjct: 17  LRELFSRFGTVASATVVTNNETNQSRGFGFVEMPD 51


>UniRef50_UPI000156016B Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 223

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 27/83 (32%), Positives = 43/83 (51%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRP 440
           E+VD  +  DP   RS+G GFI +     V++  + +  K+ G  +  K+AV  +  K P
Sbjct: 84  EVVDRTIKMDPNIGRSRGLGFILFKDVASVEKVLDQKERKVGGHRMNHKKAVTMK--KDP 141

Query: 441 EASATVKKLFVAGLKQDIEEEDL 509
                +KK+FV GL  +  EE +
Sbjct: 142 -----MKKIFVGGLNPEATEEKI 159



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++    D E+ K++G  F+ F + +PV R  L++ H I
Sbjct: 158 KIREYFGKFGEIEAIEFSLDPESNKRQGSVFIAFKEEEPV-RSILEKFHTI 207



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++YF+    +V  ++  D   G+ RG GF+ F D   V++V  Q+  ++
Sbjct: 76  KDYFTKLREVVDRTIKMDPNIGRSRGLGFILFKDVASVEKVLDQKERKV 124


>UniRef50_Q54CU2 Cluster: RNA-binding region-containing protein;
           n=1; Dictyostelium discoideum AX4|Rep: RNA-binding
           region-containing protein - Dictyostelium discoideum AX4
          Length = 306

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 4/60 (6%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDG---RIVEPKRAVPRE 425
           G+++D  ++ DP TK S+GFGF+TYS      +A Q     KIDG   R+ + KR+  R+
Sbjct: 95  GKVIDCTILLDPNTKESRGFGFVTYSSGDEAQDAIQRLDSTKIDGNTIRVEKSKRSKARD 154



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR+ F++ G ++  +++ D  T + RGFGFV +   D
Sbjct: 87  LRDTFASIGKVIDCTILLDPNTKESRGFGFVTYSSGD 123


>UniRef50_O45577 Cluster: Putative uncharacterized protein cpf-2;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein cpf-2 - Caenorhabditis elegans
          Length = 336

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 18/35 (51%), Positives = 27/35 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +R  FS  GN++S+ +V D+ETGK +G+GF+EF D
Sbjct: 34  IRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPD 68


>UniRef50_Q9UN86-2 Cluster: Isoform B of Q9UN86 ; n=13;
           Euteleostomi|Rep: Isoform B of Q9UN86 - Homo sapiens
           (Human)
          Length = 449

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E+F +FGN+V + + T    GK   FGFV FDD +PV R+ +
Sbjct: 314 LKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILI 357


>UniRef50_Q11SF1 Cluster: RNA binding protein; n=6; Bacteria|Rep:
           RNA binding protein - Cytophaga hutchinsonii (strain
           ATCC 33406 / NCIMB 9469)
          Length = 143

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 18/35 (51%), Positives = 26/35 (74%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LRE+F  +G + SV +++DK TG+ +GFGFVE  D
Sbjct: 17  LREFFEEYGEVSSVKIISDKFTGRSKGFGFVEMPD 51


>UniRef50_Q7RNK1 Cluster: Ribonucleoprotein homolog
           F21B7.26-Arabidopsis thaliana-related; n=5;
           Plasmodium|Rep: Ribonucleoprotein homolog
           F21B7.26-Arabidopsis thaliana-related - Plasmodium
           yoelii yoelii
          Length = 507

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 18/33 (54%), Positives = 25/33 (75%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           FS FGNI+S  + T+K+TG+ RGF FV +D+ D
Sbjct: 418 FSPFGNIISAYIATEKDTGRNRGFAFVSYDNVD 450


>UniRef50_Q9UN86 Cluster: Ras GTPase-activating protein-binding
           protein 2; n=84; Euteleostomi|Rep: Ras GTPase-activating
           protein-binding protein 2 - Homo sapiens (Human)
          Length = 482

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E+F +FGN+V + + T    GK   FGFV FDD +PV R+ +
Sbjct: 347 LKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILI 390


>UniRef50_UPI000065FE7B Cluster: RNA-binding protein 38 (RNA-binding
           motif protein 38) (RNA-binding region-containing protein
           1) (HSRNASEB) (ssDNA-binding protein SEB4)
           (CLL-associated antigen KW-5).; n=2; Takifugu
           rubripes|Rep: RNA-binding protein 38 (RNA-binding motif
           protein 38) (RNA-binding region-containing protein 1)
           (HSRNASEB) (ssDNA-binding protein SEB4) (CLL-associated
           antigen KW-5). - Takifugu rubripes
          Length = 287

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/31 (61%), Positives = 25/31 (80%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           LR+YF +FG+I    V+TDK+TGK RG+GFV
Sbjct: 28  LRKYFESFGDIDEAVVITDKQTGKSRGYGFV 58



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 11/38 (28%), Positives = 28/38 (73%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHM 347
           +++   ++G+I + VV+ D +T +S+G+GF++ ++ H+
Sbjct: 28  LRKYFESFGDIDEAVVITDKQTGKSRGYGFVSKNETHL 65



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 11/21 (52%), Positives = 18/21 (85%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y T D+SL++++E
Sbjct: 13  KIFVGGLPYHTNDASLRKYFE 33


>UniRef50_Q5JK61 Cluster: RNA recognition motif (RRM)-containing
           protein-like; n=7; Oryza sativa|Rep: RNA recognition
           motif (RRM)-containing protein-like - Oryza sativa
           subsp. japonica (Rice)
          Length = 310

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           +R YF  FG+I+   V+TDK TG+ +G+GFV F + +   + C
Sbjct: 37  MRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAAMKAC 79



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 18/46 (39%), Positives = 29/46 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G+I++ VV+ D  T RSKG+GF+T+ +     +A  +    IDGR
Sbjct: 44  FGDILEAVVITDKNTGRSKGYGFVTFREPEAAMKACFDPYPVIDGR 89


>UniRef50_A7QX84 Cluster: Chromosome undetermined scaffold_215,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_215, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 273

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R+YF  FG++  + V+ D+   + RGFGFV FD  D V+RV  +  H +
Sbjct: 26  RQYFEAFGHVTDLVVMYDQSIQRPRGFGFVSFDTEDLVNRVLYKTFHDL 74



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/49 (40%), Positives = 27/49 (55%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R+YF  F N+  V V+ D+   +  GF FV FD  D VDRV  +  H +
Sbjct: 132 RQYFEAFSNVTDVVVMYDQSIQRPCGFRFVSFDIEDVVDRVLYKTFHDL 180



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/45 (31%), Positives = 26/45 (57%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKID 386
           A+G + D+VVM D   +R +GFGF+++    +V+       H ++
Sbjct: 31  AFGHVTDLVVMYDQSIQRPRGFGFVSFDTEDLVNRVLYKTFHDLN 75


>UniRef50_Q5BXS3 Cluster: SJCHGC01369 protein; n=2; Schistosoma
           japonicum|Rep: SJCHGC01369 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 386

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/51 (37%), Positives = 32/51 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           LR+YFS +G++V + +  D  T + +G+GF+ F DY     +CL + H I+
Sbjct: 119 LRDYFSQYGDLVMIQIKRDPVTQQSKGYGFIRFADY-AAQVMCLAERHTIE 168



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 26/87 (29%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQ--AHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G++V + + +DP T++SKG+GFI ++   A ++  A+    H I+ R  + +  + + E
Sbjct: 126 YGDLVMIQIKRDPVTQQSKGYGFIRFADYAAQVMCLAER---HTIENRQCDVRIPISKME 182

Query: 429 IKRPEASATVKKLFVAGLKQDIEEEDL 509
             R + +   +K+ V GL +DI  E L
Sbjct: 183 GDRQDVA---RKVHVGGLTEDISPETL 206


>UniRef50_Q4H2Q6 Cluster: Ci-Tardbp protein; n=1; Ciona
           intestinalis|Rep: Ci-Tardbp protein - Ciona intestinalis
           (Transparent sea squirt)
          Length = 440

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYF+ +G +V V V  D E GK RG+GF+ F  Y+ V  + L Q H I
Sbjct: 155 LKEYFAKYGELVMVLVKRD-ENGKSRGYGFIRFSSYE-VQELVLSQRHII 202



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 26/92 (28%), Positives = 52/92 (56%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE+V V+V +D   K S+G+GFI +S ++ V E   ++ H I  R  + K  
Sbjct: 155 LKEYFAKYGELVMVLVKRDENGK-SRGYGFIRFS-SYEVQELVLSQRHIIGERWCDVK-- 210

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
           +P  + ++P  S+   K+FV  + + + ++++
Sbjct: 211 IPHSKDQKPTVSS---KIFVGRITEKMTKDEI 239


>UniRef50_A3BDN9 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 285

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           LR +F  +G I+   V+TD+ TG+ +G+GFV F D D     C+
Sbjct: 49  LRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDSARMACM 92



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           A+GEI++ VV+ D  T RSKG+GF+T+        A  +    IDGR
Sbjct: 55  AYGEILEAVVITDRATGRSKGYGFVTFRDPDSARMACMDPYPVIDGR 101


>UniRef50_Q8ILZ7 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 514

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 17/33 (51%), Positives = 25/33 (75%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           FS FGNI+S  + T+++TG+ RGF FV +D+ D
Sbjct: 425 FSPFGNIISAHIATERDTGRNRGFAFVSYDNVD 457


>UniRef50_O45713 Cluster: Putative uncharacterized protein; n=5;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 85

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/47 (46%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L  YFS  GN+ +V +V D+ETG+ RGF FVEF +     R   Q N
Sbjct: 20  LGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQFN 66


>UniRef50_Q04836 Cluster: 31 kDa ribonucleoprotein, chloroplast
           precursor; n=22; Magnoliophyta|Rep: 31 kDa
           ribonucleoprotein, chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 329

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 20/41 (48%), Positives = 26/41 (63%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           RL + FS  G +V   VV D+ETG+ RGFGFV   D D ++
Sbjct: 259 RLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELN 299



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 5/89 (5%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEIKR 437
           EI +V+  ++  T +S+GFGF+T S     + A +    + ++GR++   +A PR    R
Sbjct: 177 EIAEVIYNRE--TDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRG--SR 232

Query: 438 PEASATVK----KLFVAGLKQDIEEEDLE 512
           PE +  V     +++V  L  D++   LE
Sbjct: 233 PERAPRVYEPAFRVYVGNLPWDVDNGRLE 261



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G++V+  V+ D +T RS+GFGF+T S    ++EA
Sbjct: 268 GKVVEARVVYDRETGRSRGFGFVTMSDVDELNEA 301


>UniRef50_Q9D8T7-2 Cluster: Isoform 2 of Q9D8T7 ; n=2;
           Euarchontoglires|Rep: Isoform 2 of Q9D8T7 - Mus musculus
           (Mouse)
          Length = 99

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 25/60 (41%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A      LRE+F+ FG++   +V  DKETG  RG G+V+F   + +    LQQ H I
Sbjct: 28  WTAAAS---ELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQN-ALQQEHHI 83


>UniRef50_Q1IV44 Cluster: RNA-binding protein, RNP-1; n=2;
           Bacteria|Rep: RNA-binding protein, RNP-1 - Acidobacteria
           bacterium (strain Ellin345)
          Length = 107

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 18/32 (56%), Positives = 27/32 (84%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVE 601
           +R+ F+ +G + SVS+VTD++TG+ RGFGFVE
Sbjct: 18  IRQLFTPYGKVDSVSLVTDRDTGRARGFGFVE 49


>UniRef50_Q7XI13 Cluster: Glycine-rich RNA-binding protein-like;
           n=9; Magnoliophyta|Rep: Glycine-rich RNA-binding
           protein-like - Oryza sativa subsp. japonica (Rice)
          Length = 308

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 21/64 (32%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           ++R    +G++++  V+ +  T RS+GFGF+T+S+   VD A +     ++DGR +   +
Sbjct: 23  LERAFSEYGKVIETQVVLERDTGRSRGFGFVTFSEPRAVDAAIRGMHNGELDGRTISVNK 82

Query: 411 AVPR 422
           A PR
Sbjct: 83  AQPR 86



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           R L   FS +G ++   VV +++TG+ RGFGFV F +   VD
Sbjct: 21  RTLERAFSEYGKVIETQVVLERDTGRSRGFGFVTFSEPRAVD 62


>UniRef50_A7SMA3 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 259

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 21/41 (51%), Positives = 28/41 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L E F  + N+V V V+TD+ETG+ RGFGFV F   D +D+
Sbjct: 128 LEEKFHGY-NVVDVKVITDRETGRPRGFGFVTFGSEDEMDK 167



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREE 428
           +VDV V+ D +T R +GFGF+T+     +D+A +      +DGR ++  +A PR E
Sbjct: 137 VVDVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGE 192


>UniRef50_A6RJZ8 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 790

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           RE F  FG++ S S+  D ETGK RGFGFV F +++
Sbjct: 259 RELFEKFGDVTSASLARDAETGKSRGFGFVNFINHE 294



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L + F+ FGNI+S  V  D E+G  +G+GFV ++
Sbjct: 163 KALHDTFAAFGNILSCKVAQD-ESGASKGYGFVHYE 197



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 14/99 (14%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY----SQAHMVDEAQNNRPHKIDGRIV--EPKRAV 416
           +G++    + +D +T +S+GFGF+ +      A  VDE  N +  K     V    K+  
Sbjct: 265 FGDVTSASLARDAETGKSRGFGFVNFINHEHAATAVDEL-NGKDFKGQDLYVGRAQKKHE 323

Query: 417 PREEIKRPEASATVKK--------LFVAGLKQDIEEEDL 509
             EE++R   +A ++K        L+V  L  DI++E L
Sbjct: 324 REEELRRSYEAARIEKASKYQGVNLYVKNLDDDIDDEKL 362


>UniRef50_Q9D8T7 Cluster: SRA stem-loop-interacting RNA-binding
           protein, mitochondrial precursor; n=6; Eutheria|Rep: SRA
           stem-loop-interacting RNA-binding protein, mitochondrial
           precursor - Mus musculus (Mouse)
          Length = 112

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 25/60 (41%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A      LRE+F+ FG++   +V  DKETG  RG G+V+F   + +    LQQ H I
Sbjct: 28  WTAAAS---ELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQN-ALQQEHHI 83


>UniRef50_UPI000065DEA8 Cluster: RNA-binding protein 24 (RNA-binding
           motif protein 24) (RNA-binding region-containing protein
           6).; n=1; Takifugu rubripes|Rep: RNA-binding protein 24
           (RNA-binding motif protein 24) (RNA-binding
           region-containing protein 6). - Takifugu rubripes
          Length = 258

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           LR+YF  FG+I    V+TD++TGK RG+GFV
Sbjct: 27  LRKYFEVFGDIEEAVVITDRQTGKSRGYGFV 57



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 13/21 (61%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTDSSL++++E
Sbjct: 12  KIFVGGLPYHTTDSSLRKYFE 32


>UniRef50_Q48A10 Cluster: RNA-binding protein; n=2;
           Alteromonadales|Rep: RNA-binding protein - Colwellia
           psychrerythraea (strain 34H / ATCC BAA-681)
           (Vibriopsychroerythus)
          Length = 160

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/39 (56%), Positives = 28/39 (71%), Gaps = 2/39 (5%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF--DDYD 616
           +RE FS  G++ SV ++ DK TGK+RGFGFVE   DD D
Sbjct: 87  VRELFSEHGSVHSVRLMKDKHTGKRRGFGFVEMASDDLD 125



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = +1

Query: 136 NMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKE-FYEHG 258
           N   S S +     E  R L++G L YR  ++S++E F EHG
Sbjct: 54  NTASSTSSNTIASDEDVRTLYVGNLPYRANETSVRELFSEHG 95


>UniRef50_A1SSM5 Cluster: RNP-1 like RNA-binding protein precursor;
           n=6; Proteobacteria|Rep: RNP-1 like RNA-binding protein
           precursor - Psychromonas ingrahamii (strain 37)
          Length = 160

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +R  FS  G ++SV ++ DK TGK+RGFGFVE  + D
Sbjct: 84  IRSLFSEHGQVLSVRLMKDKHTGKRRGFGFVEMPEKD 120


>UniRef50_A0HBM8 Cluster: RNA-binding region RNP-1; n=1; Comamonas
           testosteroni KF-1|Rep: RNA-binding region RNP-1 -
           Comamonas testosteroni KF-1
          Length = 83

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 18/35 (51%), Positives = 27/35 (77%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVE 601
           R  L+ +FS+ G+++S  V+TD+ TG+ RGFGFVE
Sbjct: 16  RETLKSHFSSCGDVLSSEVITDRNTGQSRGFGFVE 50


>UniRef50_Q259G3 Cluster: H0124B04.13 protein; n=5; Oryza
           sativa|Rep: H0124B04.13 protein - Oryza sativa (Rice)
          Length = 913

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 6/82 (7%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ-NNRPHKIDGRIVEPK-----RAV 416
           +GE+ +  V KD  T  SKG+GF+ YS  H   EA  +     +DGR +E +       +
Sbjct: 327 FGEVTNAKVAKDHTTGLSKGYGFVQYSSPHHAAEAVIHLNGRLVDGRKIEVRVSGIPSTL 386

Query: 417 PREEIKRPEASATVKKLFVAGL 482
           P   ++ P  + TVK++ ++ L
Sbjct: 387 PNSAVESPSTTRTVKEIDMSNL 408



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++L E F  FG I    VV D +T   +G+GF++F D +   +     N
Sbjct: 420 KKLVELFLPFGKITHARVVADPDTFSAKGYGFIKFTDSESATKAIAAMN 468



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 4/89 (4%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRA-VPREE 428
           +G+IV   V+ D  T  S+G+GF+ YS      EA +      ++GR +E + A  P  E
Sbjct: 232 FGQIVRSRVVDDCFTGLSQGYGFVKYSDPRCASEAIKRMNGRLVEGRALEVRVAGFPSSE 291

Query: 429 --IKRPEASATVKKLFVAGLKQDIEEEDL 509
              ++P     + KL+V  L   +  + L
Sbjct: 292 DNSQQPSKETDMAKLYVCNLSLSMNTDRL 320



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +L E F  FG IV   VV D  TG  +G+GFV++ D
Sbjct: 224 KLIELFLPFGQIVRSRVVDDCFTGLSQGYGFVKYSD 259



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           RL + F   G I    VV ++ TG  +GFGFV+F D
Sbjct: 704 RLIDLFLPCGQITQAKVVVERYTGVSKGFGFVKFAD 739



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           RL   F  FG + +  V  D  TG  +G+GFV++
Sbjct: 319 RLIHLFLPFGEVTNAKVAKDHTTGLSKGYGFVQY 352


>UniRef50_O24306 Cluster: Ribonucleoprotein; n=3; Pisum sativum|Rep:
           Ribonucleoprotein - Pisum sativum (Garden pea)
          Length = 291

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/36 (55%), Positives = 24/36 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           RL + FS  G +VS  VV D+ETG+ RGFGFV   D
Sbjct: 221 RLEQVFSEHGKVVSARVVYDRETGRSRGFGFVTMSD 256



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 7/91 (7%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVD--EAQNNRPHKIDGRIVEPKRAVPR---- 422
           EI +V+  ++  T +S+GFGF+T S     +   A+ NR +  +GR +   +A PR    
Sbjct: 136 EIAEVIYNRE--TDQSRGFGFVTMSTVEEAEAGAAKFNR-YDYNGRPLTVNKAAPRGSRP 192

Query: 423 -EEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
             E + P     V +++V  L  ++++  LE
Sbjct: 193 EREERPPRTFEPVLRVYVGNLSWELDDSRLE 223



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           G++V   V+ D +T RS+GFGF+T S     ++  N+    +DG+I+E
Sbjct: 230 GKVVSARVVYDRETGRSRGFGFVTMSD----EKEMNDAIAALDGQILE 273


>UniRef50_Q6X9Z2 Cluster: HnRNP core protein A1; n=2;
           Laurasiatheria|Rep: HnRNP core protein A1 - Equus
           caballus (Horse)
          Length = 61

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT 329
           WG + D VVM+DP TKRS+GFGF+T
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVT 61



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35


>UniRef50_A0BZZ4 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=4; Eukaryota|Rep: Chromosome
           undetermined scaffold_14, whole genome shotgun sequence
           - Paramecium tetraurelia
          Length = 260

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           + L E FS FG+I+S  ++ + ETG  +G+GFV +D+++  D      N Q
Sbjct: 120 KTLYETFSAFGHILSTKIMRNPETGVSKGYGFVSYDNFESSDGALTAMNGQ 170



 Score = 36.7 bits (81), Expect = 0.63
 Identities = 22/63 (34%), Positives = 33/63 (52%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KKPI 691
           E F   G +V+V +  DK +G+ +G+GFVEF   +  D   ++  H IK +      KPI
Sbjct: 37  ELFIQCGPVVNVHIPKDKISGEHQGYGFVEFKSEEDAD-YAIKIMHMIKLYG-----KPI 90

Query: 692 SEN 700
             N
Sbjct: 91  KVN 93



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           A+G I+   +M++P+T  SKG+GF++Y      D A
Sbjct: 128 AFGHILSTKIMRNPETGVSKGYGFVSYDNFESSDGA 163


>UniRef50_Q6ZR81 Cluster: CDNA FLJ46566 fis, clone THYMU3040829,
           moderately similar to Cold- inducible RNA-binding
           protein; n=1; Homo sapiens|Rep: CDNA FLJ46566 fis, clone
           THYMU3040829, moderately similar to Cold- inducible
           RNA-binding protein - Homo sapiens (Human)
          Length = 135

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N +++
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKVR 72



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 17/44 (38%), Positives = 34/44 (77%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+     +D+A++
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFEN---IDDAKD 62


>UniRef50_UPI0000E47947 Cluster: PREDICTED: similar to GA10247-PA;
           n=4; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GA10247-PA - Strongylocentrotus purpuratus
          Length = 519

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   V +DP T++SKGFGFI Y      +     R HKID   +  +      E+K
Sbjct: 142 YGELLMAHVKRDPVTQKSKGFGFIRYKDVDSQEGVVEKR-HKID---LSSRWC----EVK 193

Query: 435 RPE---ASATVKKLFVAGLKQDIEEEDL 509
            P    A  + KKLF+  L  D  +EDL
Sbjct: 194 YPNTGGAQPSRKKLFIGRLTSDTTKEDL 221



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/56 (32%), Positives = 32/56 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIW 673
           ++EYF  +G ++   V  D  T K +GFGF+ + D D  + V +++ H+I   + W
Sbjct: 135 MKEYFGKYGELLMAHVKRDPVTQKSKGFGFIRYKDVDSQEGV-VEKRHKIDLSSRW 189


>UniRef50_UPI00006CFFFC Cluster: RNA binding protein; n=1;
           Tetrahymena thermophila SB210|Rep: RNA binding protein -
           Tetrahymena thermophila SB210
          Length = 451

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G+I++V V++DPKT   KGFG++ + +      A      K+  R +  K+AVP E +++
Sbjct: 207 GDILNVRVIRDPKTHEGKGFGYVFFKEKTGFQNALEKNGTKLLEREIRVKKAVPAERLEK 266

Query: 438 PEASATVK 461
            +     K
Sbjct: 267 KKVRKAEK 274



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/36 (38%), Positives = 26/36 (72%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +LR +F + G+I++V V+ D +T + +GFG+V F +
Sbjct: 198 QLRHHFESCGDILNVRVIRDPKTHEGKGFGYVFFKE 233


>UniRef50_Q552K5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 699

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 15/42 (35%), Positives = 28/42 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L+ YF  FGN++   ++ D  T K +G+GF+ F++ D +++V
Sbjct: 119 LKTYFLQFGNVLECKIIMDYNTNKSKGYGFITFENEDSIEKV 160


>UniRef50_A7S6X1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 172

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L  +FS FG +  V +V D+ TG  +GFGF+ F   +P  ++  Q N   K
Sbjct: 33  LETFFSNFGPVADVRIVCDRRTGLNKGFGFITFSLEEPAKKLIEQNNIDFK 83



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 2/59 (3%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPRE 425
           +G + DV ++ D +T  +KGFGFIT+S      +   QNN   K  GR +  ++A+ ++
Sbjct: 40  FGPVADVRIVCDRRTGLNKGFGFITFSLEEPAKKLIEQNNIDFK--GRSLRLRQAIRKK 96


>UniRef50_Q32P59 Cluster: SRA stem-loop-interacting RNA-binding
           protein, mitochondrial precursor; n=5;
           Laurasiatheria|Rep: SRA stem-loop-interacting
           RNA-binding protein, mitochondrial precursor - Bos
           taurus (Bovine)
          Length = 111

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/60 (36%), Positives = 33/60 (55%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A      LRE+F+ FG++   +V  DKETG  +G G++ F   + +     Q+NH I
Sbjct: 28  WTAASS---ELREHFAQFGHVRKCTVPFDKETGFHKGMGWIHFSSEEELHNALQQENHVI 84


>UniRef50_A4CFR2 Cluster: Putative uncharacterized protein; n=3;
           Alteromonadales|Rep: Putative uncharacterized protein -
           Pseudoalteromonas tunicata D2
          Length = 160

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/42 (45%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +RE F   G + SV ++ DK TGK+RGFGFVE  + D  + +
Sbjct: 81  VRELFEEHGKVFSVRLLKDKNTGKRRGFGFVEVAEKDAANTI 122


>UniRef50_A3J7P1 Cluster: RNA-binding protein; n=4;
           Gammaproteobacteria|Rep: RNA-binding protein -
           Marinobacter sp. ELB17
          Length = 124

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + +RE F   G +   ++V DKETGK +GFGFVE  D
Sbjct: 59  QEIRELFEAHGTVTECTLVLDKETGKSKGFGFVEMPD 95


>UniRef50_Q9SVM7 Cluster: RNA-binding protein like; n=1; Arabidopsis
           thaliana|Rep: RNA-binding protein like - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 126

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPK 407
           +G +VD +VM+D  T RS+GFGF+TYS     + A +    K ++GR V  K
Sbjct: 65  YGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 116



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LRE FS +GN+V   V+ D+ T + RGFGFV +  +   +
Sbjct: 58  LREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAE 97


>UniRef50_Q8VXC4 Cluster: Glycine rich RNA binding protein; n=20;
           Magnoliophyta|Rep: Glycine rich RNA binding protein -
           Oryza sativa (Rice)
          Length = 194

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           R L   FST+G I+   ++ D+ETG+ RGFGFV F
Sbjct: 22  RSLEAAFSTYGEILESKIINDRETGRSRGFGFVTF 56



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +GEI++  ++ D +T RS+GFGF+T+ S+  M D  +     ++DGR +    A  R
Sbjct: 31  YGEILESKIINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKELDGRNITVNEAQSR 87


>UniRef50_Q8LPB0 Cluster: Glycine-rich RNA-binding protein; n=1;
           Physcomitrella patens|Rep: Glycine-rich RNA-binding
           protein - Physcomitrella patens (Moss)
          Length = 155

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 16/33 (48%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++E FS FG +  V ++ D++TG+ RGFGFV F
Sbjct: 58  IKEAFSAFGEVTEVKIICDRDTGRSRGFGFVTF 90



 Score = 36.7 bits (81), Expect = 0.63
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYS 335
           IK    A+GE+ +V ++ D  T RS+GFGF+T++
Sbjct: 58  IKEAFSAFGEVTEVKIICDRDTGRSRGFGFVTFA 91


>UniRef50_Q6ID29 Cluster: At4g13860; n=9; cellular organisms|Rep:
           At4g13860 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 87

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPK 407
           +G +VD +VM+D  T RS+GFGF+TYS     + A +    K ++GR V  K
Sbjct: 26  YGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LRE FS +GN+V   V+ D+ T + RGFGFV +  +   +
Sbjct: 19  LREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAE 58


>UniRef50_Q556F3 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 904

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/37 (51%), Positives = 27/37 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + FS FG + SV V+TDK+TG+ +G+GFV+F   D
Sbjct: 785 LFQLFSQFGKLQSVRVITDKDTGENKGYGFVKFYQTD 821


>UniRef50_Q1JSB7 Cluster: RNA binding protein, putative; n=1;
           Toxoplasma gondii|Rep: RNA binding protein, putative -
           Toxoplasma gondii
          Length = 475

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/37 (48%), Positives = 25/37 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FGN+VS  V TD+ TG+ RGF FV +D+ +
Sbjct: 361 LMQNFGGFGNVVSARVATDRTTGRNRGFAFVSYDNVE 397


>UniRef50_A7SDQ4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 962

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           LRE F+T GN+ SV ++ D++TG  +GFG+V F+  D V       N + K
Sbjct: 800 LRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFK 850


>UniRef50_Q1LVU9 Cluster: Cold inducible RNA binding protein; n=8;
           Clupeocephala|Rep: Cold inducible RNA binding protein -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 223

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD-YDPVDRVCLQQNHQI 655
           L E FS +G I  V V+ D+ET + RGFGFV F++  D  D +      Q+
Sbjct: 38  LEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQV 88



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRA 413
           +G I  V V++D +T RS+GFGF+T+       +A      K +DGR++    A
Sbjct: 45  YGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQVDGRMIRVDEA 98


>UniRef50_Q9FZ84 Cluster: F26I16.3 protein; n=2; Arabidopsis
           thaliana|Rep: F26I16.3 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 155

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIV 398
           +K    ++G+IVD VV+ D ++  S+GFGF+TY    + + A     +K +DGRI+
Sbjct: 52  LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRII 107



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L+E F +FG IV   VV D+E+G  RGFGFV +D  +
Sbjct: 52  LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIE 88


>UniRef50_Q0DXG2 Cluster: Os02g0755400 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os02g0755400 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 176

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI++ VV+ D +T RSKG+GF+T+ +     EA  N    I GR
Sbjct: 69  YGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRNPNPTIGGR 114



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+++F  +G I+   V+TD+ET + +G+GFV F
Sbjct: 62  LQDHFQQYGEILEAVVITDRETSRSKGYGFVTF 94


>UniRef50_A2X9R7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 355

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI++ VV+ D +T RSKG+GF+T+ +     EA  N    I GR
Sbjct: 69  YGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRNPNPTIGGR 114



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+++F  +G I+   V+TD+ET + +G+GFV F
Sbjct: 62  LQDHFQQYGEILEAVVITDRETSRSKGYGFVTF 94


>UniRef50_Q382X1 Cluster: RNA-binding protein, putative; n=3;
           Trypanosoma|Rep: RNA-binding protein, putative -
           Trypanosoma brucei
          Length = 130

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY-DPVDRVCLQQNHQIKRFNI 670
           LR  F+ FG IVS ++V DKET + +G+GFV  + Y D  + V   Q H ++   +
Sbjct: 32  LRALFAPFGKIVSTALVRDKETKRCKGYGFVLMERYQDAYNAVMALQGHTVQHARV 87



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV   +++D +TKR KG+GF+   +     +   N    + G  V+  R   R  + 
Sbjct: 39  FGKIVSTALVRDKETKRCKGYGFVLMERY----QDAYNAVMALQGHTVQHARVQVR--LA 92

Query: 435 RPEASATVKK 464
           RPEAS  VKK
Sbjct: 93  RPEAS--VKK 100


>UniRef50_Q5KBA9 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 373

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/31 (58%), Positives = 25/31 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G I+ V++V DKETGK RGFGF+ ++D
Sbjct: 51  FSQWGEIMDVNLVRDKETGKSRGFGFLMYED 81



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVE 401
           WGEI+DV +++D +T +S+GFGF+ Y  Q   V    N    ++ GR ++
Sbjct: 54  WGEIMDVNLVRDKETGKSRGFGFLMYEDQRSTVLAVDNMNGTQVIGRTLK 103


>UniRef50_A5DJP2 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 235

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + +R+YF  FG I  + +  +K+TGK + +GF+EF D +     C   N+ +
Sbjct: 108 KEMRQYFDQFGEISRLRISRNKKTGKSKHYGFIEFQDKEVAKIACEAMNNYL 159


>UniRef50_A3LSC1 Cluster: Predicted protein; n=2;
           Saccharomycetales|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 252

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 14/37 (37%), Positives = 31/37 (83%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +++YFS FG+I+++ +  +K+TGK + +GF+EF++++
Sbjct: 125 MKKYFSQFGSIINLKLSRNKKTGKSKHYGFIEFENFE 161


>UniRef50_UPI00015B5E70 Cluster: PREDICTED: similar to nucleolar
           phosphoprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to nucleolar phosphoprotein - Nasonia
           vitripennis
          Length = 211

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++EYF  FG +  V V   K+TGK RG+G++EF
Sbjct: 75  MKEYFEQFGKVTRVRVARSKKTGKSRGYGYIEF 107


>UniRef50_UPI0000DB7209 Cluster: PREDICTED: similar to CG6937-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG6937-PA
           - Apis mellifera
          Length = 183

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +YF  FGN+  V VV  K TG+ RG+G+VEF
Sbjct: 72  DYFKQFGNVTRVRVVRSKNTGRSRGYGYVEF 102


>UniRef50_UPI0000EB047B Cluster: Cleavage stimulation factor 64 kDa
           subunit, tau variant (CSTF 64 kDa subunit, tau variant)
           (CF-1 64 kDa subunit, tau variant) (TauCstF-64).; n=3;
           Canis lupus familiaris|Rep: Cleavage stimulation factor
           64 kDa subunit, tau variant (CSTF 64 kDa subunit, tau
           variant) (CF-1 64 kDa subunit, tau variant)
           (TauCstF-64). - Canis familiaris
          Length = 381

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G++VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>UniRef50_Q4S5L6 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 252

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGF 595
           LR YF +FG+I    V+TDK+TGK RG+GF
Sbjct: 25  LRGYFQSFGDIDEAVVITDKQTGKSRGYGF 54


>UniRef50_Q4KLD9 Cluster: MGC116464 protein; n=1; Xenopus
           laevis|Rep: MGC116464 protein - Xenopus laevis (African
           clawed frog)
          Length = 391

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSV-SVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           + L + FS FGN++S   ++ D E+G  +GF FV FD +D  D      N Q
Sbjct: 112 KMLFDTFSQFGNLISTPKIMKDPESGGSKGFAFVSFDSFDGADHAIQSMNGQ 163



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           G ++SV++  DK +G  +G+GFVEF   +  D   L+  + IK +N
Sbjct: 35  GPVLSVNMPRDKVSGFHQGYGFVEFKTEEDAD-YALKVMNMIKLYN 79


>UniRef50_A0KEF3 Cluster: RNA-binding protein; n=4;
           Gammaproteobacteria|Rep: RNA-binding protein - Aeromonas
           hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB
           9240)
          Length = 163

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +RE F+  G ++SV ++ DK TGK+RGFGFVE    D
Sbjct: 88  VRELFAEQGQVISVRLMKDKATGKRRGFGFVEMPAAD 124


>UniRef50_Q4W5P0 Cluster: Homologous to drosophila sqd (Squid)
           protein protein 1, isoform b; n=3; Caenorhabditis|Rep:
           Homologous to drosophila sqd (Squid) protein protein 1,
           isoform b - Caenorhabditis elegans
          Length = 308

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 30/87 (34%), Positives = 39/87 (44%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+    V  D    RS+GF F+ ++       A   R   I G+ VE K A  RE   
Sbjct: 52  YGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSREN-- 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                   KK+FV GL  D  E+DL S
Sbjct: 110 --------KKVFVGGLPSDYSEQDLRS 128



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           LR +F  FG +  +    DK+T  +R F F+ F++ +  D+   Q
Sbjct: 126 LRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQ 170



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 19/71 (26%), Positives = 31/71 (43%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L  +F+ +G +    V  D+  G+ RGF FVEF   +        +   IK  ++ +   
Sbjct: 45  LSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPA 104

Query: 686 PISEN*HVWAG 718
              EN  V+ G
Sbjct: 105 KSRENKKVFVG 115



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 15/56 (26%), Positives = 28/56 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G++ D+    D +TK  + F FI + +    D+A +        R  + K+AVP+
Sbjct: 133 FGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188


>UniRef50_Q4FW55 Cluster: Poly(A) binding protein, putative; n=6;
           Trypanosomatidae|Rep: Poly(A) binding protein, putative
           - Leishmania major strain Friedlin
          Length = 594

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/48 (43%), Positives = 27/48 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL E F  +G  VSV+V+ DKETG  R FGFV   D +   +   + N
Sbjct: 303 RLEELFQRYGETVSVTVMMDKETGVSRCFGFVSMKDQNAASQAIQELN 350



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           ++L +YF   G + SV V  D  T K  G+G+V F D
Sbjct: 22  QKLYDYFVRIGPVTSVRVCVDSATQKSLGYGYVNFQD 58


>UniRef50_A3M0M8 Cluster: Predicted protein; n=2; Pichia|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 217

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/41 (41%), Positives = 32/41 (78%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L+++FS+ G +  V+++T+K TG+ +GF ++EFDD D V++
Sbjct: 105 LQQHFSSAGIVKRVTILTNKFTGQPKGFAYLEFDDVDGVNK 145


>UniRef50_Q1DXH0 Cluster: Polyadenylate-binding protein, cytoplasmic
           and nuclear (Poly(A)- binding protein); n=11;
           Pezizomycotina|Rep: Polyadenylate-binding protein,
           cytoplasmic and nuclear (Poly(A)- binding protein) -
           Coccidioides immitis
          Length = 768

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/36 (50%), Positives = 23/36 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R+ F  FG I S ++  D E+GK RGFGFV F  +D
Sbjct: 253 RDLFEKFGEITSATLARDAESGKSRGFGFVNFTSHD 288



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 13/98 (13%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYS---QAHMVDEAQNNRPHKIDGRIV--EPKRAVP 419
           +GEI    + +D ++ +S+GFGF+ ++    A    EA N++  K     V    K+   
Sbjct: 259 FGEITSATLARDAESGKSRGFGFVNFTSHDNAAAAVEALNDKDFKGQKLYVGRAQKKHER 318

Query: 420 REEIKRPEASATVKK--------LFVAGLKQDIEEEDL 509
            EE+++   +A ++K        L++  L  DI++E L
Sbjct: 319 EEELRKQYEAARIEKASKYQGVNLYIKNLSDDIDDEKL 356



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKR------- 410
           A+G I+   V +D +   SKG+GF+ Y  A   + AQN   H ++G ++  K+       
Sbjct: 165 AFGNILSCKVAQD-EFGNSKGYGFVHYETA---EAAQNAIKH-VNGMLLNDKKVFVGHHI 219

Query: 411 AVPREEIKRPEASATVKKLFVAGLKQDIEEED 506
           A    + K  E  A    ++V  + QD  EE+
Sbjct: 220 AKKDRQSKFEEMKANFTNVYVKNIDQDTTEEE 251


>UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=74;
           cellular organisms|Rep: Glycine-rich RNA-binding protein
           8 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 169

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  FS FG+++   ++ D+E+G+ RGFGFV F D
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKR 410
           ++R    +G+++D  ++ D ++ RS+GFGF+T+  +  M D  +     ++DGR++    
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNE 81

Query: 411 AVPR 422
           A  R
Sbjct: 82  AQSR 85


>UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=16;
           cellular organisms|Rep: Glycine-rich RNA-binding protein
           7 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 176

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R L   F+ +G+++   ++ D+ETG+ RGFGFV F D
Sbjct: 22  RALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKD 58



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G+++D  ++ D +T RS+GFGF+T+  +  M D  +      +DGR +    A  R
Sbjct: 31  YGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87


>UniRef50_Q9H0L4 Cluster: Cleavage stimulation factor 64 kDa
           subunit, tau variant; n=83; Eukaryota|Rep: Cleavage
           stimulation factor 64 kDa subunit, tau variant - Homo
           sapiens (Human)
          Length = 616

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G++VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>UniRef50_Q14011 Cluster: Cold-inducible RNA-binding protein; n=62;
           Eukaryota|Rep: Cold-inducible RNA-binding protein - Homo
           sapiens (Human)
          Length = 172

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+       +A      K +DGR +   +
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQ 81

Query: 411 A 413
           A
Sbjct: 82  A 82


>UniRef50_A5KRV2 Cluster: RNP-1 like RNA-binding protein; n=1;
           candidate division TM7 genomosp. GTL1|Rep: RNP-1 like
           RNA-binding protein - candidate division TM7 genomosp.
           GTL1
          Length = 108

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEIK 434
           GE+ +  V+ D  + RSKGFGF+TY      D A     + ++DGR +    A PREE  
Sbjct: 27  GEVEEAKVVTDRDSGRSKGFGFVTYVNDEDADTAIKELDNSELDGRNIHVNEARPREERP 86

Query: 435 R 437
           R
Sbjct: 87  R 87



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 15/40 (37%), Positives = 26/40 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LR +F+  G +    VVTD+++G+ +GFGFV + + +  D
Sbjct: 19  LRAHFAEKGEVEEAKVVTDRDSGRSKGFGFVTYVNDEDAD 58


>UniRef50_Q9SJ28 Cluster: Putative glycine-rich RNA binding protein;
           n=1; Arabidopsis thaliana|Rep: Putative glycine-rich RNA
           binding protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 117

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + FS FGN++   ++ D++TGK R FGFV F++
Sbjct: 23  LTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEE 57


>UniRef50_Q5K249 Cluster: Putative glycine-rich RNA-binding protein;
           n=1; Guillardia theta|Rep: Putative glycine-rich
           RNA-binding protein - Guillardia theta (Cryptomonas phi)
          Length = 152

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR+ F+ FG I   +VV D+ETG+ RGFGFV F
Sbjct: 77  LRDLFAEFGAIQDANVVYDRETGRSRGFGFVTF 109



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPRE 425
           +G I D  V+ D +T RS+GFGF+T++++   + A        I GR V  K+A  RE
Sbjct: 84  FGAIQDANVVYDRETGRSRGFGFVTFAESADCEAAITAMDKANIGGRTVLVKQANVRE 141


>UniRef50_Q012A5 Cluster: Ps16 protein; n=2; Ostreococcus|Rep: Ps16
            protein - Ostreococcus tauri
          Length = 1094

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = +2

Query: 506  LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
            L++  S FG++    ++TD++TG+ RGFGFV   +    D V  Q N Q
Sbjct: 1031 LQDLCSEFGSVEDSRLITDRDTGRSRGFGFVTMSNTTEADEVVAQLNGQ 1079



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +2

Query: 506  LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
            L E FS F ++   SV+ D+ETG+ RGF FV  ++ + V+R     N
Sbjct: 930  LAELFSEF-DVRDASVMKDRETGRSRGFAFVSMNNEEDVERASAALN 975



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +3

Query: 255  WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIV 398
            +G + D  ++ D  T RS+GFGF+T S     DE  AQ N    +DGR++
Sbjct: 1038 FGSVEDSRLITDRDTGRSRGFGFVTMSNTTEADEVVAQLN-GQDVDGRVL 1086



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +3

Query: 261  EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREE 428
            ++ D  VMKD +T RS+GF F++ +    V+ A       ++DGR +   +A  + E
Sbjct: 938  DVRDASVMKDRETGRSRGFAFVSMNNEEDVERASAALNGREVDGRELRVSKAQAQAE 994


>UniRef50_O23189 Cluster: RNA-binding like protein; n=1; Arabidopsis
           thaliana|Rep: RNA-binding like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 306

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I D  + KDPK    +GFGF+T+++  + D     R H+I G+ V    A P +E  
Sbjct: 207 FGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEICGQEVAIDSATPLDE-A 264

Query: 435 RPEASAT 455
            P A A+
Sbjct: 265 GPSAGAS 271



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  FG+I    +  D +    RGFGFV F +    DRV  +++H+I
Sbjct: 200 LRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEI 248



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L++Y S FG++    V+ D+ TG+ RGFG+V F   +       Q   ++ R  +     
Sbjct: 19  LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKEEMRQPAKKVTRIFVARIPS 78

Query: 686 PISEN 700
            +SE+
Sbjct: 79  SVSES 83



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI 383
           +K  +  +G++ D +VMKD  T RS+GFG++T++ A    E       K+
Sbjct: 19  LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKEEMRQPAKKV 68


>UniRef50_A7PVU6 Cluster: Chromosome chr8 scaffold_34, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_34, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 907

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/86 (31%), Positives = 37/86 (43%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI +  V+ D  T +S+G+GFITY        A       IDGR+     A        
Sbjct: 89  GEIEEGAVIVDKTTGKSRGYGFITYKHMESTQSALQAPSKLIDGRMAVCNLACEGLSGAS 148

Query: 438 PEASATVKKLFVAGLKQDIEEEDLES 515
                  +KL++ GL  D+  E L S
Sbjct: 149 TTPDQAQRKLYIGGLAPDVTSEVLLS 174



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L  +F   G I   SV  DKET + RGFGFV +
Sbjct: 172 LLSFFGRHGEIEEGSVAYDKETNESRGFGFVTY 204



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 18/52 (34%), Positives = 27/52 (51%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           GEI +  V  D +T  S+GFGF+TY       +A ++    + GR +  K A
Sbjct: 180 GEIEEGSVAYDKETNESRGFGFVTYKTVEAAKKAIDDPQKFLGGRSIIVKLA 231



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           F   G I   +V+ DK TGK RG+GF+ +
Sbjct: 85  FRLHGEIEEGAVIVDKTTGKSRGYGFITY 113


>UniRef50_A7PNS9 Cluster: Chromosome chr8 scaffold_23, whole genome
           shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome
           chr8 scaffold_23, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 293

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 29/83 (34%), Positives = 42/83 (50%)
 Frame = +2

Query: 398 RAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGK 577
           RA    S G D + R+  +  +V  + +E  H    LRE FS FG +  V V  D +TG 
Sbjct: 194 RAGADRSSGTDMRRRNEENAVRV-SNLSEDTH-EADLRELFSRFGQLTRVYVAIDHKTGL 251

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
            RGFG+V F + +  +R   + N
Sbjct: 252 SRGFGYVNFVNREDAERAISKLN 274


>UniRef50_A3C5F0 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 470

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVS-VSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L + FS FG IV+   ++ D ETG  RGFGFV +D ++  D+     N+Q
Sbjct: 128 LYDTFSAFGVIVTNPKIMRDPETGNSRGFGFVSYDSFESSDQAIEAMNNQ 177



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 4/44 (9%)
 Frame = +3

Query: 252 AWGEIV-DVVVMKDPKTKRSKGFGFITYSQAHMVD---EAQNNR 371
           A+G IV +  +M+DP+T  S+GFGF++Y      D   EA NN+
Sbjct: 134 AFGVIVTNPKIMRDPETGNSRGFGFVSYDSFESSDQAIEAMNNQ 177


>UniRef50_Q8IIT2 Cluster: Nucleic acid binding factor, putative;
           n=1; Plasmodium falciparum 3D7|Rep: Nucleic acid binding
           factor, putative - Plasmodium falciparum (isolate 3D7)
          Length = 580

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L +YFS FG IV + V  +    K +GFGFV F+  + +++V  ++ H I
Sbjct: 239 KKDLEKYFSKFGKIVDIYVSRNISNNKNKGFGFVSFEKQESMNKVLKEKLHII 291



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           +LR YF  FG I+ + +  D  T + RG  FV F D + V  + L   H
Sbjct: 517 KLRNYFEKFGEIIDIYMPNDVYTNRPRGIAFVTFLDNESVKNI-LSDEH 564



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 15/58 (25%), Positives = 34/58 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G+IVD+ V ++    ++KGFGF+++ +   +++    + H I G+ +    A  R++
Sbjct: 249 FGKIVDIYVSRNISNNKNKGFGFVSFEKQESMNKVLKEKLHIICGKEIVVDVASMRDD 306


>UniRef50_Q86NL1 Cluster: RE27227p; n=5; Endopterygota|Rep: RE27227p
           - Drosophila melanogaster (Fruit fly)
          Length = 437

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L+E FS  G ++S+ +V D+E+GK +GFGF E+ D +
Sbjct: 31  KLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQE 68


>UniRef50_A7APD8 Cluster: RNA recognition motif domain containing
           protein; n=1; Babesia bovis|Rep: RNA recognition motif
           domain containing protein - Babesia bovis
          Length = 362

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT-YSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G ++   VM+D  + RS+GFGF+T Y Q +   E   +  H ++G+ V+ +R      +
Sbjct: 104 YGRVITAQVMRDYNSGRSRGFGFVTLYVQEN--TENLFSDEHNVNGKHVDVRR------M 155

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLES 515
           +   AS   +K+FV GL + + E+ L++
Sbjct: 156 QNDAASNMKRKIFVGGLPKSLSEQMLKT 183



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L E+F  +G +++  V+ D  +G+ RGFGFV
Sbjct: 97  LTEHFMKYGRVITAQVMRDYNSGRSRGFGFV 127


>UniRef50_A6SSI6 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 322

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/35 (48%), Positives = 26/35 (74%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           + FS+ GN+V+  +V D+ETG+ +GFGF E+ D D
Sbjct: 26  DIFSSAGNVVNFRLVYDRETGRPKGFGFAEYPDSD 60


>UniRef50_Q13595 Cluster: Transformer-2 protein homolog; n=57;
           Eumetazoa|Rep: Transformer-2 protein homolog - Homo
           sapiens (Human)
          Length = 282

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G +  V+VV D+ TG+ RGF FV F+  D
Sbjct: 133 RDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERID 171


>UniRef50_P19683 Cluster: 31 kDa ribonucleoprotein, chloroplast
           precursor; n=23; Magnoliophyta|Rep: 31 kDa
           ribonucleoprotein, chloroplast precursor - Nicotiana
           sylvestris (Wood tobacco)
          Length = 315

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           RL + FS  G +VS  VV D+ETG+ RGFGFV
Sbjct: 245 RLEQLFSEHGKVVSARVVYDRETGRSRGFGFV 276



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           G++V   V+ D +T RS+GFGF+T  S+A M D   N     +DGR +    A  R
Sbjct: 254 GKVVSARVVYDRETGRSRGFGFVTMASEAEMSDAIANLDGQSLDGRTIRVNVAEDR 309



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR-EEIK 434
           EI +V+  +D  T +S+GFGF+T S     ++A +    + ++GR++   +A  R E  +
Sbjct: 163 EIAEVIYNRD--TDQSRGFGFVTMSTVEEAEKAVEMYNRYDVNGRLLTVNKAARRGERPE 220

Query: 435 RPEASATVK-KLFVAGLKQDIEEEDLE 512
           RP  +     +++V  +   I++  LE
Sbjct: 221 RPPRTFEQSYRIYVGNIPWGIDDARLE 247


>UniRef50_UPI0000E4A87D Cluster: PREDICTED: similar to RNA-binding
           region (RNP1, RRM) containing 2; n=4; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to RNA-binding region
           (RNP1, RRM) containing 2 - Strongylocentrotus purpuratus
          Length = 600

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 16/41 (39%), Positives = 29/41 (70%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           R L+E+FS+ G + +V ++TD+ + + +G G+VE+D  D V
Sbjct: 222 RELKEFFSSVGKVRTVKIITDRNSRRSKGVGYVEYDVADSV 262


>UniRef50_UPI0000E4857E Cluster: PREDICTED: similar to cold
           inducible RNA-binding protein beta; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           cold inducible RNA-binding protein beta -
           Strongylocentrotus purpuratus
          Length = 577

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           R+ + F TFG I  V+++ +KE+G  RGFGF+ FD
Sbjct: 25  RMEKLFETFGKISQVNLMKNKESGDSRGFGFITFD 59


>UniRef50_UPI0000519E48 Cluster: PREDICTED: similar to U1-snRNP
           binding protein homolog; n=1; Apis mellifera|Rep:
           PREDICTED: similar to U1-snRNP binding protein homolog -
           Apis mellifera
          Length = 213

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L+E+FS +G ++S  V+ D  TG  +G+GFVE    D   RV
Sbjct: 78  LKEFFSKYGEVISAKVIVDIVTGLSQGYGFVEMRSEDEARRV 119


>UniRef50_Q7NHK5 Cluster: RNA-binding protein; n=10; cellular
           organisms|Rep: RNA-binding protein - Gloeobacter
           violaceus
          Length = 123

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + E FS +G + SV + TD+ETG+ RGF FVE  D
Sbjct: 17  ITEAFSEYGTVKSVKIPTDRETGRPRGFAFVEMAD 51


>UniRef50_Q7MWI3 Cluster: RNA-binding protein; n=5;
           Bacteroidetes/Chlorobi group|Rep: RNA-binding protein -
           Porphyromonas gingivalis (Bacteroides gingivalis)
          Length = 97

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           +G + S  V+TD+ETG+ RGFGFVE +D +   R
Sbjct: 26  YGAVTSARVITDRETGRSRGFGFVEMEDENDARR 59


>UniRef50_O83375 Cluster: RNA-binding protein, putative; n=1;
           Treponema pallidum|Rep: RNA-binding protein, putative -
           Treponema pallidum
          Length = 105

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L   FS FG ++SV+V+ DK T + +GFGFVE +  +  + V  + N +
Sbjct: 35  LASLFSQFGEVLSVAVIKDKLTQRSKGFGFVEMESAESAELVINELNEK 83



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGR 392
           +GE++ V V+KD  T+RSKGFGF+    A   +   N    K  +GR
Sbjct: 42  FGEVLSVAVIKDKLTQRSKGFGFVEMESAESAELVINELNEKEFEGR 88


>UniRef50_Q5EUH9 Cluster: Putative uncharacterized protein; n=1;
           Gemmata sp. Wa1-1|Rep: Putative uncharacterized protein
           - Gemmata sp. Wa1-1
          Length = 122

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 15/33 (45%), Positives = 27/33 (81%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVE 601
           +L++ F+ +G++VS  V+ D++TG+ +GFGFVE
Sbjct: 55  QLQDMFTPYGSVVSAQVIMDRDTGRSKGFGFVE 87


>UniRef50_A7CQC8 Cluster: RNP-1 like RNA-binding protein; n=1;
           Opitutaceae bacterium TAV2|Rep: RNP-1 like RNA-binding
           protein - Opitutaceae bacterium TAV2
          Length = 106

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR  FST G +  V + TD+ETG+ RGF FV FD
Sbjct: 19  LRTAFSTCGTLTDVFLATDRETGRPRGFAFVTFD 52


>UniRef50_A3J4E6 Cluster: RNA binding protein; n=4; cellular
           organisms|Rep: RNA binding protein - Flavobacteria
           bacterium BAL38
          Length = 111

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/32 (53%), Positives = 24/32 (75%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVE 601
           LR YF  +G + SV +++DK TG+ +GFGFVE
Sbjct: 17  LRGYFEEYGAVESVKIISDKFTGRSKGFGFVE 48


>UniRef50_Q1PES4 Cluster: RNA recognition motif-containing protein;
           n=2; Arabidopsis thaliana|Rep: RNA recognition
           motif-containing protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 317

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           LR YF  FG +V  +VV++   G+ +G+GF+ F DY
Sbjct: 28  LRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDY 63



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGR 392
           ++R    +G++VD  V+ +    RSKG+GFIT+      V   QN++P  IDGR
Sbjct: 28  LRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQNSKP-IIDGR 80


>UniRef50_A7PX80 Cluster: Chromosome chr12 scaffold_36, whole genome
           shotgun sequence; n=2; core eudicotyledons|Rep:
           Chromosome chr12 scaffold_36, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 103

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 16/35 (45%), Positives = 27/35 (77%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           + L++ FS+FG++  V ++ DK++G+ RGFGFV F
Sbjct: 15  KSLKDAFSSFGDVTEVRIMYDKDSGRSRGFGFVYF 49


>UniRef50_A7PIB0 Cluster: Chromosome chr13 scaffold_17, whole genome
           shotgun sequence; n=2; core eudicotyledons|Rep:
           Chromosome chr13 scaffold_17, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 287

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 14/46 (30%), Positives = 29/46 (63%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           +  +R++F  +G I+   +++DK TG+ +G+GFV F + +   + C
Sbjct: 29  KEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKEPEAAKKAC 74



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 22/67 (32%), Positives = 35/67 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI++ V++ D  T RSKG+GF+T+ +     +A  +    I+GR      A       
Sbjct: 39  YGEILEAVIISDKLTGRSKGYGFVTFKEPEAAKKACEDATPMINGRRANCNLASLGARRP 98

Query: 435 RPEASAT 455
           R  AS+T
Sbjct: 99  RSAASST 105


>UniRef50_Q8TA30 Cluster: Putative uncharacterized protein; n=1;
           Heterodera glycines|Rep: Putative uncharacterized
           protein - Heterodera glycines (Soybean cyst nematode
           worm)
          Length = 219

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR  F ++GNI S  V+ D E G+ +GFGFV F+  D   +  ++ N++I
Sbjct: 65  LRSNFESYGNITSAKVMCD-EHGRSKGFGFVCFEKADEATKAVVEMNNKI 113


>UniRef50_Q553V5 Cluster: Putative uncharacterized protein; n=4;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 91

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +  L+ +FS FGNI    VV D+ T + +GFGFV+F+  + V       N
Sbjct: 17  KEALKNHFSQFGNIKDCYVVLDRVTKRSKGFGFVQFESKESVQNAINSDN 66



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G I D  V+ D  TKRSKGFGF+ +     V  A N+  ++I+GR +    A+ ++
Sbjct: 27  FGNIKDCYVVLDRVTKRSKGFGFVQFESKESVQNAINS-DNEINGRKLVVNEALAKD 82


>UniRef50_A5K494 Cluster: Nucleic acid binding factor, putative;
           n=2; Plasmodium|Rep: Nucleic acid binding factor,
           putative - Plasmodium vivax
          Length = 753

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L +YFS +G IV + V  +    K +GFGFV F+    +D+V   + H I
Sbjct: 376 KKDLEKYFSKYGKIVDIYVSKNLSNNKNKGFGFVSFEKQSSMDKVLKDKLHII 428



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 15/46 (32%), Positives = 30/46 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G+IVD+ V K+    ++KGFGF+++ +   +D+   ++ H I G+
Sbjct: 386 YGKIVDIYVSKNLSNNKNKGFGFVSFEKQSSMDKVLKDKLHIICGK 431



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR YF  FG I+ + +  D  T + RG  FV F D D V ++   +N
Sbjct: 679 LRNYFEAFGEIIDIYMPNDVCTNRPRGIAFVTFLDNDCVKKILSNKN 725



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPRE 425
           A+GEI+D+ +  D  T R +G  F+T+     V +  +  N  H IDG+ V    A P  
Sbjct: 685 AFGEIIDIYMPNDVCTNRPRGIAFVTFLDNDCVKKILSNKNSKHIIDGKEVVVDLADPET 744

Query: 426 EIKR 437
           + K+
Sbjct: 745 KTKK 748


>UniRef50_Q1DPW0 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 147

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           LR+ FS FG+I    VV D++T + RGFGFV F      +    + N+Q
Sbjct: 18  LRQGFSKFGSIEEAIVVKDRDTNRSRGFGFVRFASEGEAEAAMNEMNNQ 66



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422
           +G I + +V+KD  T RS+GFGF+ ++     + A N     + DGR +   +A  R
Sbjct: 25  FGSIEEAIVVKDRDTNRSRGFGFVRFASEGEAEAAMNEMNNQEFDGRTIRVDKAADR 81


>UniRef50_P62995 Cluster: Splicing factor, arginine/serine-rich 10;
           n=30; Bilateria|Rep: Splicing factor,
           arginine/serine-rich 10 - Homo sapiens (Human)
          Length = 288

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 132 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 170



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 134 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 187


>UniRef50_P39697 Cluster: 40S ribosomal protein S19, mitochondrial
           precursor; n=85; Streptophytina|Rep: 40S ribosomal
           protein S19, mitochondrial precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 212

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ-IKRFNI 670
           L++ FS+F  +    V+T+K TG+ RG+GFV F   D  +      N Q +  FNI
Sbjct: 47  LKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNI 102


>UniRef50_UPI0001555426 Cluster: PREDICTED: similar to hematopoietic
           antigen CD38, partial; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to hematopoietic
           antigen CD38, partial - Ornithorhynchus anatinus
          Length = 258

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 16/31 (51%), Positives = 26/31 (83%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV++++V DK+TGK +GFGF+ ++D
Sbjct: 15  FSQYGEIVNINLVRDKKTGKSKGFGFLCYED 45



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV++ +++D KT +SKGFGF+ Y  Q   +    N    KI GR +
Sbjct: 18  YGEIVNINLVRDKKTGKSKGFGFLCYEDQRSTILAVDNFNGIKIKGRTI 66


>UniRef50_UPI0000E467CE Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 339

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/49 (34%), Positives = 33/49 (67%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           +++++FS FGNI  + +   K++GK +G+ ++EF +YD V +V  +  H
Sbjct: 65  QMKKFFSQFGNIKRLRLSRSKKSGKSKGYAYIEF-EYDEVAKVVTETMH 112


>UniRef50_UPI0000E46272 Cluster: PREDICTED: hypothetical protein;
           n=3; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 127

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/31 (54%), Positives = 24/31 (77%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++FST G + SV + T K+TGK RGFG++EF
Sbjct: 88  KHFSTAGELKSVRLATHKDTGKSRGFGYIEF 118


>UniRef50_UPI0000498AD7 Cluster: enhancer binding protein 2; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: enhancer binding
           protein 2 - Entamoeba histolytica HM-1:IMSS
          Length = 320

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           L+E+F  FG +V V V+ ++  G  +GFG+VEFD  +   +   + N+++ R
Sbjct: 19  LKEFFERFGKVVDV-VIMERYDGASKGFGYVEFDTEESAQKALREGNNEMLR 69



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 228 FFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEP 404
           F +K     +G++VDVV+M +     SKGFG++ +       +A +      + GR +  
Sbjct: 17  FELKEFFERFGKVVDVVIM-ERYDGASKGFGYVEFDTEESAQKALREGNNEMLRGRNIRV 75

Query: 405 KRAVPREEIKRPEAS 449
             A  R++ +  E S
Sbjct: 76  DMATERKQHEHKERS 90


>UniRef50_Q5PPI5 Cluster: Putative uncharacterized protein; n=1;
           Rattus norvegicus|Rep: Putative uncharacterized protein
           - Rattus norvegicus (Rat)
          Length = 148

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L ++FS+FG I  V VV D+ET + RGFGF+ F + +         N +++
Sbjct: 22  LEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGEVR 72



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 17/36 (47%), Positives = 27/36 (75%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++G I +VVV+KD +T+RS+GFGFIT++      +A
Sbjct: 28  SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDA 63


>UniRef50_A2AEK1 Cluster: Cleavage stimulation factor, 3' pre-RNA
           subunit 2; n=6; Bilateria|Rep: Cleavage stimulation
           factor, 3' pre-RNA subunit 2 - Mus musculus (Mouse)
          Length = 554

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>UniRef50_Q7NCQ3 Cluster: RNA-binding protein; n=1; Gloeobacter
           violaceus|Rep: RNA-binding protein - Gloeobacter
           violaceus
          Length = 195

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           R+ L   F+  G +VS+ V+TD++TGK RGFGF+     +  D    Q N
Sbjct: 16  RQELEAIFAPAGEVVSLKVITDRKTGKCRGFGFLTVSTPEAADSFIEQFN 65



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD 353
           GE+V + V+ D KT + +GFGF+T S     D
Sbjct: 27  GEVVSLKVITDRKTGKCRGFGFLTVSTPEAAD 58


>UniRef50_Q9LKA4 Cluster: Similarity to RNA-binding protein; n=5;
           Magnoliophyta|Rep: Similarity to RNA-binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 404

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/93 (24%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++ +  ++G++ + +V+ D  T +SKG+GF+T+        A      KIDGR+   + A
Sbjct: 91  LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLA 150

Query: 414 VPREEIKRPE-ASATVKKLFVAGLKQDIEEEDL 509
               +    + A  +++K++VA +  D+  + L
Sbjct: 151 ASGNQGTGSQIADISMRKIYVANVPFDMPADRL 183



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR  FS++G++    V+ DK TGK +G+GFV F   D
Sbjct: 91  LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVD 127


>UniRef50_Q3ED69 Cluster: Uncharacterized protein At1g22910.3; n=8;
           Magnoliophyta|Rep: Uncharacterized protein At1g22910.3 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 347

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  +K+    +GEI++ VV+ D  + RSKG+GF+T+ +A     A  +    IDGR
Sbjct: 25  HKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 15/47 (31%), Positives = 29/47 (61%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           +  ++++F  FG I+   V+TDK +G+ +G+GFV F + +     C+
Sbjct: 26  KETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACV 72


>UniRef50_Q01L95 Cluster: OSIGBa0137L20.5 protein; n=7; Oryza
           sativa|Rep: OSIGBa0137L20.5 protein - Oryza sativa
           (Rice)
          Length = 137

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/50 (34%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L E FS +G ++  ++VTDK T + +GFGFV+F   +  ++   + N ++
Sbjct: 53  LAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAANKAKEEMNGKV 102



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 13/49 (26%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIV 398
           +G++++  ++ D  T R KGFGF+ ++     ++A+     K+ +GR++
Sbjct: 60  YGQVLEATIVTDKMTNRPKGFGFVKFASEEAANKAKEEMNGKVLNGRVI 108


>UniRef50_A7QJF1 Cluster: Chromosome chr8 scaffold_106, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_106, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 332

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/57 (31%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           +G+I++ +VM +  T R +GFGFIT++    +++A +     ++DGR++   +A P+
Sbjct: 30  YGKILESLVMMERDTGRPRGFGFITFADHRAMEDAIREMHGRELDGRVISVNKAQPK 86



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 16/38 (42%), Positives = 26/38 (68%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           R L + FS +G I+   V+ +++TG+ RGFGF+ F D+
Sbjct: 21  RHLEDAFSRYGKILESLVMMERDTGRPRGFGFITFADH 58


>UniRef50_A7P2N7 Cluster: Chromosome chr1 scaffold_5, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_5, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 140

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVP 419
           +G+IV+V V+KD   KR +G+ FI Y+       A  N  HK +DGR+V  + A P
Sbjct: 61  FGQIVEVDVVKDKAAKRPRGYAFIQYTSQDHAMLALENMDHKYLDGRVVCVELAKP 116



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L+E FS FG IV V VV DK   + RG+ F+++   D
Sbjct: 54  LQEEFSKFGQIVEVDVVKDKAAKRPRGYAFIQYTSQD 90


>UniRef50_A3AVD4 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 611

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/36 (52%), Positives = 26/36 (72%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L + FS FGNI+S  V TD E G+ +GFGFV++D
Sbjct: 140 KTLHDTFSAFGNILSCKVATD-EMGQSKGFGFVQYD 174



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 5/91 (5%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G I+   V  D +  +SKGFGF+ Y +     EA  +    ++G ++  K       +
Sbjct: 148 AFGNILSCKVATD-EMGQSKGFGFVQYDKG----EAAQSAIKSLNGMLINDKPVYVGPFL 202

Query: 432 KRPEASATVKK-----LFVAGLKQDIEEEDL 509
           ++ E   +V K     +FV  L +   +EDL
Sbjct: 203 RKQERENSVDKTKFNNVFVKNLSESTTKEDL 233


>UniRef50_Q95QV8 Cluster: Putative uncharacterized protein; n=6;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 408

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++LRE F  FG++    V+ D  T K +G+GFV +   +  +R   Q N Q
Sbjct: 149 QKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQ 199



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G++ D  V++D  T +SKG+GF++Y +    + A
Sbjct: 158 FGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 192



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           +R+ F++FG I  V +       K +G+ FV+FD+ D   +  +Q N+Q
Sbjct: 256 IRQGFASFGRITEVRIF------KMQGYAFVKFDNKDAAAKAIVQMNNQ 298


>UniRef50_A2E4P7 Cluster: Spliceosomal protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Spliceosomal protein,
           putative - Trichomonas vaginalis G3
          Length = 221

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L + F  FGN++   VV D  TGK  G GFV +D +D  D+
Sbjct: 117 LLQTFRQFGNVLHARVVVDPATGKSLGHGFVAYDSFDAADK 157


>UniRef50_Q00880 Cluster: Cutinase negative acting protein; n=2;
           Sordariomycetes|Rep: Cutinase negative acting protein -
           Nectria haematococca
          Length = 507

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L E F  F  +V   VVT+K TG+ RGFG+V+F+D
Sbjct: 267 LYEAFKEFNGLVGARVVTEKGTGRSRGFGYVDFND 301



 Score = 36.7 bits (81), Expect = 0.63
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +RE+F     + SV + TD ++G  +GFG+V F+  +    V   +N
Sbjct: 372 VREFFGEVAEVASVRLPTDPDSGNLKGFGYVSFNSVEDAKAVIDAKN 418


>UniRef50_A1CJX8 Cluster: Glycine-rich RNA-binding protein,
           putative; n=2; Aspergillus|Rep: Glycine-rich RNA-binding
           protein, putative - Aspergillus clavatus
          Length = 133

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           LR+ F  FG +    VV D++T + RGFGFV F      D+     N+Q
Sbjct: 18  LRQGFEQFGQVEEAIVVKDRDTNRSRGFGFVRFSSDSDADKAMDAMNNQ 66



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGRIVEPKRAVPR 422
           +G++ + +V+KD  T RS+GFGF+ +S     D+A +     + DGR +   +A  R
Sbjct: 25  FGQVEEAIVVKDRDTNRSRGFGFVRFSSDSDADKAMDAMNNQEFDGRTIRVDKASER 81


>UniRef50_Q9GZT3 Cluster: SRA stem-loop-interacting RNA-binding
           protein, mitochondrial precursor; n=4; Mammalia|Rep: SRA
           stem-loop-interacting RNA-binding protein, mitochondrial
           precursor - Homo sapiens (Human)
          Length = 109

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A     +L+E+F+ FG++    +  DKETG  RG G+V+F   + +     Q+NH I
Sbjct: 28  WTAASS---QLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHII 84


>UniRef50_Q14498 Cluster: RNA-binding protein 39; n=55;
           Euteleostomi|Rep: RNA-binding protein 39 - Homo sapiens
           (Human)
          Length = 530

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 155 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 207



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 307


>UniRef50_UPI0000EB42F3 Cluster: UPI0000EB42F3 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB42F3 UniRef100
           entry - Canis familiaris
          Length = 133

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L ++FS+FG I  V VV D+ET + RGFGF+ F +
Sbjct: 22  LEDHFSSFGPISEVVVVKDRETQRSRGFGFITFSN 56



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQ-AHMVDEAQNNRPHKIDGR 392
           ++G I +VVV+KD +T+RS+GFGFIT+S   +  D  +      +DGR
Sbjct: 28  SFGPISEVVVVKDRETQRSRGFGFITFSNPEYASDTMRAMNGESLDGR 75


>UniRef50_Q6IRQ4 Cluster: MGC82187 protein; n=6; Tetrapoda|Rep:
           MGC82187 protein - Xenopus laevis (African clawed frog)
          Length = 370

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/54 (35%), Positives = 36/54 (66%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G +V+V++MKD +T +S+GF F+T+ S A   D A+      +DG+ ++ ++A
Sbjct: 31  YGRVVEVLLMKDRETNKSRGFAFVTFESPADAKDAARELNGKALDGKPIKVEQA 84



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G +V V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAVFCKYGRVVEVLLMKDRETNKSRGFAFVTFE 57


>UniRef50_Q9M9G6 Cluster: F14O23.18 protein; n=2; Arabidopsis
           thaliana|Rep: F14O23.18 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 461

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +LRE     G +VS  +VTD+ETGK +G+GF E+ D
Sbjct: 24  QLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKD 59


>UniRef50_Q8RWN5 Cluster: RNA-binding protein-like; n=3; Arabidopsis
           thaliana|Rep: RNA-binding protein-like - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 310

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           R L   FS FG+I+   ++ +++TG+ RGFGF+ F D   +D
Sbjct: 21  RDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMD 62



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           ++R    +G+I+D  +M +  T RS+GFGFIT++    +DE+ +         R++   R
Sbjct: 23  LERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNR 82

Query: 411 AVPR 422
           A P+
Sbjct: 83  AEPK 86


>UniRef50_Q5ZAN0 Cluster: Putative uncharacterized protein
           OSJNBb0053G03.10; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBb0053G03.10 - Oryza sativa subsp. japonica (Rice)
          Length = 230

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           + L+EYFS FG +    VVTD  T   RGFG ++F   +   R   +  H
Sbjct: 131 QELKEYFSNFGEVNRAIVVTDLNTKMPRGFGLIQFASEESTARALKKDRH 180



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +GE+   +V+ D  TK  +GFG I ++       A     H + G+ VE   A+P+++
Sbjct: 140 FGEVNRAIVVTDLNTKMPRGFGLIQFASEESTARALKKDRHFLCGQWVEVSLAMPKQQ 197


>UniRef50_Q01FM4 Cluster: FOG: RRM domain; n=1; Ostreococcus
           tauri|Rep: FOG: RRM domain - Ostreococcus tauri
          Length = 318

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 17/36 (47%), Positives = 26/36 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           L E F   G +  + +VT+++TGK +G+GFVEFDD+
Sbjct: 20  LTEIFCECGPVRELRLVTERDTGKLKGYGFVEFDDF 55


>UniRef50_Q582F3 Cluster: RNA-binding protein, putative; n=1;
           Trypanosoma brucei|Rep: RNA-binding protein, putative -
           Trypanosoma brucei
          Length = 599

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 21/52 (40%), Positives = 31/52 (59%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           +LR   +TFGNIVS  V+ D  T + RG+GFV F+  D    +C++  +  K
Sbjct: 236 KLRSVCATFGNIVSAKVMHDSNTNESRGYGFVMFET-DEQAALCVRTLNSCK 286


>UniRef50_Q54G90 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 459

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 20/35 (57%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR  FS FG I S  V+ D  TG  RGFGFV+F D
Sbjct: 115 LRSIFSAFGEIDSCRVMVDLNTGLSRGFGFVKFKD 149


>UniRef50_Q54BM2 Cluster: RNA-binding region-containing protein;
           n=1; Dictyostelium discoideum AX4|Rep: RNA-binding
           region-containing protein - Dictyostelium discoideum AX4
          Length = 565

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 4/91 (4%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK-- 407
           ++ +   +G I   +VMKD K   SKGFGF+ Y+     DEA      +++GR++  K  
Sbjct: 300 LREVFSQFGTITSAIVMKDDKATTSKGFGFVCYTAP---DEA-TRAVTEMNGRMIGTKPL 355

Query: 408 --RAVPREEIKRPEASATVKKLFVAGLKQDI 494
                 R++I+R +     ++ F  G++Q +
Sbjct: 356 YVALAQRKDIRRAQLEMQHQQKFKTGIRQQM 386



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           + L + FS FGNI+S  VVTD +    +GFGFV ++  +  D+   + N
Sbjct: 112 KALYDTFSAFGNILSCKVVTD-DGNSSKGFGFVHYETQESADKAIAKVN 159



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 27/79 (34%), Positives = 38/79 (48%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +L  +GEI ++ +M D K K SKGFGF  +  A    EA  N     +G+I   K  
Sbjct: 204 LKELLQQYGEITNITIMADDKGK-SKGFGFANFESA----EAAKNVVENENGKIFHGKPI 258

Query: 414 VPREEIKRPEASATVKKLF 470
                 K+ E  A +K  F
Sbjct: 259 YAGRAQKKIEREAELKHTF 277



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +LRE FS FG I S  V+ D +    +GFGFV +   D   R   + N
Sbjct: 299 KLREVFSQFGTITSAIVMKDDKATTSKGFGFVCYTAPDEATRAVTEMN 346



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +L+E    +G I +++++ D + GK +GFGF  F+  +    V   +N +I
Sbjct: 203 QLKELLQQYGEITNITIMAD-DKGKSKGFGFANFESAEAAKNVVENENGKI 252


>UniRef50_Q18724 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 114

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + +L  YF  +G+I SV++  D +TG  RGF  + FD  D  ++   Q+ H I
Sbjct: 38  KSQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIEQRPHVI 90



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVP 419
           +G I  V +  DP T   +GF  IT+      ++A   RPH IDG  V+ +  +P
Sbjct: 48  YGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIEQRPHVIDGDRVDVEPYIP 102


>UniRef50_Q4PBV1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 192

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 20/49 (40%), Positives = 25/49 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L   FST+G +    V+ D+ETG+ RGFGFV F      D      N Q
Sbjct: 19  LAHAFSTYGQLTDYIVMKDRETGRSRGFGFVTFATQAEADAAIAALNEQ 67



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           +G++ D +VMKD +T RS+GFGF+T++     D A       ++DGR +    A  R
Sbjct: 26  YGQLTDYIVMKDRETGRSRGFGFVTFATQAEADAAIAALNEQELDGRRIRVNMANSR 82


>UniRef50_P49314 Cluster: 31 kDa ribonucleoprotein, chloroplast
           precursor; n=10; core eudicotyledons|Rep: 31 kDa
           ribonucleoprotein, chloroplast precursor - Nicotiana
           plumbaginifolia (Leadwort-leaved tobacco)
          Length = 292

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/40 (45%), Positives = 26/40 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L+E FS  GN+V   VV D+++G+ RGFGFV +     V+
Sbjct: 224 LKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVN 263



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKR 410
           +K +    G +VD  V+ D  + RS+GFGF+TYS A  V++A ++     +DGR +    
Sbjct: 224 LKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVNDAIDSLNGIDLDGRSIRVSA 283

Query: 411 AVPR 422
           A  R
Sbjct: 284 AEER 287



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           F   GN+  V V+ DK +G+ RGFGFV     + V+    Q N
Sbjct: 108 FERAGNVEIVEVIYDKLSGRSRGFGFVTMSTKEEVEAAEQQFN 150



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIV 398
           G +  V V+ D  + RS+GFGF+T S    V+ A Q    ++IDGR +
Sbjct: 112 GNVEIVEVIYDKLSGRSRGFGFVTMSTKEEVEAAEQQFNGYEIDGRAI 159


>UniRef50_Q9UUE4 Cluster: Peptidyl-prolyl cis-trans isomerase cyp6;
           n=25; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           cyp6 - Schizosaccharomyces pombe (Fission yeast)
          Length = 432

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           FS FG I+S  V+ DKETG    + F+EFD+ + V++
Sbjct: 264 FSRFGKIISCQVIRDKETGDSLQYAFIEFDNKESVEK 300


>UniRef50_UPI0000E22438 Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand RNA-binding protein) (hnRNP core
           protein A1) (Unwinding protein 1) (UP1); n=1; Pan
           troglodytes|Rep: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand RNA-binding protein) (hnRNP core
           protein A1) (Unwinding protein 1) (UP1) - Pan
           troglodytes
          Length = 309

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 19/45 (42%), Positives = 27/45 (60%)
 Frame = +2

Query: 533 NIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           +IV    +T     KKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 140 SIVLQLTLTLGRGAKKRGFAFVTFDDHDSVDKIVIQKYHTVNDHN 184


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 687,728,738
Number of Sequences: 1657284
Number of extensions: 12967251
Number of successful extensions: 34856
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 31714
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34738
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63792713725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).