SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30010
         (545 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8D2I2 Cluster: YeaZ protein; n=1; Wigglesworthia gloss...    34   2.5  
UniRef50_Q7U270 Cluster: PPE FAMILY PROTEIN; n=19; Mycobacterium...    32   7.5  
UniRef50_Q6EIY7 Cluster: Glycoprotein IIb; n=5; Danio rerio|Rep:...    32   9.9  
UniRef50_Q8CF22 Cluster: Adult male testis cDNA, RIKEN full-leng...    32   9.9  

>UniRef50_Q8D2I2 Cluster: YeaZ protein; n=1; Wigglesworthia
           glossinidia endosymbiont of Glossina brevipalpis|Rep:
           YeaZ protein - Wigglesworthia glossinidia brevipalpis
          Length = 230

 Score = 33.9 bits (74), Expect = 2.5
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 86  LRNPEFIISILNFDYYICVGA*LKAFGVVRFKNTLYQVNSPDVCDIHLLPIISLKSFFIY 265
           + + +F IS+ NFD Y+ +   LK +      N ++     D+C   +  IIS+  +F Y
Sbjct: 163 ISSKKFAISVSNFDIYVLLKCSLKKY------NKIFYYKIFDIC---IKDIISISYYFFY 213

Query: 266 KNGFC 280
           K  +C
Sbjct: 214 KKKYC 218


>UniRef50_Q7U270 Cluster: PPE FAMILY PROTEIN; n=19; Mycobacterium|Rep:
            PPE FAMILY PROTEIN - Mycobacterium bovis
          Length = 3507

 Score = 32.3 bits (70), Expect = 7.5
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 374  NSKLNNEGRVVSGLSGAGSWPVRRIGSRDNAVGNTGN 484
            NS  NN G    G SG G+W +   GS +  +GNTG+
Sbjct: 1142 NSGTNNVG---IGNSGTGNWGIGNSGSGNTGIGNTGS 1175


>UniRef50_Q6EIY7 Cluster: Glycoprotein IIb; n=5; Danio rerio|Rep:
           Glycoprotein IIb - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1037

 Score = 31.9 bits (69), Expect = 9.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +3

Query: 6   LGHSFMKYNKYIIVCASMIEWIIFIYN*EILNS 104
           LG S   YN YI+ CA +  W + +   E +N+
Sbjct: 119 LGASVRTYNNYILACAPLFHWNVLVDQEEAMNT 151


>UniRef50_Q8CF22 Cluster: Adult male testis cDNA, RIKEN full-length
           enriched library, clone:1700084P21 product:hypothetical
           protein, full insert sequence; n=2; Mus musculus|Rep:
           Adult male testis cDNA, RIKEN full-length enriched
           library, clone:1700084P21 product:hypothetical protein,
           full insert sequence - Mus musculus (Mouse)
          Length = 165

 Score = 31.9 bits (69), Expect = 9.9
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = -3

Query: 456 RDPIRRTGQLPA-PDRPETTRPSLFNFEF*LFCH*TIKSGSEIIFKTNRPYCR 301
           +DP+ R  Q PA P  P     SL +FE       T   GS ++   NRP CR
Sbjct: 19  KDPLHRDAQRPASPPCPAAPPASLESFEIKPARLSTPPQGSTVLCLANRPLCR 71


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 515,621,887
Number of Sequences: 1657284
Number of extensions: 9913155
Number of successful extensions: 20825
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 20116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20815
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 35405708495
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).