SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30009
         (801 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2FMP7 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_Q98S16 Cluster: Putative uncharacterized protein orf232...    34   4.8  

>UniRef50_A2FMP7 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 990

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = -2

Query: 356 VAPTKSSSIQNIEKLTKVHDRLHLNYR*NRQRIDINNKYINNLR 225
           +A  KSS  QNIE L + +  L L+   +R  ID NN+ +NNL+
Sbjct: 387 IAVLKSSK-QNIESLNEQNRNLKLDLEKSRAEIDFNNETMNNLK 429


>UniRef50_Q98S16 Cluster: Putative uncharacterized protein orf232;
           n=1; Guillardia theta|Rep: Putative uncharacterized
           protein orf232 - Guillardia theta (Cryptomonas phi)
          Length = 232

 Score = 33.9 bits (74), Expect = 4.8
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 5/54 (9%)
 Frame = -1

Query: 159 FDLNIPLLLYVSHKNQVDISTMNKY*Y-----IVLCISLLLHLGIFVHLEISSS 13
           +D NI +   ++HKN+ D  T  K+ Y     ++L IS+  HLG+F +L + S+
Sbjct: 8   YDNNISIFTKINHKNKFD--TFLKFYYSLIAKLILSISIFKHLGVFNNLNLYST 59


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 755,550,549
Number of Sequences: 1657284
Number of extensions: 14198634
Number of successful extensions: 26287
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 25352
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26283
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 68731504465
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).