SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9H9S3 Cluster: Protein transport protein Sec61 subunit...    64   2e-09
UniRef50_A3BXT8 Cluster: Putative uncharacterized protein; n=1; ...    60   3e-08
UniRef50_A0CU87 Cluster: Chromosome undetermined scaffold_28, wh...    57   2e-07
UniRef50_Q22MG2 Cluster: Preprotein translocase, SecY subunit co...    55   7e-07
UniRef50_A3C0K6 Cluster: Putative uncharacterized protein; n=1; ...    51   1e-05
UniRef50_UPI0000499503 Cluster: Sec61 alpha subunit; n=3; Entamo...    48   1e-04
UniRef50_Q5KC69 Cluster: Protein transporter, putative; n=4; Euk...    46   4e-04
UniRef50_A2DZB2 Cluster: Preprotein translocase, SecY subunit, p...    44   0.002
UniRef50_Q7QS32 Cluster: GLP_661_10951_12423; n=1; Giardia lambl...    40   0.035
UniRef50_Q8U019 Cluster: Preprotein translocase subunit secY; n=...    37   0.19 
UniRef50_Q4DZU4 Cluster: Putative uncharacterized protein; n=2; ...    36   0.43 
UniRef50_A6C8L5 Cluster: Putative uncharacterized protein; n=1; ...    33   2.3  
UniRef50_A2ZMZ3 Cluster: Putative uncharacterized protein; n=2; ...    33   3.1  
UniRef50_A2ZMY6 Cluster: Putative uncharacterized protein; n=3; ...    33   3.1  
UniRef50_Q7RNN8 Cluster: TATA element modulatory factor; n=4; Pl...    33   4.1  
UniRef50_Q4Q8V2 Cluster: Putative uncharacterized protein; n=3; ...    33   4.1  
UniRef50_UPI0000D5740E Cluster: PREDICTED: similar to Centromeri...    32   5.4  
UniRef50_Q54T74 Cluster: Leucine-rich repeat-containing protein;...    32   5.4  
UniRef50_Q2FSG8 Cluster: Preprotein translocase secY subunit; n=...    32   5.4  
UniRef50_A0RUE4 Cluster: Preprotein translocase secY subunit; n=...    32   5.4  
UniRef50_Q9UX84 Cluster: Preprotein translocase subunit secY; n=...    32   5.4  
UniRef50_O28377 Cluster: Preprotein translocase subunit secY; n=...    32   5.4  
UniRef50_Q7QS31 Cluster: GLP_661_12509_12237; n=1; Giardia lambl...    32   7.1  
UniRef50_Q4N520 Cluster: Putative uncharacterized protein; n=2; ...    32   7.1  
UniRef50_A5DTE1 Cluster: Putative uncharacterized protein; n=1; ...    32   7.1  
UniRef50_A0B9U7 Cluster: Preprotein translocase, SecY subunit; n...    32   7.1  
UniRef50_P28541 Cluster: Preprotein translocase subunit secY; n=...    32   7.1  
UniRef50_Q751E3 Cluster: AGL237Cp; n=1; Eremothecium gossypii|Re...    31   9.4  
UniRef50_A6UWW1 Cluster: Preprotein translocase, SecY subunit; n...    31   9.4  
UniRef50_Q9YDD0 Cluster: Preprotein translocase subunit secY; n=...    31   9.4  

>UniRef50_Q9H9S3 Cluster: Protein transport protein Sec61 subunit
           alpha isoform 2; n=176; Eukaryota|Rep: Protein transport
           protein Sec61 subunit alpha isoform 2 - Homo sapiens
           (Human)
          Length = 476

 Score = 63.7 bits (148), Expect = 2e-09
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQAE+GGM  L F
Sbjct: 439 GAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF 476



 Score = 62.9 bits (146), Expect = 3e-09
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 416 YIPTAAAFGGLCIGALSVLADFLGAIGSG 444


>UniRef50_A3BXT8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 377

 Score = 59.7 bits (138), Expect = 3e-08
 Identities = 26/29 (89%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGG+CIGAL+VLADF+GAIGSG
Sbjct: 319 YIPTAAAFGGVCIGALTVLADFMGAIGSG 347



 Score = 45.2 bits (102), Expect = 7e-04
 Identities = 23/32 (71%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA-EMG 165
           G    GTGILLAVTIIYQYFE F KE+A E+G
Sbjct: 342 GAIGSGTGILLAVTIIYQYFETFEKERATELG 373


>UniRef50_A0CU87 Cluster: Chromosome undetermined scaffold_28, whole
           genome shotgun sequence; n=11; Eukaryota|Rep: Chromosome
           undetermined scaffold_28, whole genome shotgun sequence
           - Paramecium tetraurelia
          Length = 474

 Score = 56.8 bits (131), Expect = 2e-07
 Identities = 24/29 (82%), Positives = 28/29 (96%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIP AA+FGG+CIGAL++LADFLGAIGSG
Sbjct: 417 YIPIAASFGGMCIGALTILADFLGAIGSG 445



 Score = 36.7 bits (81), Expect = 0.25
 Identities = 17/29 (58%), Positives = 20/29 (68%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAE 159
           G    GTGILL+VTIIY YFE   KE+ +
Sbjct: 440 GAIGSGTGILLSVTIIYGYFETLKKEKEQ 468


>UniRef50_Q22MG2 Cluster: Preprotein translocase, SecY subunit
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Preprotein translocase, SecY subunit
           containing protein - Tetrahymena thermophila SB210
          Length = 551

 Score = 55.2 bits (127), Expect = 7e-07
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIP AA FGGLCIGALSV+ADF+G IGSG
Sbjct: 495 YIPIAATFGGLCIGALSVVADFIGVIGSG 523



 Score = 35.5 bits (78), Expect = 0.57
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAE 159
           G    GTGILLAV I+Y YFE F +E+ +
Sbjct: 518 GVIGSGTGILLAVNIVYGYFEQFKREKEQ 546


>UniRef50_A3C0K6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 215

 Score = 50.8 bits (116), Expect = 1e-05
 Identities = 22/29 (75%), Positives = 25/29 (86%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YI TAAA GGLC+GAL++LAD  GAIGSG
Sbjct: 166 YISTAAALGGLCVGALTILADMTGAIGSG 194



 Score = 32.3 bits (70), Expect = 5.4
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 70  SGPSAPGTGILLAVTIIYQYFEIFVKEQ 153
           +G    GTGILLA T++Y   + F KE+
Sbjct: 188 TGAIGSGTGILLAATVVYNLIDAFQKEE 215


>UniRef50_UPI0000499503 Cluster: Sec61 alpha subunit; n=3; Entamoeba
           histolytica HM-1:IMSS|Rep: Sec61 alpha subunit -
           Entamoeba histolytica HM-1:IMSS
          Length = 447

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 21/29 (72%), Positives = 24/29 (82%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIP AA+FGG+CI  LSV AD LGA+GSG
Sbjct: 388 YIPIAASFGGMCISLLSVGADLLGAVGSG 416


>UniRef50_Q5KC69 Cluster: Protein transporter, putative; n=4;
           Eukaryota|Rep: Protein transporter, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 478

 Score = 46.0 bits (104), Expect = 4e-04
 Identities = 20/28 (71%), Positives = 24/28 (85%)
 Frame = +3

Query: 6   IPTAAAFGGLCIGALSVLADFLGAIGSG 89
           IPTAAAFGG  +G LSV+AD +GA+GSG
Sbjct: 417 IPTAAAFGGATLGLLSVVADMMGALGSG 444



 Score = 40.3 bits (90), Expect = 0.020
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +1

Query: 43  GLCQCWPTSSGPSAPGTGILLAVTIIYQYFEIFVKEQA--EMGGMSTLLF 186
           GL        G    GTGIL+A TIIY YFE+ +KE +  +  G+  LLF
Sbjct: 429 GLLSVVADMMGALGSGTGILMATTIIYGYFELGIKENSGIDATGLGDLLF 478


>UniRef50_A2DZB2 Cluster: Preprotein translocase, SecY subunit,
           putative; n=5; Trichomonas vaginalis G3|Rep: Preprotein
           translocase, SecY subunit, putative - Trichomonas
           vaginalis G3
          Length = 484

 Score = 43.6 bits (98), Expect = 0.002
 Identities = 19/29 (65%), Positives = 22/29 (75%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAA GG+ +  LS +ADFL A GSG
Sbjct: 419 YIPTAAALGGILVALLSFVADFLSAFGSG 447


>UniRef50_Q7QS32 Cluster: GLP_661_10951_12423; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_661_10951_12423 - Giardia lamblia
           ATCC 50803
          Length = 490

 Score = 39.5 bits (88), Expect = 0.035
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAA  GGL +G +   AD  GAIGSG
Sbjct: 436 YIPTAALAGGLILGFVGFCADIFGAIGSG 464


>UniRef50_Q8U019 Cluster: Preprotein translocase subunit secY; n=4;
           Thermococcaceae|Rep: Preprotein translocase subunit secY
           - Pyrococcus furiosus
          Length = 468

 Score = 37.1 bits (82), Expect = 0.19
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIP    +G L +  ++VLADFLGA+G+G
Sbjct: 405 YIPYVTFWGSLTVALIAVLADFLGALGTG 433


>UniRef50_Q4DZU4 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 1006

 Score = 35.9 bits (79), Expect = 0.43
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%)
 Frame = -1

Query: 261 SIRAETTIKTELNAAVRLP--LSLRDLEEQCAHAAHLRLFLDKDLEVLVN-DGDGEQ 100
           SIR    ++  L  A+R+P  + +R +EEQ A   H+RL LD+   V V+   DGE+
Sbjct: 65  SIRMGEELELFLRLALRIPSWMQVRQIEEQYAEQIHVRLALDRLSTVFVDKQNDGEE 121


>UniRef50_A6C8L5 Cluster: Putative uncharacterized protein; n=1;
           Planctomyces maris DSM 8797|Rep: Putative
           uncharacterized protein - Planctomyces maris DSM 8797
          Length = 103

 Score = 33.5 bits (73), Expect = 2.3
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = -1

Query: 288 RYENVHLMMSI--RAETTIKTELNAAVRLPLSLRDLEEQCAHAAHLRLFLDKDLEVLVND 115
           R E   L++    R  T I+  L+  V L   L +L+        L + L+ +++VLV+D
Sbjct: 16  RIEGAKLLLGFWERERTAIEITLSRPVTLETRLSELDYDSLIVVELVMLLEGEMKVLVSD 75

Query: 114 GDGEQYPSARS 82
           GD E    ++S
Sbjct: 76  GDYEGLSDSQS 86


>UniRef50_A2ZMZ3 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 546

 Score = 33.1 bits (72), Expect = 3.1
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIG 83
           Y+  AA F G C+G LS+LA FLG  G
Sbjct: 376 YMTIAAIFVGFCVGFLSLLAGFLGLDG 402


>UniRef50_A2ZMY6 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 384

 Score = 33.1 bits (72), Expect = 3.1
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           Y+  AA   G+C+G L++LA F+G  GSG
Sbjct: 329 YMTMAAYIVGICVGLLNLLAGFMGLGGSG 357


>UniRef50_Q7RNN8 Cluster: TATA element modulatory factor; n=4;
           Plasmodium (Vinckeia)|Rep: TATA element modulatory
           factor - Plasmodium yoelii yoelii
          Length = 867

 Score = 32.7 bits (71), Expect = 4.1
 Identities = 19/56 (33%), Positives = 27/56 (48%)
 Frame = -3

Query: 400 HAHNTTPVGALPSTQQILNLKSNFFDKVQRCIHIQHYQI*KRTPNDVDSSRNDNKN 233
           +AHN  PV  L ++    N K N F      + I H     R+ +  DS+ +DNKN
Sbjct: 150 NAHNKDPVSNLEASNSNYNFKHNLFTHPGGYVSIDHK---NRSRSSNDSAPHDNKN 202


>UniRef50_Q4Q8V2 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 927

 Score = 32.7 bits (71), Expect = 4.1
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = -1

Query: 105 EQYPSARSRWPRGSRPALTEPRCTVLRTRPPSGC 4
           +  P + SR+ RG+ P+L   RC      PPS C
Sbjct: 106 DSLPQSFSRYERGAAPSLPRTRCATSLPLPPSAC 139


>UniRef50_UPI0000D5740E Cluster: PREDICTED: similar to Centromeric
           protein E (CENP-E protein); n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to Centromeric protein
           E (CENP-E protein) - Tribolium castaneum
          Length = 405

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = -3

Query: 421 HHPRTRRHAHNTTPVGALPSTQQILNLKSNFFDKVQRCIHIQHYQI 284
           ++  TR H  N     +LP  Q IL  K+   DK+++ +H Q  Q+
Sbjct: 12  YYSNTRSHLSNDQEHQSLPPLQVILEEKNRVIDKLKKQVHNQRIQL 57


>UniRef50_Q54T74 Cluster: Leucine-rich repeat-containing protein;
           n=1; Dictyostelium discoideum AX4|Rep: Leucine-rich
           repeat-containing protein - Dictyostelium discoideum AX4
          Length = 1378

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +1

Query: 22  RSEDCASGLCQCWPTSSGPS 81
           R+  C SG+C+C+P  +GPS
Sbjct: 812 RTNGCRSGICECYPNLTGPS 831


>UniRef50_Q2FSG8 Cluster: Preprotein translocase secY subunit; n=4;
           Methanomicrobiales|Rep: Preprotein translocase secY
           subunit - Methanospirillum hungatei (strain JF-1 / DSM
           864)
          Length = 479

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGS 86
           YIP     GG+ IG +SV+A+  G IG+
Sbjct: 413 YIPRVTVIGGVFIGIMSVVANLFGVIGA 440


>UniRef50_A0RUE4 Cluster: Preprotein translocase secY subunit; n=2;
           Thermoprotei|Rep: Preprotein translocase secY subunit -
           Cenarchaeum symbiosum
          Length = 478

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIP+    G + +GAL+  +D LG  GSG
Sbjct: 414 YIPSVTIIGSMILGALAGASDVLGVFGSG 442


>UniRef50_Q9UX84 Cluster: Preprotein translocase subunit secY; n=4;
           Sulfolobaceae|Rep: Preprotein translocase subunit secY -
           Sulfolobus solfataricus
          Length = 469

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = +1

Query: 43  GLCQCWPTSSGPSAPGTGILLAVTIIYQYFEIFVKEQA 156
           GL   + T  G    G GILLAVTI  QY+ +   E++
Sbjct: 419 GLIAVFATLLGAYGTGIGILLAVTIAIQYYSLLAYERS 456


>UniRef50_O28377 Cluster: Preprotein translocase subunit secY; n=44;
           Euryarchaeota|Rep: Preprotein translocase subunit secY -
           Archaeoglobus fulgidus
          Length = 493

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 13/22 (59%), Positives = 18/22 (81%)
 Frame = +1

Query: 88  GTGILLAVTIIYQYFEIFVKEQ 153
           GTG+LLAV+I Y+++E   KEQ
Sbjct: 456 GTGLLLAVSIAYRFYEDLAKEQ 477



 Score = 31.5 bits (68), Expect = 9.4
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGS 86
           YIP     GG  IG L+++A+ LG IG+
Sbjct: 426 YIPKVTILGGAIIGILTLVANMLGTIGN 453


>UniRef50_Q7QS31 Cluster: GLP_661_12509_12237; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_661_12509_12237 - Giardia lamblia
           ATCC 50803
          Length = 90

 Score = 31.9 bits (69), Expect = 7.1
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = -3

Query: 88  PEPMAPRKSASTDRAPMHSPPNAAAVGM 5
           P+P+AP+ SA     P   PP  AAVGM
Sbjct: 57  PDPIAPKMSAQNPTNPSIRPPARAAVGM 84


>UniRef50_Q4N520 Cluster: Putative uncharacterized protein; n=2;
           Theileria|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 249

 Score = 31.9 bits (69), Expect = 7.1
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = -1

Query: 339 NLIFSIKYNDVFTSNTTRYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEEQCAHAAH 160
           NL ++   ND+  SN    EN  + +++  E   +T L A   L   LR+  EQC    +
Sbjct: 30  NLNYAGNSNDL--SNKIN-ENSLVELTLNLERERETYLEAVAVLHDQLRESHEQCQQLVN 86

Query: 159 LRLFLDKDLEVLVNDG 112
               L ++LE  V+DG
Sbjct: 87  SHAELTRELEAEVDDG 102


>UniRef50_A5DTE1 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1101

 Score = 31.9 bits (69), Expect = 7.1
 Identities = 21/55 (38%), Positives = 25/55 (45%)
 Frame = -1

Query: 183 EQCAHAAHLRLFLDKDLEVLVNDGDGEQYPSARSRWPRGSRPALTEPRCTVLRTR 19
           E   HA  L L  DK LE+ VN   GE    A +  P G   A +  RC V+  R
Sbjct: 145 ESVQHAPTLGLINDKSLELTVNLYRGEYITMAENVEPAGIVVATSLQRCIVISLR 199


>UniRef50_A0B9U7 Cluster: Preprotein translocase, SecY subunit; n=6;
           Euryarchaeota|Rep: Preprotein translocase, SecY subunit
           - Methanosaeta thermophila (strain DSM 6194 / PT)
           (Methanothrixthermophila (strain DSM 6194 / PT))
          Length = 537

 Score = 31.9 bits (69), Expect = 7.1
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIG 83
           YIP     GG  IG L+V+A  LG +G
Sbjct: 470 YIPKVTVIGGAIIGLLTVIASLLGTLG 496


>UniRef50_P28541 Cluster: Preprotein translocase subunit secY; n=10;
           Euryarchaeota|Rep: Preprotein translocase subunit secY -
           Methanococcus vannielii
          Length = 438

 Score = 31.9 bits (69), Expect = 7.1
 Identities = 13/28 (46%), Positives = 20/28 (71%)
 Frame = +1

Query: 70  SGPSAPGTGILLAVTIIYQYFEIFVKEQ 153
           +G    GTG+LL V+I+Y+ +E  V+EQ
Sbjct: 396 TGALGGGTGVLLTVSIVYRLYEQLVQEQ 423


>UniRef50_Q751E3 Cluster: AGL237Cp; n=1; Eremothecium gossypii|Rep:
           AGL237Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 578

 Score = 31.5 bits (68), Expect = 9.4
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 1/83 (1%)
 Frame = -3

Query: 259 DSSRNDNKNGAERSGPTAAIITRLRRAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEP 80
           + + +D+    E   P AA +   RRA    +PS   P Q SR T +    R   + P  
Sbjct: 420 NDTEDDSWEEEEEKAPAAAPLPPPRRAAAPAQPSRESPEQSSRETSE-QPSRETPELPRR 478

Query: 79  MAPRKS-ASTDRAPMHSPPNAAA 14
             P  +  + D+AP  +P   A+
Sbjct: 479 DTPEPTEKADDKAPSGTPSRTAS 501


>UniRef50_A6UWW1 Cluster: Preprotein translocase, SecY subunit; n=2;
           Methanococcus|Rep: Preprotein translocase, SecY subunit
           - Methanococcus aeolicus Nankai-3
          Length = 443

 Score = 31.5 bits (68), Expect = 9.4
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQ 153
           G    GTG+LL V+I+Y+ +E  V+EQ
Sbjct: 403 GALGGGTGVLLTVSIVYRMYEQLVQEQ 429


>UniRef50_Q9YDD0 Cluster: Preprotein translocase subunit secY; n=1;
           Aeropyrum pernix|Rep: Preprotein translocase subunit
           secY - Aeropyrum pernix
          Length = 457

 Score = 31.5 bits (68), Expect = 9.4
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA 156
           G    GTG+LLAV II QY+ +  +E+A
Sbjct: 414 GAYGTGTGLLLAVGIINQYYAMITRERA 441


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 476,114,994
Number of Sequences: 1657284
Number of extensions: 9459076
Number of successful extensions: 34562
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 32864
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34545
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 25191138900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).