SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9BPR7 Cluster: Cuticle protein; n=4; Bombyx mori|Rep: ...    96   8e-19
UniRef50_O77057 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    90   5e-17
UniRef50_Q9BPR5 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    77   7e-13
UniRef50_Q9BPR2 Cluster: Cuticle protein; n=3; Endopterygota|Rep...    74   5e-12
UniRef50_Q9BPR3 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    69   1e-10
UniRef50_Q9BPR4 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ...    68   2e-10
UniRef50_UPI00015B5626 Cluster: PREDICTED: similar to Dbuz\Ccp7-...    66   1e-09
UniRef50_Q17BZ5 Cluster: Pupal cuticle protein, putative; n=36; ...    63   7e-09
UniRef50_Q5TWI4 Cluster: ENSANGP00000027390; n=42; Culicidae|Rep...    62   1e-08
UniRef50_Q17015 Cluster: Cuticle protein; n=82; Neoptera|Rep: Cu...    62   2e-08
UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;...    60   6e-08
UniRef50_UPI0000D5600A Cluster: PREDICTED: similar to CG9290-PA;...    59   1e-07
UniRef50_A0NCX3 Cluster: ENSANGP00000031409; n=1; Anopheles gamb...    58   3e-07
UniRef50_UPI0000D5600C Cluster: PREDICTED: similar to CG7076-PA;...    57   6e-07
UniRef50_UPI00015B5682 Cluster: PREDICTED: similar to ENSANGP000...    56   8e-07
UniRef50_Q16UT8 Cluster: Cuticle protein, putative; n=6; Endopte...    56   8e-07
UniRef50_P80681 Cluster: Larval cuticle protein A1A; n=6; Endopt...    56   1e-06
UniRef50_Q9VSH6 Cluster: CG7072-PA; n=3; Diptera|Rep: CG7072-PA ...    54   5e-06
UniRef50_Q9W077 Cluster: CG1919-PA; n=3; Diptera|Rep: CG1919-PA ...    53   7e-06
UniRef50_UPI00015B5628 Cluster: PREDICTED: similar to RE69226p; ...    53   1e-05
UniRef50_Q16X31 Cluster: Pupal cuticle protein, putative; n=2; A...    48   1e-05
UniRef50_UPI00003C00E7 Cluster: PREDICTED: similar to CG7072-PA;...    52   1e-05
UniRef50_Q16UU5 Cluster: Cuticle protein, putative; n=1; Aedes a...    52   1e-05
UniRef50_Q9VZF9 Cluster: CG1259-PB; n=3; Diptera|Rep: CG1259-PB ...    52   2e-05
UniRef50_A0NBC0 Cluster: ENSANGP00000005744; n=2; Endopterygota|...    52   2e-05
UniRef50_UPI0000D5600D Cluster: PREDICTED: similar to CG7076-PA;...    52   2e-05
UniRef50_UPI00015B5629 Cluster: PREDICTED: similar to Cuticle pr...    51   3e-05
UniRef50_UPI0000D5592F Cluster: PREDICTED: hypothetical protein;...    51   3e-05
UniRef50_UPI00015B60F5 Cluster: PREDICTED: similar to pupal cuti...    50   7e-05
UniRef50_UPI0000D56012 Cluster: PREDICTED: similar to CG13935-PA...    50   7e-05
UniRef50_Q9VSH7 Cluster: CG7076-PA; n=4; Diptera|Rep: CG7076-PA ...    50   7e-05
UniRef50_Q16X29 Cluster: Adult cuticle protein, putative; n=2; C...    50   7e-05
UniRef50_Q16X28 Cluster: Putative uncharacterized protein; n=1; ...    50   7e-05
UniRef50_Q16I16 Cluster: Cuticle protein, putative; n=2; Culicid...    50   7e-05
UniRef50_A0NG24 Cluster: ENSANGP00000030674; n=1; Anopheles gamb...    50   7e-05
UniRef50_Q9VW05 Cluster: CG9299-PA; n=1; Drosophila melanogaster...    50   9e-05
UniRef50_Q8IPD5 Cluster: CG33302-PA; n=1; Drosophila melanogaste...    50   9e-05
UniRef50_UPI0000D5771F Cluster: PREDICTED: similar to CG7076-PA;...    49   1e-04
UniRef50_Q5TWJ1 Cluster: ENSANGP00000029011; n=1; Anopheles gamb...    49   1e-04
UniRef50_O97062 Cluster: CG1330-PA; n=9; Endopterygota|Rep: CG13...    49   2e-04
UniRef50_Q9W078 Cluster: CG13935-PA; n=3; Diptera|Rep: CG13935-P...    48   2e-04
UniRef50_P26967 Cluster: Adult-specific cuticular protein ACP-20...    48   2e-04
UniRef50_UPI00015B59E6 Cluster: PREDICTED: similar to LP12967p; ...    48   3e-04
UniRef50_UPI00015B5625 Cluster: PREDICTED: similar to Cuticle pr...    48   3e-04
UniRef50_Q9VW02 Cluster: CG9283-PA; n=8; Sophophora|Rep: CG9283-...    48   3e-04
UniRef50_UPI000051ACBA Cluster: PREDICTED: similar to CG1259-PB;...    48   4e-04
UniRef50_A0NBM6 Cluster: ENSANGP00000029829; n=1; Anopheles gamb...    48   4e-04
UniRef50_UPI0000D56015 Cluster: PREDICTED: similar to CG1919-PA;...    47   5e-04
UniRef50_UPI0000D56006 Cluster: PREDICTED: similar to CG1919-PA;...    47   5e-04
UniRef50_Q7QDL7 Cluster: ENSANGP00000026489; n=3; Endopterygota|...    47   6e-04
UniRef50_Q16X30 Cluster: Adult cuticle protein, putative; n=1; A...    47   6e-04
UniRef50_O97060 Cluster: CG1327-PA; n=3; Drosophila|Rep: CG1327-...    47   6e-04
UniRef50_Q1DH39 Cluster: Adult cuticle protein, putative; n=13; ...    46   8e-04
UniRef50_Q17J77 Cluster: Cuticle protein, putative; n=1; Aedes a...    46   8e-04
UniRef50_A0NBM4 Cluster: ENSANGP00000029828; n=9; Culicidae|Rep:...    46   8e-04
UniRef50_Q9VW03 Cluster: CG9290-PA; n=3; Diptera|Rep: CG9290-PA ...    46   0.001
UniRef50_Q5TR98 Cluster: ENSANGP00000027257; n=1; Anopheles gamb...    46   0.001
UniRef50_Q16EY2 Cluster: Adult cuticle protein, putative; n=3; C...    46   0.001
UniRef50_UPI00015B5FE9 Cluster: PREDICTED: hypothetical protein;...    46   0.001
UniRef50_UPI0000DB79E3 Cluster: PREDICTED: similar to CG15006-PA...    46   0.001
UniRef50_UPI00015B6125 Cluster: PREDICTED: similar to ENSANGP000...    45   0.002
UniRef50_Q8IPD8 Cluster: CG31876-PA; n=2; Sophophora|Rep: CG3187...    45   0.002
UniRef50_Q4V5H9 Cluster: IP07124p; n=3; Sophophora|Rep: IP07124p...    45   0.002
UniRef50_Q16X77 Cluster: Adult cuticle protein, putative; n=4; C...    45   0.002
UniRef50_Q16T42 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_Q45V98 Cluster: RR2 cuticle protein 2; n=1; Myzus persi...    45   0.003
UniRef50_A0NCX5 Cluster: ENSANGP00000000739; n=1; Anopheles gamb...    45   0.003
UniRef50_Q9VZG2 Cluster: CG15006-PA; n=1; Drosophila melanogaste...    44   0.003
UniRef50_Q9VZG1 Cluster: CG15007-PA; n=2; Drosophila melanogaste...    44   0.003
UniRef50_Q7QIG5 Cluster: ENSANGP00000013250; n=2; Culicidae|Rep:...    44   0.003
UniRef50_Q4V480 Cluster: IP08764p; n=4; Endopterygota|Rep: IP087...    44   0.003
UniRef50_UPI0000DB73EB Cluster: PREDICTED: similar to CG7076-PA;...    44   0.004
UniRef50_UPI0000D5763B Cluster: PREDICTED: similar to CG9299-PA;...    44   0.006
UniRef50_Q16IY2 Cluster: Putative uncharacterized protein; n=2; ...    44   0.006
UniRef50_Q8MRD2 Cluster: RE04513p; n=2; Drosophila melanogaster|...    43   0.008
UniRef50_Q17C20 Cluster: Pupal cuticle protein, putative; n=8; C...    43   0.008
UniRef50_Q16X70 Cluster: Adult cuticle protein, putative; n=5; A...    43   0.008
UniRef50_UPI0000D5727F Cluster: PREDICTED: similar to CG9290-PA;...    43   0.010
UniRef50_P27780 Cluster: Pupal cuticle protein Edg-84A precursor...    42   0.013
UniRef50_Q9VKE2 Cluster: CG16963-PA; n=2; Drosophila melanogaste...    42   0.018
UniRef50_UPI00015B43DE Cluster: PREDICTED: similar to ENSANGP000...    42   0.024
UniRef50_Q9VSH5 Cluster: CG13670-PA; n=2; Sophophora|Rep: CG1367...    42   0.024
UniRef50_Q8IPE0 Cluster: CG31878-PB, isoform B; n=1; Drosophila ...    42   0.024
UniRef50_Q8IPD9 Cluster: CG31878-PA, isoform A; n=1; Drosophila ...    42   0.024
UniRef50_Q170Z6 Cluster: Pupal cuticle protein, putative; n=2; C...    42   0.024
UniRef50_Q7QD80 Cluster: ENSANGP00000018253; n=1; Anopheles gamb...    41   0.031
UniRef50_Q7PRE1 Cluster: ENSANGP00000015068; n=4; Endopterygota|...    41   0.031
UniRef50_P26968 Cluster: Adult-specific cuticular protein ACP-22...    41   0.031
UniRef50_Q9VLB1 Cluster: CG3818-PA; n=1; Drosophila melanogaster...    41   0.041
UniRef50_Q4V6L8 Cluster: IP11372p; n=3; Sophophora|Rep: IP11372p...    41   0.041
UniRef50_Q16F22 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_Q5TWJ2 Cluster: ENSANGP00000026095; n=2; Anopheles gamb...    40   0.054
UniRef50_Q9VDJ8 Cluster: CG5494-PA; n=3; Sophophora|Rep: CG5494-...    40   0.072
UniRef50_Q9V3P9 Cluster: CG3474-PA; n=6; Diptera|Rep: CG3474-PA ...    40   0.072
UniRef50_Q5TWH9 Cluster: ENSANGP00000027540; n=1; Anopheles gamb...    40   0.072
UniRef50_Q17C05 Cluster: Putative uncharacterized protein; n=1; ...    40   0.072
UniRef50_Q16R84 Cluster: Putative uncharacterized protein; n=2; ...    40   0.072
UniRef50_UPI00015B6123 Cluster: PREDICTED: similar to GA20083-PA...    40   0.095
UniRef50_Q45V97 Cluster: RR2 cuticle protein 3; n=1; Myzus persi...    40   0.095
UniRef50_Q16EK6 Cluster: Cuticle protein, putative; n=2; Culicid...    40   0.095
UniRef50_Q5TVQ9 Cluster: ENSANGP00000028691; n=1; Anopheles gamb...    39   0.17 
UniRef50_Q29KF3 Cluster: GA15548-PA; n=1; Drosophila pseudoobscu...    38   0.22 
UniRef50_A0NG23 Cluster: ENSANGP00000030675; n=1; Anopheles gamb...    38   0.22 
UniRef50_Q7JZJ3 Cluster: RE26879p; n=5; Endopterygota|Rep: RE268...    38   0.29 
UniRef50_Q4PFM1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.29 
UniRef50_Q9VQH5 Cluster: CG2973-PA; n=1; Drosophila melanogaster...    38   0.38 
UniRef50_Q16X39 Cluster: Adult cuticle protein, putative; n=2; A...    37   0.51 
UniRef50_A0NBM7 Cluster: ENSANGP00000029830; n=1; Anopheles gamb...    37   0.51 
UniRef50_P82121 Cluster: Cuticle protein 8; n=1; Blaberus cranii...    37   0.51 
UniRef50_UPI0000D55A42 Cluster: PREDICTED: similar to CG32029-PA...    37   0.67 
UniRef50_Q6D696 Cluster: Ribonuclease E; n=18; Gammaproteobacter...    37   0.67 
UniRef50_Q9VSN3 Cluster: CG32029-PA; n=4; Diptera|Rep: CG32029-P...    36   0.89 
UniRef50_Q5TWH8 Cluster: ENSANGP00000029291; n=1; Anopheles gamb...    36   0.89 
UniRef50_A3FK18 Cluster: CPF family cuticle protein; n=2; Anophe...    36   0.89 
UniRef50_A0NG12 Cluster: ENSANGP00000029772; n=13; Culicidae|Rep...    36   0.89 
UniRef50_UPI0000D55C02 Cluster: PREDICTED: similar to CG1919-PA;...    36   1.2  
UniRef50_Q29NE6 Cluster: GA16544-PA; n=1; Drosophila pseudoobscu...    36   1.2  
UniRef50_Q29D07 Cluster: GA16621-PA; n=1; Drosophila pseudoobscu...    36   1.2  
UniRef50_Q175B1 Cluster: Adult cuticle protein, putative; n=2; A...    36   1.2  
UniRef50_UPI00015B62AA Cluster: PREDICTED: hypothetical protein;...    36   1.5  
UniRef50_UPI0000D555C5 Cluster: PREDICTED: similar to CG2342-PA;...    36   1.5  
UniRef50_Q20BM2 Cluster: Class III homeodomain-leucine zipper pr...    36   1.5  
UniRef50_UPI0000D57280 Cluster: PREDICTED: similar to CG9290-PA;...    35   2.0  
UniRef50_Q7PP06 Cluster: ENSANGP00000017752; n=4; Endopterygota|...    35   2.0  
UniRef50_UPI0000D571CB Cluster: PREDICTED: similar to CG5494-PA;...    35   2.7  
UniRef50_Q17MU1 Cluster: Cuticle protein, putative; n=4; Aedes a...    35   2.7  
UniRef50_Q9A743 Cluster: Acetyl-CoA carboxylase, biotin carboxyl...    34   4.7  
UniRef50_Q9NDT7 Cluster: BCS-1; n=2; Balanus amphitrite|Rep: BCS...    33   6.2  
UniRef50_Q8SXK7 Cluster: RE11615p; n=2; Sophophora|Rep: RE11615p...    33   6.2  
UniRef50_Q7Q0W7 Cluster: ENSANGP00000019229; n=1; Anopheles gamb...    33   6.2  
UniRef50_A1CX01 Cluster: GPI anchored protein, putative; n=2; Tr...    33   6.2  
UniRef50_UPI00015B5644 Cluster: PREDICTED: hypothetical protein;...    33   8.3  
UniRef50_UPI0000DB7324 Cluster: PREDICTED: similar to CG6305-PA;...    33   8.3  
UniRef50_Q9GUY5 Cluster: DD5 protein; n=1; Marsupenaeus japonicu...    33   8.3  
UniRef50_Q16JC2 Cluster: Putative uncharacterized protein; n=1; ...    33   8.3  

>UniRef50_Q9BPR7 Cluster: Cuticle protein; n=4; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 248

 Score = 96.3 bits (229), Expect = 8e-19
 Identities = 58/131 (44%), Positives = 72/131 (54%), Gaps = 10/131 (7%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHATNYIAAAAPVHYASPVHY---AAPVAKVIAPA----HKVLVS--- 404
           +VSSQ I+RHDQP    Y A  A +  A+PV Y    APV    APA    H   V+   
Sbjct: 98  SVSSQNIVRHDQPQTIQYAAPVAKLAVAAPVAYHAAPAPVTYHAAPAAVSYHSAPVAKIV 157

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTT 584
           AH  EE A+PKY++ YSVADGHSGDNKSQ E RDG +   S  + +       +      
Sbjct: 158 AHQAEEIAYPKYEYNYSVADGHSGDNKSQQEVRDGDVVKGSYSFHEADGSIRTVEYTADD 217

Query: 585 TTAFNAIVSNT 617
            + FNA+V NT
Sbjct: 218 HSGFNAVVHNT 228



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 42/115 (36%), Positives = 53/115 (46%), Gaps = 4/115 (3%)
 Frame = +3

Query: 255 AVSSQTILRHDQP--HATNYIAAAAPVHY-ASPVHY-AAPVAKVIAPAHKVLVSAHHEEE 422
           AVSSQ+I+RHDQP  HA   +A A PV Y A+PV Y AAPVA   AP       A+    
Sbjct: 31  AVSSQSIVRHDQPQLHAAK-LAVATPVAYHAAPVAYQAAPVAYHAAPV------AYQAAP 83

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTT 587
            A+      YS A+  S  N  +H+        A    L +    A  + P   T
Sbjct: 84  VAYHTSPLRYSSAESVSSQNIVRHDQPQTIQYAAPVAKLAVAAPVAYHAAPAPVT 138


>UniRef50_O77057 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 197

 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 53/129 (41%), Positives = 71/129 (55%), Gaps = 8/129 (6%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHATNYIAAA-APVHYASPVHYAAPVAKVIAPAHKV-------LVSAH 410
           AVSSQ+I+RHD P   +Y +A  AP HYA+P+ +AAP+       H         L  AH
Sbjct: 27  AVSSQSIVRHDAP--AHYASAHYAPAHYAAPIVHAAPLIHAAPVVHAAPIVHAASLGYAH 84

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTT 590
             + YAHPK D+AYSVAD H+G +KSQHE+RDG     S   ++      ++        
Sbjct: 85  GHDTYAHPKNDYAYSVADPHTGGHKSQHENRDGGAVHGSYSLVEPDGSVRKVDNTADDHH 144

Query: 591 AFNAIVSNT 617
            FNA+V  T
Sbjct: 145 GFNAVVHKT 153


>UniRef50_Q9BPR5 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 243

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 40/110 (36%), Positives = 59/110 (53%), Gaps = 2/110 (1%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA--HHEEEYAHPKYDFAYSVADG 467
           HAT+ I    P ++++P  + AP   V    H        H+ +EYAHPKY ++YSV D 
Sbjct: 128 HATSAIHQV-PAYHSAPAVHEAPAVHVSTALHAASAGHEDHYVDEYAHPKYGYSYSVEDP 186

Query: 468 HSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
           H+GD+KSQHE+RDG +       L+      +++        FNA+V NT
Sbjct: 187 HTGDHKSQHETRDGDVVKGEYSLLQPDGSFRKVTYTADHHNGFNAVVHNT 236



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 32/80 (40%), Positives = 38/80 (47%), Gaps = 8/80 (10%)
 Frame = +3

Query: 255 AVSSQTILRHDQP--HAT--NYIAA-AAPVHYASPVHYAAPVAKVI--APAHKVLVSAHH 413
           AVSSQ I+RHDQ   H T  +Y A   APV  A+P  +AAP    I  AP +    + H 
Sbjct: 25  AVSSQNIVRHDQTIHHETPIHYTALHTAPVAQAAPEIHAAPAIHTIQEAPTYHAAPAVHE 84

Query: 414 EEEYAHPKYDFAYSVAD-GH 470
              Y        Y VA  GH
Sbjct: 85  ASSYQAIHSAPTYHVAPAGH 104


>UniRef50_Q9BPR2 Cluster: Cuticle protein; n=3; Endopterygota|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 238

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 24/109 (22%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHA-TNYIAAAAPVHYASPVHYAAPV---AKVIAPAHKVLV------- 401
           AVSSQ+I+RHD  H  T++       HY  PVH+ AP+   A + AP H   V       
Sbjct: 78  AVSSQSIVRHDTHHEQTHHEQPHEQPHYFVPVHHHAPIVHEAVIAAPIHHAPVHHVPVHH 137

Query: 402 -------------SAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
                         +HHE+ YA+PKY F Y + D H+GDNK QHE RDG
Sbjct: 138 IQQIAHHDESHHDESHHEDHYAYPKYAFEYKIEDPHTGDNKYQHEIRDG 186



 Score = 43.2 bits (97), Expect = 0.008
 Identities = 19/29 (65%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L EADGS+R V+YTAD   GF
Sbjct: 187 DVVKGEYSLHEADGSIRTVKYTADKKSGF 215


>UniRef50_Q9BPR3 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 203

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 2/76 (2%)
 Frame = +3

Query: 306 YIAAAAPVHYASPVHYAAPVAKV--IAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGD 479
           + A AA + +ASPV YAAP AKV  +AP  KV      EE  AHP+Y FAY V D  +GD
Sbjct: 40  HAAPAAHLIHASPVAYAAPFAKVAAVAPVAKV------EEYDAHPQYSFAYDVQDSLTGD 93

Query: 480 NKSQHESRDGTLCTAS 527
           +K+QHE+RDG +   S
Sbjct: 94  SKTQHETRDGDVVQGS 109



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y++V+ DG+ R V+YTAD H+GF
Sbjct: 104 DVVQGSYSVVDPDGTKRTVDYTADPHNGF 132


>UniRef50_Q9BPR4 Cluster: Cuticle protein; n=1; Bombyx mori|Rep:
           Cuticle protein - Bombyx mori (Silk moth)
          Length = 291

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 38/106 (35%), Positives = 57/106 (53%)
 Frame = +3

Query: 300 TNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGD 479
           ++YI A+  V + SPV +A  V     P    +  + H E++A  KY+F+YSV D H+GD
Sbjct: 80  SSYIHASPVVQHFSPVQHAPVVHHAAIPI--AVEHSDHVEDHAPAKYEFSYSVEDPHTGD 137

Query: 480 NKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
           +KSQHE+RDG +       L+      ++         FNAIV N+
Sbjct: 138 HKSQHETRDGDVVKGEYSLLQPDGSIRKVEYTADHHNGFNAIVHNS 183



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRP 622
           D V GEY+L++ DGS+RKVEYTAD H+GF        P
Sbjct: 148 DVVKGEYSLLQPDGSIRKVEYTADHHNGFNAIVHNSEP 185


>UniRef50_UPI00015B5626 Cluster: PREDICTED: similar to Dbuz\Ccp7-PA;
           n=5; Nasonia vitripennis|Rep: PREDICTED: similar to
           Dbuz\Ccp7-PA - Nasonia vitripennis
          Length = 144

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 3/75 (4%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYA---HPKYDFAYSVADGHSGDN 482
           A  A   YA+P  Y +  A++   +H + ++ HH EE+    HPKY FAY V D H+GD 
Sbjct: 13  ALVAGAVYAAPQSYHSHGAQLSLTSHAIPIANHHIEEHHYDHHPKYKFAYDVHDSHTGDI 72

Query: 483 KSQHESRDGTLCTAS 527
           KSQHE RDG +   S
Sbjct: 73  KSQHEERDGDVVHGS 87



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 19/30 (63%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D VHG Y+L++ADG  R V YTAD H GFQ
Sbjct: 82  DVVHGSYSLIDADGYKRVVHYTADKHSGFQ 111


>UniRef50_Q17BZ5 Cluster: Pupal cuticle protein, putative; n=36;
           Culicidae|Rep: Pupal cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 242

 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 37/80 (46%), Positives = 46/80 (57%), Gaps = 4/80 (5%)
 Frame = +3

Query: 282 HDQPHATNYIAAAAPVHYASPVHYAAPVAKVIA----PAHKVLVSAHHEEEYAHPKYDFA 449
           H   H +  +  AAPVH+ + VH AAPV  V A    P H  LV     E +A   Y+F+
Sbjct: 25  HASSHQSIQLHHAAPVHHVAAVH-AAPVHHVAAIHAAPVHHTLVK--EVEHHAPANYEFS 81

Query: 450 YSVADGHSGDNKSQHESRDG 509
           YSV D H+GD KSQHE+R G
Sbjct: 82  YSVHDEHTGDIKSQHETRHG 101



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R V+Y AD H GF
Sbjct: 102 DEVHGQYSLIDSDGHHRIVDYHADHHSGF 130


>UniRef50_Q5TWI4 Cluster: ENSANGP00000027390; n=42; Culicidae|Rep:
           ENSANGP00000027390 - Anopheles gambiae str. PEST
          Length = 199

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 4/67 (5%)
 Frame = +3

Query: 321 APVHYASPVHYAAPVAKVIAPAHKV----LVSAHHEEEYAHPKYDFAYSVADGHSGDNKS 488
           APVH  +PVH+A   A V  P H V      +++HE+ ++HP Y F Y V D H+GD+KS
Sbjct: 12  APVH--APVHHAPAHAPVHVPEHHVHHGYSGASYHEDYHSHPSYKFEYGVKDPHTGDHKS 69

Query: 489 QHESRDG 509
           Q E RDG
Sbjct: 70  QWEHRDG 76



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/32 (59%), Positives = 25/32 (78%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRY 604
           D V G+YTL EADG+ R VEY++D H+GFQ +
Sbjct: 77  DVVKGQYTLDEADGTKRVVEYSSDKHNGFQAH 108


>UniRef50_Q17015 Cluster: Cuticle protein; n=82; Neoptera|Rep:
           Cuticle protein - Anopheles gambiae (African malaria
           mosquito)
          Length = 245

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 3/76 (3%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVI---APAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGD 479
           IA+ A  + A+P   AAPVAKV    AP  KV  +A  EE  A+P Y F+Y ++D  +GD
Sbjct: 20  IASPAVSYAAAPALVAAPVAKVAYAAAPIAKVAYAAQPEEYDANPHYSFSYGISDALTGD 79

Query: 480 NKSQHESRDGTLCTAS 527
           +KSQ ESR G +   S
Sbjct: 80  SKSQQESRSGDVVQGS 95



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPV 661
           D V G Y++V+ DG+ R V+YTAD H+GF       R     + ++  APV
Sbjct: 90  DVVQGSYSVVDPDGTKRTVDYTADPHNGFNAV--VRREPLAAKTIVAAAPV 138


>UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 145

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 29/70 (41%), Positives = 40/70 (57%)
 Frame = +3

Query: 408 HHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTT 587
           H  + YA+PKY+F Y VADGH+GD+KSQHE RDG +   S   ++       +       
Sbjct: 59  HAIDYYAYPKYEFNYGVADGHTGDHKSQHEVRDGDVVKGSYSLVEPDGTIRTVHYTADDH 118

Query: 588 TAFNAIVSNT 617
             FNA+VS +
Sbjct: 119 NGFNAVVSRS 128


>UniRef50_UPI0000D5600A Cluster: PREDICTED: similar to CG9290-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9290-PA - Tribolium castaneum
          Length = 169

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/86 (39%), Positives = 43/86 (50%)
 Frame = +3

Query: 351 YAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTAST 530
           +AAPV    AP+H      H E  YAHPKY F Y V D H+GD KS  E+RDG +   S 
Sbjct: 75  HAAPVLVHSAPSH------HEEHHYAHPKYQFKYGVEDKHTGDIKSHEETRDGDVVKGSY 128

Query: 531 LWLKLTVQCARLSTPLTTTTAFNAIV 608
              +       +    +  T FNA+V
Sbjct: 129 SLHEPDGTILVVHYTASKKTGFNAVV 154


>UniRef50_A0NCX3 Cluster: ENSANGP00000031409; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031409 - Anopheles gambiae
           str. PEST
          Length = 215

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 28/65 (43%), Positives = 41/65 (63%)
 Frame = +3

Query: 333 YASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGT 512
           Y +P+     VAK+ AP     V+A + E  A+P+Y ++Y+VAD  +GDNK+Q ESR G 
Sbjct: 49  YHAPLGAYPAVAKIAAPLAVAKVAAPYAEYDANPQYSYSYAVADAVTGDNKNQQESRSGD 108

Query: 513 LCTAS 527
           + T S
Sbjct: 109 VVTGS 113



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 23/53 (43%), Positives = 28/53 (52%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVLL 667
           D V G Y+LVE DG+ R VEY AD  +GF      HR     +  LP   +LL
Sbjct: 108 DVVTGSYSLVEPDGTRRTVEYNADPINGFNAV--VHREPLAVKATLPFRAILL 158


>UniRef50_UPI0000D5600C Cluster: PREDICTED: similar to CG7076-PA;
           n=3; Tribolium castaneum|Rep: PREDICTED: similar to
           CG7076-PA - Tribolium castaneum
          Length = 558

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 23/40 (57%), Positives = 27/40 (67%)
 Frame = +3

Query: 408 HHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
           HH+E Y HPKY + Y V D H+GD KSQ E+RDG L   S
Sbjct: 51  HHQEHYHHPKYQYKYGVEDHHTGDIKSQEETRDGDLVKGS 90



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           HEE + HPKY F Y V D H+GD K   ESRDG
Sbjct: 478 HEEHHTHPKYHFKYGVEDKHTGDIKQHEESRDG 510



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+L E DG++  V YTAD H GF
Sbjct: 85  DLVKGSYSLHEPDGTILTVHYTADKHSGF 113



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+L E DG++  V YT D   GF
Sbjct: 511 DVVKGQYSLHEPDGTILTVHYTVDKKSGF 539


>UniRef50_UPI00015B5682 Cluster: PREDICTED: similar to
           ENSANGP00000019367; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000019367 - Nasonia
           vitripennis
          Length = 265

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 31/83 (37%), Positives = 45/83 (54%)
 Frame = +3

Query: 363 VAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLK 542
           V +V  PA  V V+   EE  A+P+Y FAY VAD  +GD+K+Q+E+RDG +   S   ++
Sbjct: 19  VVQVAQPAVAVPVAVKAEEVDAYPRYSFAYDVADSITGDSKAQYETRDGDVVQGSYSLIE 78

Query: 543 LTVQCARLSTPLTTTTAFNAIVS 611
                  +         FNA+VS
Sbjct: 79  ADGSRRIVDYTADPINGFNAVVS 101


>UniRef50_Q16UT8 Cluster: Cuticle protein, putative; n=6;
           Endopterygota|Rep: Cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 298

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +3

Query: 321 APVHYASPVHYAAPVAK---VIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQ 491
           APV Y++P+ YAAP+A    + AP  K ++S+        P+Y F+Y V+DG +GD KSQ
Sbjct: 21  APVGYSAPLGYAAPLATQSLIAAPLAKTVISS--------PQYSFSYGVSDGLTGDQKSQ 72

Query: 492 HESRDGTLCTAS 527
            ESR G +   S
Sbjct: 73  QESRSGDVVQGS 84



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+LV++DG  R V+YTAD  +GF
Sbjct: 79  DVVQGSYSLVDSDGLKRTVDYTADPINGF 107


>UniRef50_P80681 Cluster: Larval cuticle protein A1A; n=6;
           Endopterygota|Rep: Larval cuticle protein A1A - Tenebrio
           molitor (Yellow mealworm)
          Length = 174

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 2/75 (2%)
 Frame = +3

Query: 309 IAAAAPV-HYASPVHYAAPVAKVIAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDN 482
           +A AAPV   A+P+ YAAP A+    A   +      +EY  +P+Y F Y V DG +GD+
Sbjct: 42  LAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDS 101

Query: 483 KSQHESRDGTLCTAS 527
           K+Q ESR G +   S
Sbjct: 102 KNQVESRSGDVVQGS 116



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+LV+ DG+ R VEYTAD  +GF
Sbjct: 111 DVVQGSYSLVDPDGTRRTVEYTADPINGF 139


>UniRef50_Q9VSH6 Cluster: CG7072-PA; n=3; Diptera|Rep: CG7072-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 407

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 35/102 (34%), Positives = 44/102 (43%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQ 491
           A A P+      HYA P     AP     V A H E  A+PKY F Y + D H+GD KSQ
Sbjct: 53  AQAVPIELG---HYA-PALVHHAPVLSHAVHAVHAEPVAYPKYSFNYGIKDPHTGDIKSQ 108

Query: 492 HESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
            E RDG +       ++       +         FNA+V  T
Sbjct: 109 AEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKT 150



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 24/42 (57%), Positives = 29/42 (69%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTT 634
           D V G+Y+LVE DGSVR V+YTADDH+GF     +  PR  T
Sbjct: 115 DVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPRPNT 156


>UniRef50_Q9W077 Cluster: CG1919-PA; n=3; Diptera|Rep: CG1919-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 180

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = +3

Query: 408 HHEEE---YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPL 578
           HH+E    +A+PKY + Y VAD H+GD KSQHE RDG +   S   ++       +    
Sbjct: 41  HHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTA 100

Query: 579 TTTTAFNAIVSNT 617
                FNA+V  T
Sbjct: 101 DDHNGFNAVVHKT 113



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/29 (75%), Positives = 24/29 (82%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+LVE DGSVR VEYTADDH+GF
Sbjct: 78  DVVKGSYSLVEPDGSVRTVEYTADDHNGF 106


>UniRef50_UPI00015B5628 Cluster: PREDICTED: similar to RE69226p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           RE69226p - Nasonia vitripennis
          Length = 257

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +3

Query: 354 AAPVAKV--IAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
           AAP+A V  + P    +    H  + AHP+Y + Y V D  +GD+KSQHE RDG +    
Sbjct: 10  AAPLAPVETVVPIAAGVKPLEHPNDDAHPQYSYVYDVQDAVTGDSKSQHEERDGDVVRGG 69

Query: 528 TLWLKLTVQCARLSTPLTTTTAFNAIV 608
             +++       +     +   FNA+V
Sbjct: 70  YSFIESDGSRRIVDYVADSVNGFNAVV 96


>UniRef50_Q16X31 Cluster: Pupal cuticle protein, putative; n=2;
           Aedes aegypti|Rep: Pupal cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 183

 Score = 47.6 bits (108), Expect(2) = 1e-05
 Identities = 19/29 (65%), Positives = 24/29 (82%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+YTL+++DG+ R VEYTAD HHGF
Sbjct: 89  DVVKGQYTLLDSDGTERIVEYTADPHHGF 117



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 2/37 (5%)
 Frame = +3

Query: 405 AHHEEEYA--HPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HH+E++   HP Y F Y V D H+GD+K+  E RDG
Sbjct: 52  SHHDEDHHDDHPMYKFEYGVRDDHTGDHKTHWEHRDG 88



 Score = 24.6 bits (51), Expect(2) = 1e-05
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = +2

Query: 578 DDHHGFQRYRQQHRPRFTTQLMLP 649
           DDHH  Q+  QQH     TQ   P
Sbjct: 143 DDHHHHQQQPQQHNEDHHTQHHYP 166


>UniRef50_UPI00003C00E7 Cluster: PREDICTED: similar to CG7072-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG7072-PA
           - Apis mellifera
          Length = 203

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 22/38 (57%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRP 622
           D V GEY++VEADGS+R V YTADDH+GF     ++ P
Sbjct: 142 DTVKGEYSVVEADGSIRTVTYTADDHNGFNAVVTRNEP 179



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 7/115 (6%)
 Frame = +3

Query: 288 QPHATNYIAAAAPVHY------ASPVHYAAPVAKVIAPAHKVLVSAHHEEEY-AHPKYDF 446
           +P    Y+  ++P+ Y      +S V+ A P+ K  +           E EY A+P+Y F
Sbjct: 61  EPVFPTYVKVSSPISYRLLPKTSSLVYVAPPIIKTASAVVATDTKNEKEAEYMAYPRYSF 120

Query: 447 AYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVS 611
            Y V DG++GD+KS  E RDG         ++       ++        FNA+V+
Sbjct: 121 NYGVLDGYTGDSKSAWEERDGDTVKGEYSVVEADGSIRTVTYTADDHNGFNAVVT 175


>UniRef50_Q16UU5 Cluster: Cuticle protein, putative; n=1; Aedes
           aegypti|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 254

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 7/73 (9%)
 Frame = +3

Query: 312 AAAAPVHYASP----VHYAAPVAK---VIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGH 470
           AAA  + YA+P    V YAAP+A    V AP  K +V+  ++    +P+Y ++Y ++D  
Sbjct: 28  AAAPALTYAAPLAKTVSYAAPLATKTLVAAPLDKTVVADEYDP---NPQYSYSYGISDAV 84

Query: 471 SGDNKSQHESRDG 509
           +GD K QHESR+G
Sbjct: 85  TGDQKEQHESRNG 97



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/52 (48%), Positives = 30/52 (57%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           DAV G Y+LV+ADG  R VEYTAD  HGF      HR     + + P A V+
Sbjct: 98  DAVQGSYSLVDADGFKRTVEYTADPIHGFNAV--VHREPLAVKTVAPVAKVV 147



 Score = 36.3 bits (80), Expect = 0.89
 Identities = 27/55 (49%), Positives = 30/55 (54%), Gaps = 4/55 (7%)
 Frame = +3

Query: 282 HDQPHATNYIAAAAPVHYASPVHYAAPVAKVI---APA-HKVLVSAHHEEEYAHP 434
           H +P A   +A  A V  A+PV YAAPVAK I   APA  K LVS      YA P
Sbjct: 131 HREPLAVKTVAPVAKV-VAAPVAYAAPVAKTISYAAPAVTKTLVSQPAYASYAAP 184


>UniRef50_Q9VZF9 Cluster: CG1259-PB; n=3; Diptera|Rep: CG1259-PB -
           Drosophila melanogaster (Fruit fly)
          Length = 247

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 13/119 (10%)
 Frame = +3

Query: 291 PHATNYIAAAAPV--HYASPVH--YAAPVAKVIAP---------AHKVLVSAHHEEEYAH 431
           P A  + A  APV    A+PV    AAPVA V AP         A  V      E   AH
Sbjct: 84  PFAAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAH 143

Query: 432 PKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIV 608
           P+Y FAY V D  +GD+K+Q E+RDG +   S   ++       +S    +   FNA+V
Sbjct: 144 PQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVV 202



 Score = 39.9 bits (89), Expect = 0.072
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           D V G Y+L+E DGS R V Y AD  +GF    Q+  P      + P APVL
Sbjct: 170 DVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVP----VAVAPVAPVL 217


>UniRef50_A0NBC0 Cluster: ENSANGP00000005744; n=2;
           Endopterygota|Rep: ENSANGP00000005744 - Anopheles
           gambiae str. PEST
          Length = 117

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 30/64 (46%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = +3

Query: 330 HYASPVHYA--APV--AKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHE 497
           H + PVH +  APV  A   AP H   V   H++ + HPKY F Y V D H+GD+K+Q E
Sbjct: 3   HPSHPVHASVHAPVHHAPAHAPVHYHGVP-EHKDYHDHPKYKFEYGVKDPHTGDHKTQWE 61

Query: 498 SRDG 509
            RDG
Sbjct: 62  VRDG 65



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G+YTL EADG+ R V+Y +D H+GF+
Sbjct: 66  DVVKGQYTLHEADGTERVVDYKSDGHNGFE 95


>UniRef50_UPI0000D5600D Cluster: PREDICTED: similar to CG7076-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG7076-PA - Tribolium castaneum
          Length = 140

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 21/32 (65%), Positives = 24/32 (75%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           EE Y HPKY+F Y V D H+GD KSQ E+RDG
Sbjct: 61  EEHYDHPKYEFKYGVQDHHTGDIKSQEETRDG 92



 Score = 39.9 bits (89), Expect = 0.072
 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 2/38 (5%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF--QRYRQQH 616
           D V G+Y+L E DG++  V+YTAD H GF  +  RQ H
Sbjct: 93  DVVKGQYSLHEPDGTILTVKYTADKHSGFNAEVIRQGH 130


>UniRef50_UPI00015B5629 Cluster: PREDICTED: similar to Cuticle
           protein 21 (LM-ACP 21); n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to Cuticle protein 21 (LM-ACP 21) -
           Nasonia vitripennis
          Length = 344

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 32/91 (35%), Positives = 45/91 (49%)
 Frame = +3

Query: 336 ASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTL 515
           A+PV Y+APVAK +       V A ++    HP+Y ++Y V D  +GD+KSQ E RDG  
Sbjct: 29  AAPVLYSAPVAKTVVTK---TVDAEYDP---HPQYSYSYDVQDQLTGDSKSQEEQRDGDS 82

Query: 516 CTASTLWLKLTVQCARLSTPLTTTTAFNAIV 608
              S   L+       +         FNA+V
Sbjct: 83  VRGSYSLLESDGTRRTVHYTADDVNGFNAVV 113


>UniRef50_UPI0000D5592F Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 145

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +3

Query: 333 YASPVHYAAPV---AKVIA--PAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHE 497
           Y++  H+ AP    A V+A  PA   +V    E    +P+Y++AY+V D H+GD+KSQHE
Sbjct: 27  YSNVQHHPAPAPAPAHVVAAVPAVAPVVQTRVEPYDPNPQYNYAYAVNDQHTGDSKSQHE 86

Query: 498 SRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
           +R+G +                +       T FNA+V  T
Sbjct: 87  TRNGDVVHGQYSLTDPDGSRRTVDYSAGPHTGFNAVVHRT 126


>UniRef50_UPI00015B60F5 Cluster: PREDICTED: similar to pupal cuticle
           protein, putative; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to pupal cuticle protein, putative -
           Nasonia vitripennis
          Length = 147

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 28/64 (43%), Positives = 35/64 (54%), Gaps = 4/64 (6%)
 Frame = +3

Query: 330 HYASPVHYAAPVAKVIAPAHKVLVS---AHHEEEY-AHPKYDFAYSVADGHSGDNKSQHE 497
           H  S  H+  PV     P H++ V     H+  +Y AHPKY+FAY V D H+GD   Q E
Sbjct: 24  HAHSFSHFHGPVE---GPGHEISVHDKHGHNTIDYVAHPKYEFAYGVEDHHTGDYHGQKE 80

Query: 498 SRDG 509
            RDG
Sbjct: 81  HRDG 84



 Score = 36.3 bits (80), Expect = 0.89
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V GEYT+ E  G+VR V+Y AD H GF
Sbjct: 87  VTGEYTIKEPGGNVRTVKYHADPHGGF 113


>UniRef50_UPI0000D56012 Cluster: PREDICTED: similar to CG13935-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG13935-PA - Tribolium castaneum
          Length = 143

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 24/70 (34%), Positives = 35/70 (50%)
 Frame = +3

Query: 408 HHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTT 587
           H  + Y+HPKY F Y V+D H+GD K+Q E RDG +       ++       +       
Sbjct: 24  HAVDYYSHPKYAFKYGVSDPHTGDQKAQTEVRDGDVVKGQYSLVEPDGSIRTVDYVADPV 83

Query: 588 TAFNAIVSNT 617
             FNA+VS +
Sbjct: 84  NGFNAVVSKS 93



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 18/38 (47%), Positives = 24/38 (63%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRP 622
           D V G+Y+LVE DGS+R V+Y AD  +GF     +  P
Sbjct: 58  DVVKGQYSLVEPDGSIRTVDYVADPVNGFNAVVSKSAP 95


>UniRef50_Q9VSH7 Cluster: CG7076-PA; n=4; Diptera|Rep: CG7076-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 162

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 26/69 (37%), Positives = 33/69 (47%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTT 590
           H + YA PKY F Y V D H+GD KSQHE+RDG         ++       +        
Sbjct: 80  HVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHN 139

Query: 591 AFNAIVSNT 617
            FNA+V  T
Sbjct: 140 GFNAVVHKT 148


>UniRef50_Q16X29 Cluster: Adult cuticle protein, putative; n=2;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 188

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           H++ YA+PKY F Y V D H+GD+KSQ E RDG
Sbjct: 86  HKDYYAYPKYKFNYGVQDSHTGDHKSQWEIRDG 118



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+  E DG+ R VEYT+D H GF
Sbjct: 119 DVVKGGYSFYEPDGTKRVVEYTSDKHSGF 147


>UniRef50_Q16X28 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 362

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 2/78 (2%)
 Frame = +3

Query: 381 PAHKVLVSA--HHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQ 554
           PA K +  A   +  EYAHP Y F+Y V D HSGD KSQ E+RD  +       ++    
Sbjct: 18  PAVKAVKDALYAYAPEYAHPSYSFSYGVKDLHSGDVKSQWETRDDGIVKGHYSVVEPDGS 77

Query: 555 CARLSTPLTTTTAFNAIV 608
              +     + T FNA+V
Sbjct: 78  IREVDYTADSKTGFNAVV 95



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/36 (50%), Positives = 24/36 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRP 622
           V G Y++VE DGS+R+V+YTAD   GF    + H P
Sbjct: 65  VKGHYSVVEPDGSIREVDYTADSKTGFNAVVKTHGP 100


>UniRef50_Q16I16 Cluster: Cuticle protein, putative; n=2;
           Culicidae|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 225

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +3

Query: 417 EEY-AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTA 593
           EEY  HP+Y ++Y V D  +GDNK QHE+RDG + T     ++       +         
Sbjct: 57  EEYDPHPQYSYSYGVHDAVTGDNKEQHETRDGDVVTGQYSLVEPDGTRRTVDYTADPVNG 116

Query: 594 FNAIVSNT 617
           FNA+VS +
Sbjct: 117 FNAVVSKS 124


>UniRef50_A0NG24 Cluster: ENSANGP00000030674; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030674 - Anopheles gambiae
           str. PEST
          Length = 187

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 25/29 (86%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y+L+++DG  R VEYTADDH+GF
Sbjct: 98  DQVHGQYSLIDSDGHKRTVEYTADDHNGF 126



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHATNYIAAAAPVHYASPVHYAAPVAK--VIAPAHKVLVSAHHEEEYA 428
           AV+S  ++  +Q H T+Y  A+   H A P      +A+  ++    +  +  H +E++ 
Sbjct: 13  AVASAGVIPVEQIH-TSYQPASYSTHLAQPAAIVKTIAQPTIVKTIAQPTLVKHIDEDH- 70

Query: 429 HPKYDFAYSVADGHSGDNKSQHESRDG 509
             +YDF+Y V D H+GD K Q ESR G
Sbjct: 71  DAQYDFSYGVHDDHTGDIKEQRESRHG 97


>UniRef50_Q9VW05 Cluster: CG9299-PA; n=1; Drosophila melanogaster|Rep:
            CG9299-PA - Drosophila melanogaster (Fruit fly)
          Length = 1242

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 22/40 (55%), Positives = 26/40 (65%)
 Frame = +3

Query: 390  KVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
            KV+   H E   AHP+Y F Y+V D H+GDNK Q E RDG
Sbjct: 1151 KVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDG 1190



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +2

Query: 509  DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
            D V GEY+LVE DG+VR V+Y AD   GF
Sbjct: 1191 DVVKGEYSLVEPDGNVRTVKYYADWETGF 1219


>UniRef50_Q8IPD5 Cluster: CG33302-PA; n=1; Drosophila
           melanogaster|Rep: CG33302-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 340

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 29/58 (50%), Positives = 35/58 (60%)
 Frame = +3

Query: 336 ASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           A+PV  AAPV K +A A  VL     E     P+YDF+Y V D  +GD KSQ E+RDG
Sbjct: 105 AAPV-VAAPVVKTVAAAPAVLKQVELESS---PRYDFSYGVHDSITGDIKSQVETRDG 158



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQ 613
           V G Y++++ADG  R V YTADD +GF    Q+
Sbjct: 161 VVGSYSVLDADGFKRTVTYTADDINGFNAVVQR 193


>UniRef50_UPI0000D5771F Cluster: PREDICTED: similar to CG7076-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG7076-PA - Tribolium castaneum
          Length = 132

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/83 (34%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
 Frame = +3

Query: 381 PAHKVLVSAHHEEE----YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLT 548
           P H      H E+     YA PKY F Y V+D H+GD KSQ ESRDG +       ++  
Sbjct: 30  PQHHHQQEEHEEDHIIDYYAPPKYTFKYGVSDYHTGDIKSQQESRDGDVVKGQYSVVEPD 89

Query: 549 VQCARLSTPLTTTTAFNAIVSNT 617
                +       + FNA+V  T
Sbjct: 90  GSVRTVEYTADKHSGFNAVVHKT 112



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/43 (51%), Positives = 27/43 (62%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQ 637
           D V G+Y++VE DGSVR VEYTAD H GF     +  P+   Q
Sbjct: 77  DVVKGQYSVVEPDGSVRTVEYTADKHSGFNAVVHKTAPQHQQQ 119


>UniRef50_Q5TWJ1 Cluster: ENSANGP00000029011; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029011 - Anopheles gambiae
           str. PEST
          Length = 384

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/63 (39%), Positives = 33/63 (52%)
 Frame = +3

Query: 420 EYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFN 599
           EYAHP Y F+Y V D HSGD KSQ E+RD  +       ++       +     + T FN
Sbjct: 25  EYAHPAYSFSYGVKDLHSGDVKSQWETRDDGIVKGHYSVVEPDGSIREVDYTADSKTGFN 84

Query: 600 AIV 608
           A+V
Sbjct: 85  AVV 87



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/36 (50%), Positives = 24/36 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRP 622
           V G Y++VE DGS+R+V+YTAD   GF    + H P
Sbjct: 57  VKGHYSVVEPDGSIREVDYTADSKTGFNAVVKTHGP 92


>UniRef50_O97062 Cluster: CG1330-PA; n=9; Endopterygota|Rep:
           CG1330-PA - Drosophila melanogaster (Fruit fly)
          Length = 208

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 25/61 (40%), Positives = 33/61 (54%)
 Frame = +3

Query: 327 VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           V + + +  AAPVA   AP   +  +   EE   HP+Y ++Y V D  SGDNK   E RD
Sbjct: 14  VAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERD 73

Query: 507 G 509
           G
Sbjct: 74  G 74



 Score = 39.9 bits (89), Expect = 0.072
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V YTAD  +GF
Sbjct: 75  DVVRGEYSLIDADGFKRTVTYTADSINGF 103


>UniRef50_Q9W078 Cluster: CG13935-PA; n=3; Diptera|Rep: CG13935-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 194

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/65 (36%), Positives = 34/65 (52%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNA 602
           Y HPKY F Y VAD  +GD KSQHE+RDG +       ++       +     +   FNA
Sbjct: 30  YDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNA 89

Query: 603 IVSNT 617
           +V+ +
Sbjct: 90  VVTKS 94



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 22/52 (42%), Positives = 32/52 (61%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           D V G+Y+LVE DGS+R V+YTAD  HGF     +  P    Q ++  +P++
Sbjct: 59  DVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVV-ASPIV 109


>UniRef50_P26967 Cluster: Adult-specific cuticular protein ACP-20
           precursor; n=4; Tenebrionidae|Rep: Adult-specific
           cuticular protein ACP-20 precursor - Tenebrio molitor
           (Yellow mealworm)
          Length = 208

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/29 (68%), Positives = 24/29 (82%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L E DG+VR V+YTADDH+GF
Sbjct: 91  DVVKGEYSLAEPDGTVRVVKYTADDHNGF 119


>UniRef50_UPI00015B59E6 Cluster: PREDICTED: similar to LP12967p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           LP12967p - Nasonia vitripennis
          Length = 204

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTT 634
           D V GEY+++EADGS+R V YTADD +GF     + +P   T
Sbjct: 138 DTVRGEYSVMEADGSIRTVTYTADDKNGFNAVVTRTKPSRVT 179



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +3

Query: 414 EEEYA-HPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTT 590
           + E+A +PKY + Y V DG++GD K+  E RDG         ++       ++       
Sbjct: 105 DAEFAIYPKYSYNYGVVDGNTGDTKAAWEERDGDTVRGEYSVMEADGSIRTVTYTADDKN 164

Query: 591 AFNAIVSNT 617
            FNA+V+ T
Sbjct: 165 GFNAVVTRT 173


>UniRef50_UPI00015B5625 Cluster: PREDICTED: similar to Cuticle
           protein 8 (LM-8) (LM-ACP 8); n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to Cuticle protein 8
           (LM-8) (LM-ACP 8) - Nasonia vitripennis
          Length = 752

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +3

Query: 399 VSAHHEEEYAH-PKYDFAYSVADGHSGDNKSQHESRDG 509
           ++ HHEE Y H PKY F Y+V D H+ D K Q E+RDG
Sbjct: 15  LAEHHEEHYDHHPKYKFRYNVHDTHTHDIKEQEEARDG 52



 Score = 39.9 bits (89), Expect = 0.072
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+LVE DG  R V+Y+AD H GF
Sbjct: 53  DHVKGQYSLVEPDGGKRTVKYSADKHTGF 81


>UniRef50_Q9VW02 Cluster: CG9283-PA; n=8; Sophophora|Rep: CG9283-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 204

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>UniRef50_UPI000051ACBA Cluster: PREDICTED: similar to CG1259-PB;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG1259-PB
           - Apis mellifera
          Length = 397

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 28/84 (33%), Positives = 45/84 (53%)
 Frame = +3

Query: 357 APVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLW 536
           A VA  + P   V+ + + +    +P+Y F+YSVADG +GDNK+Q E+R+G +   S   
Sbjct: 200 ATVAAALPPTAAVVRTENFDP---NPQYSFSYSVADGLTGDNKAQEETRNGDVVQGSYSL 256

Query: 537 LKLTVQCARLSTPLTTTTAFNAIV 608
           ++       +S        FNA+V
Sbjct: 257 IEPDGSRRVVSYAADPINGFNAVV 280



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 21/51 (41%), Positives = 27/51 (52%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPV 661
           D V G Y+L+E DGS R V Y AD  +GF    Q+  P  T +  +   PV
Sbjct: 248 DVVQGSYSLIEPDGSRRVVSYAADPINGFNAVVQKD-PSITVKTAIAATPV 297


>UniRef50_A0NBM6 Cluster: ENSANGP00000029829; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029829 - Anopheles gambiae
           str. PEST
          Length = 152

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 2/36 (5%)
 Frame = +3

Query: 408 HHE--EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           HHE  + YA+PKY F Y V D H+GD KS  E RDG
Sbjct: 46  HHEPHDYYAYPKYKFEYGVKDPHTGDQKSHWEERDG 81



 Score = 37.1 bits (82), Expect = 0.51
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRY 604
           D V G Y+L E DGS R V Y AD  HGF+ +
Sbjct: 82  DVVKGVYSLYEPDGSERVVVYRADKLHGFEAH 113


>UniRef50_UPI0000D56015 Cluster: PREDICTED: similar to CG1919-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 115

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 25/67 (37%), Positives = 34/67 (50%)
 Frame = +3

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAF 596
           E  A+PKY F Y V DGH+GD K Q E RDG +       ++      ++       + F
Sbjct: 31  EPVAYPKYHFEYGVKDGHTGDIKEQTEERDGDVVKGEYSLVEPDGTVRKVQYRDDGHSGF 90

Query: 597 NAIVSNT 617
           NAIV+ T
Sbjct: 91  NAIVTRT 97


>UniRef50_UPI0000D56006 Cluster: PREDICTED: similar to CG1919-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 193

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 34/115 (29%), Positives = 52/115 (45%), Gaps = 5/115 (4%)
 Frame = +3

Query: 282 HDQPHATNYIAAAAPVHYASPV--HYAAPVA---KVIAPAHKVLVSAHHEEEYAHPKYDF 446
           + +P    Y  AA P+ Y  P+   Y   V    K I P +       +E+  A+PKY +
Sbjct: 47  YGKPVVPLYGKAALPL-YEKPIVPFYGKEVPLYEKPIVPVYGKAEVPIYEKPVAYPKYQY 105

Query: 447 AYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVS 611
           +Y V D H+GD+K+Q E R+G +   S    +       +         FNA+VS
Sbjct: 106 SYGVHDPHTGDHKAQEEIREGDVVKGSYSLAEPDGTIRVVKYTADDLNGFNAVVS 160


>UniRef50_Q7QDL7 Cluster: ENSANGP00000026489; n=3;
           Endopterygota|Rep: ENSANGP00000026489 - Anopheles
           gambiae str. PEST
          Length = 148

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 27/98 (27%), Positives = 43/98 (43%)
 Frame = +3

Query: 324 PVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESR 503
           P+ Y   + Y    AK I P H V  + H E    +P Y F+Y V+D H+GD+K   E+ 
Sbjct: 23  PLSYGPALSYGY-AAKAIQPLHTVAAAPHVEAYDPNPHYSFSYGVSDPHTGDSKHAEETL 81

Query: 504 DGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
              +   S    +      +++        FNA+V  +
Sbjct: 82  SNGVVHGSYSLTEPDGTIRKVTYTADKIHGFNAVVEKS 119



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 18/27 (66%), Positives = 21/27 (77%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           VHG Y+L E DG++RKV YTAD  HGF
Sbjct: 86  VHGSYSLTEPDGTIRKVTYTADKIHGF 112


>UniRef50_Q16X30 Cluster: Adult cuticle protein, putative; n=1;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 149

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 23/40 (57%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRY--RQQHRP 622
           D V G YTL +ADGS R VEYTAD  HGF+    + QH P
Sbjct: 92  DVVKGAYTLFDADGSTRIVEYTADPLHGFKAVVKKVQHEP 131



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 7/61 (11%)
 Frame = +3

Query: 348 HYAAPVAKVIAPAHKVLVSAHHEEE-------YAHPKYDFAYSVADGHSGDNKSQHESRD 506
           H+ A   KV    HK+    HHE+        +AH KY F Y V D H+GD+K+  E RD
Sbjct: 35  HHKAEHVKV--EHHKI--EHHHEDHIDVPHDYFAHAKYKFDYGVKDPHTGDHKTHWEERD 90

Query: 507 G 509
           G
Sbjct: 91  G 91


>UniRef50_O97060 Cluster: CG1327-PA; n=3; Drosophila|Rep: CG1327-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 217

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 23/40 (57%), Positives = 26/40 (65%), Gaps = 3/40 (7%)
 Frame = +3

Query: 399 VSAHHEEEYA---HPKYDFAYSVADGHSGDNKSQHESRDG 509
           +  H  E Y    HPKY+FAY V D  SGD+KSQ ESRDG
Sbjct: 49  IHPHGHEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDG 88



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPV 661
           D V GEY+L +ADG  R V+YTAD  +GF     +         ++  APV
Sbjct: 89  DVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHHKVVAAAPV 139


>UniRef50_Q1DH39 Cluster: Adult cuticle protein, putative; n=13;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 196

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 19/32 (59%), Positives = 24/32 (75%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           E+ Y++PKY F Y V D H+GD+KSQ E RDG
Sbjct: 86  EDYYSYPKYKFEYGVKDIHTGDHKSQWEMRDG 117



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V GEYTL EADGS R VEY AD  +GF+
Sbjct: 118 DVVKGEYTLDEADGSKRIVEYYADGKNGFE 147


>UniRef50_Q17J77 Cluster: Cuticle protein, putative; n=1; Aedes
           aegypti|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 148

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 30/85 (35%), Positives = 44/85 (51%)
 Frame = +3

Query: 354 AAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTL 533
           AAPVA  +APA   + + +   +   P+Y +AY+V D  +GDNKSQ E+RDG +   S  
Sbjct: 30  AAPVA-ALAPAVPAVAAVNTNYDPL-PQYTYAYNVQDALTGDNKSQQETRDGDVVKGSYS 87

Query: 534 WLKLTVQCARLSTPLTTTTAFNAIV 608
            ++       +         FNAIV
Sbjct: 88  LVEPDGTVRTVIYTADPINGFNAIV 112



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/51 (47%), Positives = 30/51 (58%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPV 661
           D V G Y+LVE DG+VR V YTAD  +GF    Q  R     + ++P APV
Sbjct: 80  DVVKGSYSLVEPDGTVRTVIYTADPINGFNAIVQ--RGPLVHKALVPVAPV 128


>UniRef50_A0NBM4 Cluster: ENSANGP00000029828; n=9; Culicidae|Rep:
           ENSANGP00000029828 - Anopheles gambiae str. PEST
          Length = 147

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           H++ + HPKY F Y V D H+GD+K+Q E RDG
Sbjct: 29  HKDYHDHPKYKFEYGVKDPHTGDHKTQWEVRDG 61



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G+YTL EADG+ R V+Y +D H+GF+
Sbjct: 62  DVVKGQYTLHEADGTERVVDYKSDGHNGFE 91


>UniRef50_Q9VW03 Cluster: CG9290-PA; n=3; Diptera|Rep: CG9290-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 198

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/29 (65%), Positives = 23/29 (79%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+L E+DG+ R VEYTADDH+GF
Sbjct: 110 DKVKGSYSLKESDGTTRVVEYTADDHNGF 138



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 18/31 (58%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           E + +PKY F Y V D H+GD KSQ E+RDG
Sbjct: 79  EPHHYPKYQFDYGVKDAHTGDQKSQWETRDG 109


>UniRef50_Q5TR98 Cluster: ENSANGP00000027257; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000027257 - Anopheles gambiae
           str. PEST
          Length = 141

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/32 (59%), Positives = 24/32 (75%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           ++ YA+PKY F Y V D H+GD+KSQ E RDG
Sbjct: 64  KDYYAYPKYKFEYGVKDYHTGDHKSQWEVRDG 95



 Score = 39.5 bits (88), Expect = 0.095
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V GEYT+ E DGS+R V+Y AD  +GF+
Sbjct: 96  DVVKGEYTVQEPDGSMRVVKYHADGKNGFE 125


>UniRef50_Q16EY2 Cluster: Adult cuticle protein, putative; n=3;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 244

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/29 (68%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y L EADG+ R VEYTADDH+GF
Sbjct: 159 DVVKGGYMLKEADGTTRVVEYTADDHNGF 187



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           + + YA+PKY F Y V D H+GD+K Q E RDG
Sbjct: 126 YNDYYAYPKYKFEYGVDDPHTGDHKKQWEVRDG 158


>UniRef50_UPI00015B5FE9 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 196

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/40 (52%), Positives = 28/40 (70%), Gaps = 1/40 (2%)
 Frame = +3

Query: 411 HEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
           H+EE+  P KY+FAY V D +SG++ S  ESRDG+L   S
Sbjct: 108 HQEEHHEPAKYNFAYQVKDSNSGNDYSHQESRDGSLTRGS 147


>UniRef50_UPI0000DB79E3 Cluster: PREDICTED: similar to CG15006-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG15006-PA - Apis mellifera
          Length = 123

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +3

Query: 396 LVSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLST 572
           L S + E  Y  HP+Y +AY+V D  +GD+KSQ E+R+G + + S  +++       +  
Sbjct: 31  LASVNPEFNYDPHPQYTYAYNVQDSLTGDSKSQQETRNGDIVSGSYSFIEADGTRRIVEY 90

Query: 573 PLTTTTAFNAIV 608
                  FNA+V
Sbjct: 91  TADPVNGFNAVV 102


>UniRef50_UPI00015B6125 Cluster: PREDICTED: similar to
           ENSANGP00000027390; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000027390 - Nasonia
           vitripennis
          Length = 216

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 426 AHPKYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           AHPKY+++Y V D H+GD  SQ E+RDG+  T
Sbjct: 94  AHPKYEYSYGVEDHHTGDFHSQKETRDGSSVT 125


>UniRef50_Q8IPD8 Cluster: CG31876-PA; n=2; Sophophora|Rep:
           CG31876-PA - Drosophila melanogaster (Fruit fly)
          Length = 146

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/29 (62%), Positives = 24/29 (82%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+YTLV+ADG +R V+YT+D H+GF
Sbjct: 69  DQVQGQYTLVDADGYLRTVDYTSDAHNGF 97



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 25/50 (50%), Positives = 28/50 (56%)
 Frame = +3

Query: 360 PVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           P+    A   K L+     E  AH  YDFAYSV D H+GD KSQ ESR G
Sbjct: 21  PIYHSPAAIVKPLLKTVEVEAPAH--YDFAYSVHDEHTGDIKSQTESRKG 68


>UniRef50_Q4V5H9 Cluster: IP07124p; n=3; Sophophora|Rep: IP07124p -
           Drosophila melanogaster (Fruit fly)
          Length = 202

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/69 (37%), Positives = 37/69 (53%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +A   + AA  + YA+P    AP  KV+A    V   A  E    +P+Y F+Y V D H+
Sbjct: 60  YAAPKLLAAPAISYAAPAISYAP--KVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHT 117

Query: 474 GDNKSQHES 500
           GD+K Q E+
Sbjct: 118 GDSKQQEET 126



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 17/27 (62%), Positives = 21/27 (77%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           VHG Y+L E DG++RKV YTAD  +GF
Sbjct: 132 VHGSYSLAEPDGTIRKVTYTADKVNGF 158


>UniRef50_Q16X77 Cluster: Adult cuticle protein, putative; n=4;
           Culicidae|Rep: Adult cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 146

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/33 (57%), Positives = 22/33 (66%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           H + YAHPKY F Y V D  +GD+KS  E RDG
Sbjct: 40  HGDYYAHPKYKFEYGVQDHKTGDHKSHWEIRDG 72



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 16/32 (50%), Positives = 22/32 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRY 604
           D V G+Y+L E DG+ R VEY +D H GF+ +
Sbjct: 73  DVVKGQYSLHEPDGTERVVEYKSDKHSGFEAH 104


>UniRef50_Q16T42 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 212

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/31 (61%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           E Y +PKY F Y V D H+GD+KSQ E RDG
Sbjct: 111 EYYTYPKYKFEYGVQDFHTGDHKSQWEIRDG 141



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 19/35 (54%), Positives = 25/35 (71%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQ 613
           D V GEYTL +ADG+ R V+Y ADD +GF+   +Q
Sbjct: 142 DFVKGEYTLADADGTHRIVKYRADDKNGFRAVVRQ 176


>UniRef50_Q45V98 Cluster: RR2 cuticle protein 2; n=1; Myzus
           persicae|Rep: RR2 cuticle protein 2 - Myzus persicae
           (Peach-potato aphid)
          Length = 228

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 6/109 (5%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVA----KVIAPAHKV--LVSAHHEEEYAHPKYDFAYSVADGH 470
           + A AP    +P     PVA    K++APA  V  +V     +    P Y FAY V D  
Sbjct: 66  VIATAPAKIVTPPARTVPVAVAPAKLVAPAVPVAKVVQVVPAQFQPDPSYTFAYQVQDQI 125

Query: 471 SGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
           +GD+KSQ E+R G +       ++       +      T  FNA V  +
Sbjct: 126 TGDSKSQEETRQGDVVKGRYSLIEPDGTRRTVDYTADPTNGFNAYVQKS 174



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQ 613
           D V G Y+L+E DG+ R V+YTAD  +GF  Y Q+
Sbjct: 139 DVVKGRYSLIEPDGTRRTVDYTADPTNGFNAYVQK 173


>UniRef50_A0NCX5 Cluster: ENSANGP00000000739; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000000739 - Anopheles gambiae
           str. PEST
          Length = 224

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 18/27 (66%), Positives = 21/27 (77%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           VHG Y+L E DG++RKV YTAD  HGF
Sbjct: 87  VHGSYSLTEPDGTIRKVTYTADKIHGF 113



 Score = 40.3 bits (90), Expect = 0.054
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 3/104 (2%)
 Frame = +3

Query: 315 AAAPVHY--ASPVHYAAPVAKVIAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNK 485
           A  P+H   A+PV +A  +A   AP  K      H E Y  +P Y F+Y V+D H+GD+K
Sbjct: 23  AIQPLHTVAAAPVLHAPAIAVAAAPVLK------HVEAYDPNPHYSFSYGVSDPHTGDSK 76

Query: 486 SQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
              E+    +   S    +      +++        FNA+V  +
Sbjct: 77  HAEETLSNGVVHGSYSLTEPDGTIRKVTYTADKIHGFNAVVEKS 120


>UniRef50_Q9VZG2 Cluster: CG15006-PA; n=1; Drosophila
           melanogaster|Rep: CG15006-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 192

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/57 (43%), Positives = 31/57 (54%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVLLGSSL 679
           D V G Y+L+EADG+ R VEYTAD  HGF       R     + + P A VL  + L
Sbjct: 84  DVVQGAYSLIEADGTRRIVEYTADPVHGFNAV--VRREGAVVKAVAPVAKVLAPAPL 138



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +3

Query: 336 ASPVHYAAP-VAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           A P + + P +AKV AP   V   A  E    +P+Y F+Y V DG +GD KSQ E+R G
Sbjct: 27  ALPAYPSYPALAKVAAPL--VAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSG 83


>UniRef50_Q9VZG1 Cluster: CG15007-PA; n=2; Drosophila
           melanogaster|Rep: CG15007-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 147

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 5/94 (5%)
 Frame = +3

Query: 261 SSQTILRHDQPHATNY-----IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEY 425
           SS +I++H  P   +Y     + A   +        AA    ++  A  V V  + E + 
Sbjct: 6   SSDSIVKHKAPLENHYPPANLVMALIKITLICCALIAAIECALLPAAVPVGVPLNTEVD- 64

Query: 426 AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
            HP+Y FAY+V D  +GD+KSQ E RDG +   S
Sbjct: 65  PHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGS 98



 Score = 43.2 bits (97), Expect = 0.008
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHR-PRFTTQLMLPTAPVLLG 670
           D V G Y++V+ADGS+R V YTAD  +GF    Q+   P     L+ P A  +LG
Sbjct: 93  DVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPVPVAARPLVAPVAAPILG 147


>UniRef50_Q7QIG5 Cluster: ENSANGP00000013250; n=2; Culicidae|Rep:
           ENSANGP00000013250 - Anopheles gambiae str. PEST
          Length = 152

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/38 (50%), Positives = 25/38 (65%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
           ++ YA+PKY F Y V D  +GD+KSQ E RDG +   S
Sbjct: 49  QDYYAYPKYQFEYGVKDPLTGDHKSQWEMRDGDIVKGS 86



 Score = 40.3 bits (90), Expect = 0.054
 Identities = 18/30 (60%), Positives = 21/30 (70%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YTL E DG+ R VEY ADD +GF+
Sbjct: 81  DIVKGSYTLDEPDGTQRIVEYRADDRNGFE 110


>UniRef50_Q4V480 Cluster: IP08764p; n=4; Endopterygota|Rep: IP08764p
           - Drosophila melanogaster (Fruit fly)
          Length = 245

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 29/79 (36%), Positives = 36/79 (45%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGH 470
           P   ++    AP H   P  Y AP  K  AP          E     PKY F Y + DG+
Sbjct: 31  PGPLHHYGGYAPQHGPLPGPYVAP--KPAAP----------EPYDPDPKYSFGYDIQDGY 78

Query: 471 SGDNKSQHESRDGTLCTAS 527
           +GD KSQHE+R G +   S
Sbjct: 79  TGDLKSQHETRHGDVVKGS 97



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y++V+ DG+ R V+YTAD HHGF
Sbjct: 92  DVVKGSYSVVDPDGTKRTVDYTADPHHGF 120


>UniRef50_UPI0000DB73EB Cluster: PREDICTED: similar to CG7076-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG7076-PA
           - Apis mellifera
          Length = 117

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
 Frame = +3

Query: 408 HHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           H + +Y AHP Y+F+Y V D H+GD   Q E RDG
Sbjct: 37  HRDHDYVAHPHYEFSYGVEDHHTGDYHGQKEHRDG 71


>UniRef50_UPI0000D5763B Cluster: PREDICTED: similar to CG9299-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9299-PA - Tribolium castaneum
          Length = 185

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPR 625
           DAV+GEY+L+E DG+VR V+Y AD   GF       +PR
Sbjct: 144 DAVNGEYSLLEEDGNVRTVKYFADWKSGFHAQVHNSKPR 182


>UniRef50_Q16IY2 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 178

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           + ++A P Y ++Y V D  SGD KSQHESR G
Sbjct: 44  DSQHAEPNYSYSYVVRDDKSGDRKSQHESRQG 75



 Score = 40.3 bits (90), Expect = 0.054
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRP 622
           D V G+Y ++E+DG+ R V+Y+ADD +GF     +H+P
Sbjct: 76  DQVRGQYRMMESDGTERIVDYSADDRNGFNAV-VRHQP 112


>UniRef50_Q8MRD2 Cluster: RE04513p; n=2; Drosophila
           melanogaster|Rep: RE04513p - Drosophila melanogaster
           (Fruit fly)
          Length = 206

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 1/46 (2%)
 Frame = +3

Query: 375 IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           I PA   L +    EEY  HP+Y + Y V D  SGD+K+Q E+R+G
Sbjct: 35  IIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 80



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+L +ADG  R V+YTAD  +GF
Sbjct: 81  DVVQGQYSLNDADGYRRIVDYTADPINGF 109


>UniRef50_Q17C20 Cluster: Pupal cuticle protein, putative; n=8;
           Culicidae|Rep: Pupal cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 244

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 19/29 (65%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G YTL++ADG  R VEYTAD+H GF
Sbjct: 92  DNVKGVYTLIDADGFRRIVEYTADEHSGF 120



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 26/70 (37%), Positives = 33/70 (47%), Gaps = 8/70 (11%)
 Frame = +3

Query: 324 PVHYASPVHYAAP-VAKVIAPA-----HKVLVSAHHEEEYAHP--KYDFAYSVADGHSGD 479
           P +Y  P ++A P + K + PA        LV      EY     +Y F YSV D  +GD
Sbjct: 22  PHYYQQPQYHAQPALVKTVQPALVKTLQPALVKTVKHVEYPDTPAEYQFQYSVHDEQTGD 81

Query: 480 NKSQHESRDG 509
            KSQ E R G
Sbjct: 82  IKSQQEERHG 91


>UniRef50_Q16X70 Cluster: Adult cuticle protein, putative; n=5;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 129

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +3

Query: 384 AHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +H      H +  ++HPKY+F Y V DG++ D+KS  E RDG
Sbjct: 34  SHSEFEYHHGDYLHSHPKYNFKYGVKDGYTHDHKSAWEHRDG 75



 Score = 40.3 bits (90), Expect = 0.054
 Identities = 18/36 (50%), Positives = 26/36 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQH 616
           D V G+YTL EADG+ R V+Y++D   GFQ + Q++
Sbjct: 76  DVVKGQYTLDEADGTHRVVDYSSDHKSGFQVHVQRN 111


>UniRef50_UPI0000D5727F Cluster: PREDICTED: similar to CG9290-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9290-PA - Tribolium castaneum
          Length = 127

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/38 (50%), Positives = 22/38 (57%)
 Frame = +3

Query: 396 LVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           L   HH E+     Y F Y V D H+GD KSQ+E RDG
Sbjct: 16  LAGHHHLEDNGPAFYKFEYGVHDPHTGDKKSQYEHRDG 53



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 17/27 (62%), Positives = 18/27 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G YTL EADG+ R VEY A  H GF
Sbjct: 56  VKGGYTLKEADGTTRIVEYHAGPHGGF 82


>UniRef50_P27780 Cluster: Pupal cuticle protein Edg-84A precursor;
           n=2; Sophophora|Rep: Pupal cuticle protein Edg-84A
           precursor - Drosophila melanogaster (Fruit fly)
          Length = 188

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 1/37 (2%)
 Frame = +3

Query: 402 SAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           S+  E+ Y +HP+Y F Y V D  +GD KSQ ESRDG
Sbjct: 24  SSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDG 60



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y++ +ADG  R V+YTADD  GF
Sbjct: 61  DVVHGQYSVNDADGYRRTVDYTADDVRGF 89


>UniRef50_Q9VKE2 Cluster: CG16963-PA; n=2; Drosophila
           melanogaster|Rep: CG16963-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 477

 Score = 41.9 bits (94), Expect = 0.018
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +3

Query: 399 VSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTP 575
           ++ +  E+Y   P+Y FAY V D  +GD+K Q E RDG L       ++       +   
Sbjct: 63  LAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122

Query: 576 LTTTTAFNAIVS 611
               + FNAIVS
Sbjct: 123 ADDVSGFNAIVS 134



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHR 619
           D V G+Y+L+E DG+ R VEYTADD  GF     + R
Sbjct: 101 DLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQR 137


>UniRef50_UPI00015B43DE Cluster: PREDICTED: similar to
           ENSANGP00000031410; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000031410 - Nasonia
           vitripennis
          Length = 133

 Score = 41.5 bits (93), Expect = 0.024
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           D V G Y+L+E DG+ R V YTAD  +GF    Q   P  + +  +  AP L
Sbjct: 72  DVVQGSYSLIEPDGTRRTVAYTADPINGFNAV-QHKDPSVSVKTAIAAAPAL 122



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 25/76 (32%), Positives = 35/76 (46%)
 Frame = +3

Query: 300 TNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGD 479
           + +I  AA V  A       P + +I  AH       +E   + P Y F Y V DG +GD
Sbjct: 3   SKFILLAAVVAVARAAFIYTP-SGIIPLAHPSQAIIGNEPLDSQPNYSFNYHVDDGLTGD 61

Query: 480 NKSQHESRDGTLCTAS 527
           NK+  E+R G +   S
Sbjct: 62  NKAHKETRYGDVVQGS 77


>UniRef50_Q9VSH5 Cluster: CG13670-PA; n=2; Sophophora|Rep:
           CG13670-PA - Drosophila melanogaster (Fruit fly)
          Length = 266

 Score = 41.5 bits (93), Expect = 0.024
 Identities = 17/30 (56%), Positives = 24/30 (80%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G Y++V+ DG++R V+YTADD +GFQ
Sbjct: 127 DEVRGVYSVVDPDGTLRVVKYTADDANGFQ 156



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNK 485
           I A A V Y+    YA     V+ P H V V      +Y A P+Y FAY V DG +   +
Sbjct: 63  IGACAAVGYS----YARFEGPVVGPEHLVTVHDGRTVDYVARPEYSFAYGVEDGKTRVLQ 118

Query: 486 SQHESRDG 509
           ++ E+R+G
Sbjct: 119 NRKETRNG 126


>UniRef50_Q8IPE0 Cluster: CG31878-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG31878-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 106

 Score = 41.5 bits (93), Expect = 0.024
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 396 LVSAHHEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           ++++H +E  A P +Y+F YSV D HSGD K Q E R G   T
Sbjct: 27  IIASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT 69


>UniRef50_Q8IPD9 Cluster: CG31878-PA, isoform A; n=1; Drosophila
           melanogaster|Rep: CG31878-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 146

 Score = 41.5 bits (93), Expect = 0.024
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 396 LVSAHHEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           ++++H +E  A P +Y+F YSV D HSGD K Q E R G   T
Sbjct: 67  IIASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT 109


>UniRef50_Q170Z6 Cluster: Pupal cuticle protein, putative; n=2;
           Culicidae|Rep: Pupal cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 248

 Score = 41.5 bits (93), Expect = 0.024
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D +HGEYT+ + DG +R V+YTA+ H GF
Sbjct: 153 DELHGEYTVQQPDGKLRVVKYTANKHSGF 181


>UniRef50_Q7QD80 Cluster: ENSANGP00000018253; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000018253 - Anopheles gambiae
           str. PEST
          Length = 200

 Score = 41.1 bits (92), Expect = 0.031
 Identities = 20/46 (43%), Positives = 28/46 (60%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLML 646
           D V G+Y  +E+DG+ R V+YTADD  GF     +H+P   T+  L
Sbjct: 115 DRVRGQYRTLESDGTERIVDYTADDVRGFNAV-VRHQPSVGTRAQL 159


>UniRef50_Q7PRE1 Cluster: ENSANGP00000015068; n=4;
           Endopterygota|Rep: ENSANGP00000015068 - Anopheles
           gambiae str. PEST
          Length = 132

 Score = 41.1 bits (92), Expect = 0.031
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +3

Query: 375 IAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQ 554
           +APA  V VS +++     P+Y +AY+V D  +GD+KSQ E+RDG +   S   ++    
Sbjct: 30  VAPA--VAVSTNYDPL---PQYTYAYNVQDALTGDSKSQQETRDGDIVRGSYSLVEPDGT 84

Query: 555 CARLSTPLTTTTAFNAIV 608
              +         FNA+V
Sbjct: 85  LRTVFYTADPVNGFNAVV 102



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 18/35 (51%), Positives = 23/35 (65%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQ 613
           D V G Y+LVE DG++R V YTAD  +GF    Q+
Sbjct: 70  DIVRGSYSLVEPDGTLRTVFYTADPVNGFNAVVQR 104


>UniRef50_P26968 Cluster: Adult-specific cuticular protein ACP-22
           precursor; n=2; Tenebrionidae|Rep: Adult-specific
           cuticular protein ACP-22 precursor - Tenebrio molitor
           (Yellow mealworm)
          Length = 199

 Score = 41.1 bits (92), Expect = 0.031
 Identities = 21/40 (52%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 399 VSAHHEEEY---AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           V  HHEE     AHP+Y   Y VAD  + D KS+HE RDG
Sbjct: 120 VDVHHEEAIHLKAHPEYHSDYHVADHKTKDFKSKHEVRDG 159


>UniRef50_Q9VLB1 Cluster: CG3818-PA; n=1; Drosophila
           melanogaster|Rep: CG3818-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 153

 Score = 40.7 bits (91), Expect = 0.041
 Identities = 21/50 (42%), Positives = 29/50 (58%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAP 658
           D V G Y L+++DG  R V+Y ADDH+GF+   Q  R     ++ LP  P
Sbjct: 57  DKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQ--REPTDIKIPLPEPP 104



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESR 503
           E +Y    Y+F +SV D H+GD KSQ ESR
Sbjct: 25  EPDYGPVAYEFQWSVNDPHTGDIKSQKESR 54


>UniRef50_Q4V6L8 Cluster: IP11372p; n=3; Sophophora|Rep: IP11372p -
           Drosophila melanogaster (Fruit fly)
          Length = 424

 Score = 40.7 bits (91), Expect = 0.041
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           Y H  Y F+Y V D H+GD KSQ ESRDG
Sbjct: 51  YEHQGYAFSYGVKDLHTGDVKSQWESRDG 79



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+++E DGS+R V YTAD   GF
Sbjct: 80  DGVKGHYSVLEPDGSIRTVHYTADAKKGF 108


>UniRef50_Q16F22 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 131

 Score = 40.7 bits (91), Expect = 0.041
 Identities = 17/28 (60%), Positives = 23/28 (82%)
 Frame = +2

Query: 512 AVHGEYTLVEADGSVRKVEYTADDHHGF 595
           ++ G+Y+LVE DGSVR V+YTAD  +GF
Sbjct: 23  SIAGQYSLVEPDGSVRTVDYTADPINGF 50


>UniRef50_Q5TWJ2 Cluster: ENSANGP00000026095; n=2; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000026095 - Anopheles gambiae
           str. PEST
          Length = 808

 Score = 40.3 bits (90), Expect = 0.054
 Identities = 35/106 (33%), Positives = 48/106 (45%), Gaps = 4/106 (3%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAP--VAKVIAPAHKV-LVSAHHEEEYA-HPKYDFAYSVADGHSGD 479
           AAAAP   A    Y AP  V K +AP   V  V+  + E Y  + +Y F Y V D  +GD
Sbjct: 688 AAAAP---ALTTAYTAPATVVKTVAPTTVVKTVAEKYLEHYEDNARYAFEYGVNDPLTGD 744

Query: 480 NKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
            K Q E RDG +       ++       +       T F+A V+N+
Sbjct: 745 IKHQKEERDGDVVRGQYSLVEPDGNVRTVDYYADWATGFHATVTNS 790



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+LVE DG+VR V+Y AD   GF
Sbjct: 755 DVVRGQYSLVEPDGNVRTVDYYADWATGF 783


>UniRef50_Q9VDJ8 Cluster: CG5494-PA; n=3; Sophophora|Rep: CG5494-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 381

 Score = 39.9 bits (89), Expect = 0.072
 Identities = 15/26 (57%), Positives = 18/26 (69%)
 Frame = +2

Query: 518 HGEYTLVEADGSVRKVEYTADDHHGF 595
           HG Y+ V+  G V+ V YTAD HHGF
Sbjct: 59  HGSYSYVDGHGHVQSVSYTADPHHGF 84


>UniRef50_Q9V3P9 Cluster: CG3474-PA; n=6; Diptera|Rep: CG3474-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 218

 Score = 39.9 bits (89), Expect = 0.072
 Identities = 18/38 (47%), Positives = 22/38 (57%)
 Frame = +3

Query: 408 HHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           H +   +H +YDF Y V D  +GD KSQ ESR G   T
Sbjct: 62  HDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVT 99



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRY 604
           V G Y L++ADG  R V YTAD H GF+ +
Sbjct: 98  VTGHYELIDADGHKRTVHYTADKHKGFEAH 127


>UniRef50_Q5TWH9 Cluster: ENSANGP00000027540; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000027540 - Anopheles gambiae
           str. PEST
          Length = 247

 Score = 39.9 bits (89), Expect = 0.072
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G+YTL + DG+ R VEY ADD +GF+
Sbjct: 181 DHVKGKYTLDQPDGTKRVVEYAADDRNGFE 210


>UniRef50_Q17C05 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 140

 Score = 39.9 bits (89), Expect = 0.072
 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 408 HHEEEYAHPK-YDFAYSVADGHSGDNKSQHESRDG 509
           HHEEE+  P  Y + Y V D H+GD   Q ESR+G
Sbjct: 73  HHEEEHHAPAHYQYHYGVHDEHTGDVHGQQESREG 107


>UniRef50_Q16R84 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 158

 Score = 39.9 bits (89), Expect = 0.072
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 3/61 (4%)
 Frame = +3

Query: 336 ASP--VHYAAPVAKVIAPAH-KVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           ASP  +H   P  K +   H K LV+    E +A+P+Y+FAY   D  +GD+K Q E R 
Sbjct: 37  ASPNLIHRIIPAQKPMQDDHLKKLVN----EVHAYPEYEFAYGARDPKTGDHKDQWEKRV 92

Query: 507 G 509
           G
Sbjct: 93  G 93



 Score = 37.1 bits (82), Expect = 0.51
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G Y L EADG+ R VEY +DD  GF+
Sbjct: 94  DHVQGIYVLEEADGTKRIVEYESDDKQGFR 123


>UniRef50_UPI00015B6123 Cluster: PREDICTED: similar to GA20083-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           GA20083-PA - Nasonia vitripennis
          Length = 161

 Score = 39.5 bits (88), Expect = 0.095
 Identities = 25/66 (37%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
 Frame = +3

Query: 315 AAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPK-YDFAYSVADGHSGDNKSQ 491
           A A  H  S  H+  PV         V       ++YA P  Y+FAY V D H+GD   Q
Sbjct: 46  AKAEGHAHSFQHFHGPVHGDDKEVMWVDKHGKQHQDYAAPAHYEFAYGVEDHHTGDYHGQ 105

Query: 492 HESRDG 509
            E RDG
Sbjct: 106 KEHRDG 111



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 14/24 (58%), Positives = 19/24 (79%)
 Frame = +2

Query: 512 AVHGEYTLVEADGSVRKVEYTADD 583
           AV GEYT+ E DG++R V+Y AD+
Sbjct: 113 AVAGEYTVKEPDGNIRTVKYHADE 136


>UniRef50_Q45V97 Cluster: RR2 cuticle protein 3; n=1; Myzus
           persicae|Rep: RR2 cuticle protein 3 - Myzus persicae
           (Peach-potato aphid)
          Length = 205

 Score = 39.5 bits (88), Expect = 0.095
 Identities = 28/72 (38%), Positives = 34/72 (47%), Gaps = 8/72 (11%)
 Frame = +3

Query: 318 AAPVHYASPVHYAAPVAKV------IAPAHKVLVS--AHHEEEYAHPKYDFAYSVADGHS 473
           +AP + A P  Y+AP           + A+    S  AH EE YA   Y F YSV D H+
Sbjct: 28  SAPSYEAKPQSYSAPTPSYNKQPSQSSSAYPSYPSQKAHAEESYAPRPYKFEYSVNDEHT 87

Query: 474 GDNKSQHESRDG 509
              KSQ E  DG
Sbjct: 88  YGIKSQKEESDG 99



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 19/27 (70%), Positives = 22/27 (81%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G YTL+EADGS R VEYTAD+ +GF
Sbjct: 102 VKGYYTLLEADGSRRTVEYTADE-NGF 127


>UniRef50_Q16EK6 Cluster: Cuticle protein, putative; n=2;
           Culicidae|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 322

 Score = 39.5 bits (88), Expect = 0.095
 Identities = 16/27 (59%), Positives = 20/27 (74%)
 Frame = +2

Query: 518 HGEYTLVEADGSVRKVEYTADDHHGFQ 598
           HG Y+ V+ DG V+ V+YTAD  HGFQ
Sbjct: 67  HGGYSYVDGDGHVQTVKYTADPIHGFQ 93


>UniRef50_Q5TVQ9 Cluster: ENSANGP00000028691; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000028691 - Anopheles gambiae
           str. PEST
          Length = 251

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 30/74 (40%), Positives = 42/74 (56%), Gaps = 7/74 (9%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHATNYIAAAAPVHYASP-VHYAAPVAKVIA---PAHKVLVS--AHHE 416
           AVS  +I RH+ P     +A A  V YA P VHYAAP+ K  A   PA K +V+  A+ +
Sbjct: 42  AVSYSSITRHETPK----VAVAKQVTYAEPAVHYAAPLTKTYAVHEPALKTVVAQPAYTK 97

Query: 417 EEYA-HPKYDFAYS 455
             YA  P + +A++
Sbjct: 98  TVYAQEPAHVYAHA 111


>UniRef50_Q29KF3 Cluster: GA15548-PA; n=1; Drosophila
           pseudoobscura|Rep: GA15548-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 260

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 29/81 (35%), Positives = 39/81 (48%), Gaps = 8/81 (9%)
 Frame = +3

Query: 291 PHATNYIAA----AAPVHYASPVHYAAPVAKVIA---PAHKVLVSAHHEEEYAHP-KYDF 446
           P  TN  AA    +A VH ++ +  AA  A   A   P+   ++  H E E   P  Y F
Sbjct: 68  PPRTNQFAAGGSSSASVHASNLLQSAANAASASAALLPSPLPVLRQHQEPEVFPPASYSF 127

Query: 447 AYSVADGHSGDNKSQHESRDG 509
            Y+V D  +GD K   E+RDG
Sbjct: 128 NYAVNDESTGDIKEHSETRDG 148



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G Y+L++ DG  R V YTADD HGF
Sbjct: 151 VRGFYSLIDPDGYKRTVTYTADDVHGF 177


>UniRef50_A0NG23 Cluster: ENSANGP00000030675; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030675 - Anopheles gambiae
           str. PEST
          Length = 357

 Score = 38.3 bits (85), Expect = 0.22
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF---QRYRQQHRPR 625
           V G+Y+ V+ADG  + V Y ADD  GF   QR    HRPR
Sbjct: 114 VRGQYSWVDADGIRQIVNYRADDRTGFNAEQRREPAHRPR 153



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESR 503
           H++      YDF+YSV D  +GD KSQ ESR
Sbjct: 79  HDQSDEQVGYDFSYSVHDPVTGDQKSQEESR 109


>UniRef50_Q7JZJ3 Cluster: RE26879p; n=5; Endopterygota|Rep: RE26879p
           - Drosophila melanogaster (Fruit fly)
          Length = 217

 Score = 37.9 bits (84), Expect = 0.29
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTL 515
           EE+Y   KY+F Y V D  SG++    ESRDG L
Sbjct: 120 EEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDL 153


>UniRef50_Q4PFM1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 474

 Score = 37.9 bits (84), Expect = 0.29
 Identities = 27/102 (26%), Positives = 47/102 (46%)
 Frame = +3

Query: 282 HDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVA 461
           HDQ  A+  +A+ +    A+P+  A   AK  + +   ++  + +  +     D + S +
Sbjct: 144 HDQEKASPSLASISEESAATPLSKAENGAKTSSASD--MLDGYSDSSFDSDSDDSSSSNS 201

Query: 462 DGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTT 587
           DG S  + S  E  DG++ T   L LK + Q  +   P  TT
Sbjct: 202 DGSSSASSSDDEQEDGSVATLDEL-LKASQQAYKSRAPAPTT 242


>UniRef50_Q9VQH5 Cluster: CG2973-PA; n=1; Drosophila
           melanogaster|Rep: CG2973-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 302

 Score = 37.5 bits (83), Expect = 0.38
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G Y+L++ DG  R V YTADD HGF
Sbjct: 183 VRGFYSLIDPDGYKRTVTYTADDVHGF 209


>UniRef50_Q16X39 Cluster: Adult cuticle protein, putative; n=2;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 189

 Score = 37.1 bits (82), Expect = 0.51
 Identities = 17/26 (65%), Positives = 18/26 (69%)
 Frame = +2

Query: 521 GEYTLVEADGSVRKVEYTADDHHGFQ 598
           G YTL E DG+ R VEY AD  HGFQ
Sbjct: 56  GGYTLDEPDGTKRYVEYKADKWHGFQ 81



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = +3

Query: 435 KYDFAYSVADGHSGDNKSQHESRDG 509
           KY F Y V D H+GD+KSQ E  DG
Sbjct: 27  KYKFEYGVKDPHTGDHKSQWEISDG 51


>UniRef50_A0NBM7 Cluster: ENSANGP00000029830; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029830 - Anopheles gambiae
           str. PEST
          Length = 168

 Score = 37.1 bits (82), Expect = 0.51
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           EE+ + P Y+F Y V D  SGD+K Q E R G
Sbjct: 67  EEKSSGPSYEFGYGVKDPISGDHKDQWEKRQG 98


>UniRef50_P82121 Cluster: Cuticle protein 8; n=1; Blaberus
           craniifer|Rep: Cuticle protein 8 - Blaberus craniifer
           (Death's head cockroach)
          Length = 195

 Score = 37.1 bits (82), Expect = 0.51
 Identities = 14/27 (51%), Positives = 22/27 (81%)
 Frame = +3

Query: 429 HPKYDFAYSVADGHSGDNKSQHESRDG 509
           +P+Y F+Y+V D  +GD+KSQ E+R+G
Sbjct: 48  NPQYTFSYNVDDPETGDSKSQEETRNG 74



 Score = 36.7 bits (81), Expect = 0.67
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+++E+DGS R VEY+AD   GF
Sbjct: 75  DNVQGRYSVIESDGSRRVVEYSADAVSGF 103


>UniRef50_UPI0000D55A42 Cluster: PREDICTED: similar to CG32029-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG32029-PA - Tribolium castaneum
          Length = 323

 Score = 36.7 bits (81), Expect = 0.67
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 14/94 (14%)
 Frame = +3

Query: 288 QPHATNYIAAAAPVHYA-SPVHYAAPVAKVIAP------AHKVLVSAH------HEEEY- 425
           QPH    +   AP+ Y  +PV YAAP A    P       H+     H      + EEY 
Sbjct: 152 QPHYLRVVPQPAPIKYQPAPVKYAAPAAPGYRPYVQPQQQHQQQQQQHQGGEQQNPEEYD 211

Query: 426 AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
            +P Y F + V D    + +++ E R+G   T S
Sbjct: 212 PNPSYQFGFDVNDDLYTNYQNRKEQREGGKITGS 245


>UniRef50_Q6D696 Cluster: Ribonuclease E; n=18;
            Gammaproteobacteria|Rep: Ribonuclease E - Erwinia
            carotovora subsp. atroseptica (Pectobacterium
            atrosepticum)
          Length = 1094

 Score = 36.7 bits (81), Expect = 0.67
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255  AVSSQTILRHDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHP 434
            A+S+Q+++       T         HY   +H  AP+ K  APA+    + H   ++  P
Sbjct: 1008 AISAQSVVEEPASGVTKAATVVEQPHYK--LHATAPMTKAPAPAYNAEPARH--SDWVRP 1063

Query: 435  KYDFA-YSVADGHSGDNKS 488
             Y F+    A GHS  N+S
Sbjct: 1064 DYPFSGKGSAGGHSAVNQS 1082


>UniRef50_Q9VSN3 Cluster: CG32029-PA; n=4; Diptera|Rep: CG32029-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 270

 Score = 36.3 bits (80), Expect = 0.89
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVLL 667
           + G Y++V++DG +R V+YTAD   GF+    +       ++  P  P  L
Sbjct: 184 IKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPTQL 234


>UniRef50_Q5TWH8 Cluster: ENSANGP00000029291; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029291 - Anopheles gambiae
           str. PEST
          Length = 141

 Score = 36.3 bits (80), Expect = 0.89
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G Y L E DG+ R VEY AD  HGF+
Sbjct: 82  DRVQGVYMLEEPDGTQRIVEYEADGVHGFR 111



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = +3

Query: 432 PKYDFAYSVADGHSGDNKSQHESRDG 509
           P+Y+FAY V D  +GD+K + E RDG
Sbjct: 56  PRYEFAYGVKDPITGDHKDRWEKRDG 81


>UniRef50_A3FK18 Cluster: CPF family cuticle protein; n=2; Anopheles
           gambiae|Rep: CPF family cuticle protein - Anopheles
           gambiae (African malaria mosquito)
          Length = 178

 Score = 36.3 bits (80), Expect = 0.89
 Identities = 27/65 (41%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHP---KYDFAYSVA 461
           P A +Y A A  VHY +  HYAAP   V   AH  +V A +   YA P   K   A  VA
Sbjct: 104 PAAAHYAAPA--VHYPAAAHYAAPA--VHYAAHAPIVKAAYPAAYAAPLAYKTPLAAPVA 159

Query: 462 DGHSG 476
             H G
Sbjct: 160 AVHGG 164


>UniRef50_A0NG12 Cluster: ENSANGP00000029772; n=13; Culicidae|Rep:
           ENSANGP00000029772 - Anopheles gambiae str. PEST
          Length = 161

 Score = 36.3 bits (80), Expect = 0.89
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = +3

Query: 408 HHEEEYAHP-KYDFAYSVADGHSGDNKSQHESR 503
           HHEEE+  P  Y++ Y V D H+GD   Q E+R
Sbjct: 62  HHEEEHHGPVHYEYNYDVHDDHTGDVHGQKEAR 94


>UniRef50_UPI0000D55C02 Cluster: PREDICTED: similar to CG1919-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 116

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 4/38 (10%)
 Frame = +3

Query: 408 HHEEEY----AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           HH EEY    A P+Y + Y+V D H+ D   Q E RDG
Sbjct: 28  HHLEEYIDYRARPRYHYDYNVHDHHTHDFHHQWEHRDG 65


>UniRef50_Q29NE6 Cluster: GA16544-PA; n=1; Drosophila
           pseudoobscura|Rep: GA16544-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 89

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +3

Query: 384 AHKVLVSAHHEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           A   ++++H +E  + P +Y+F Y+V D  +GD K Q E R G   T
Sbjct: 3   ARAAIIASHPDELISSPPQYEFHYAVHDSETGDVKDQFEHRRGEYVT 49


>UniRef50_Q29D07 Cluster: GA16621-PA; n=1; Drosophila
           pseudoobscura|Rep: GA16621-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 216

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 13/28 (46%), Positives = 21/28 (75%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           + G Y++V++DG +R V+YTAD   GF+
Sbjct: 153 IKGSYSVVDSDGFIRTVKYTADPKEGFK 180


>UniRef50_Q175B1 Cluster: Adult cuticle protein, putative; n=2;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 181

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           V G Y + E+DG++R VEY ADD  GF+
Sbjct: 119 VKGVYKVAESDGTLRIVEYEADDKKGFE 146


>UniRef50_UPI00015B62AA Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 152

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = +3

Query: 258 VSSQTILRHDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHH 413
           ++ +  L  +   +T+Y+ AAAP+ YA+P   AAP+A   APA+   ++  H
Sbjct: 56  INEKLTLNKEALRSTDYLVAAAPLAYAAP---AAPLAYASAPAYAASLAYAH 104


>UniRef50_UPI0000D555C5 Cluster: PREDICTED: similar to CG2342-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2342-PA - Tribolium castaneum
          Length = 232

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/29 (48%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+L+++DG+ R V+Y AD  +GF
Sbjct: 46  DIVQGQYSLLDSDGTRRVVDYAADGINGF 74



 Score = 34.7 bits (76), Expect = 2.7
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = +3

Query: 429 HPKYDFAYSVADGHSGDNKSQHESRDGTL 515
           +P+Y F Y V+D  +GD KSQ ESR G +
Sbjct: 19  NPQYTFGYGVSDPLTGDVKSQVESRSGDI 47


>UniRef50_Q20BM2 Cluster: Class III homeodomain-leucine zipper
           protein C3HDZ1; n=3; Streptophytina|Rep: Class III
           homeodomain-leucine zipper protein C3HDZ1 - Chara
           corallina (Stonewort) (Green alga)
          Length = 910

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +3

Query: 246 VCW-AVSSQTILRHDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPA 386
           VCW +V + T     +PH+ N +A  A V+  S V+Y   VA  +APA
Sbjct: 702 VCWRSVLTMTFQFSYKPHSENDMATVARVYVRSVVNYVQRVAMALAPA 749


>UniRef50_UPI0000D57280 Cluster: PREDICTED: similar to CG9290-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9290-PA - Tribolium castaneum
          Length = 422

 Score = 35.1 bits (77), Expect = 2.0
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           V G Y+L+E DG+ R VEY A DH GF+
Sbjct: 67  VRGAYSLLEPDGTTRVVEYVA-DHDGFR 93



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 13/30 (43%), Positives = 21/30 (70%)
 Frame = +3

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           + Y    Y F+Y+V+D H+GD+KSQ E ++
Sbjct: 34  DNYKPRDYHFSYAVSDPHTGDHKSQWEVKE 63


>UniRef50_Q7PP06 Cluster: ENSANGP00000017752; n=4;
           Endopterygota|Rep: ENSANGP00000017752 - Anopheles
           gambiae str. PEST
          Length = 138

 Score = 35.1 bits (77), Expect = 2.0
 Identities = 13/22 (59%), Positives = 18/22 (81%)
 Frame = +3

Query: 318 AAPVHYASPVHYAAPVAKVIAP 383
           AAPV YA+P ++AAP+ K +AP
Sbjct: 54  AAPVAYAAPAYHAAPIVKAVAP 75


>UniRef50_UPI0000D571CB Cluster: PREDICTED: similar to CG5494-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG5494-PA - Tribolium castaneum
          Length = 321

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 518 HGEYTLVEADGSVRKVEYTADDHHGFQ 598
           HG Y+ ++++G ++ V+YTAD  HGF+
Sbjct: 72  HGGYSYIDSNGILQTVQYTADPIHGFR 98


>UniRef50_Q17MU1 Cluster: Cuticle protein, putative; n=4; Aedes
           aegypti|Rep: Cuticle protein, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 260

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 29/73 (39%), Positives = 32/73 (43%), Gaps = 4/73 (5%)
 Frame = +3

Query: 255 AVSSQTILRHDQPHATNYIAAAAPVHYASP-VHYAAPVAKVIA---PAHKVLVSAHHEEE 422
           AVS  +I R   P        A  V YA P VHYAAPVAK +A   PA            
Sbjct: 35  AVSYSSITREHYP-----AKVAKTVTYAEPAVHYAAPVAKTVAYAEPAVHYAAPVTKTLT 89

Query: 423 YAHPKYDFAYSVA 461
           YA P   +A  VA
Sbjct: 90  YAQPAVHYAAPVA 102


>UniRef50_Q9A743 Cluster: Acetyl-CoA carboxylase, biotin carboxyl
           carrier protein; n=16; Proteobacteria|Rep: Acetyl-CoA
           carboxylase, biotin carboxyl carrier protein -
           Caulobacter crescentus (Caulobacter vibrioides)
          Length = 170

 Score = 33.9 bits (74), Expect = 4.7
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +3

Query: 303 NYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAY 452
           NY+ AAAP +  +P   +APVA   APA +   +A   +    P    AY
Sbjct: 57  NYVQAAAPAYAPAPAAASAPVAAAPAPAVEAAPAAVRGDAVKSPMVGTAY 106


>UniRef50_Q9NDT7 Cluster: BCS-1; n=2; Balanus amphitrite|Rep: BCS-1
           - Balanus amphitrite (Barnacle)
          Length = 156

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 438 YDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
           Y+F Y+V D  SG+N  Q E+RDG   + S
Sbjct: 72  YNFEYAVQDDESGNNFGQQETRDGDATSGS 101


>UniRef50_Q8SXK7 Cluster: RE11615p; n=2; Sophophora|Rep: RE11615p -
           Drosophila melanogaster (Fruit fly)
          Length = 304

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 27  SLERCAGSECSRSPTGAAIFFSCG-CLFSEHRPSRPATAPC 146
           +LERC G+ C RSP G   + SCG C          A +PC
Sbjct: 6   ALERCPGAYCGRSPLGNNSWSSCGVCPRGSRVNQSYACSPC 46


>UniRef50_Q7Q0W7 Cluster: ENSANGP00000019229; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000019229 - Anopheles gambiae
           str. PEST
          Length = 180

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+L +ADG  R V+YT+D   GF
Sbjct: 60  DKVTGQYSLNDADGYRRVVDYTSDKDTGF 88


>UniRef50_A1CX01 Cluster: GPI anchored protein, putative; n=2;
           Trichocomaceae|Rep: GPI anchored protein, putative -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 994

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 16/45 (35%), Positives = 20/45 (44%)
 Frame = +3

Query: 282 HDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHE 416
           H QPH     A + P H   P H A  V   ++P H+V     HE
Sbjct: 745 HSQPHVPQPKAPSDPNHGFEPTHPAEAVPTGVSPTHEVEAPKGHE 789


>UniRef50_UPI00015B5644 Cluster: PREDICTED: hypothetical protein;
           n=3; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 203

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVA 461
           +A A  + Y++P  YAAP     APA     +  +   YA P Y   Y+ +
Sbjct: 14  VANAGAIGYSAPAAYAAPAIGYAAPAVASYAAPAYATSYAAPAYTSNYAAS 64


>UniRef50_UPI0000DB7324 Cluster: PREDICTED: similar to CG6305-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG6305-PA -
           Apis mellifera
          Length = 194

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 15/29 (51%), Positives = 18/29 (62%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY +   DG ++ V YTAD  HGF
Sbjct: 149 DIVRGEYRVQLPDGRLQIVRYTADWKHGF 177


>UniRef50_Q9GUY5 Cluster: DD5 protein; n=1; Marsupenaeus
           japonicus|Rep: DD5 protein - Penaeus japonicus (Kuruma
           prawn)
          Length = 1312

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAP 658
           V GE+   +A G+  K+EYTA DH GFQ     H PR    +    AP
Sbjct: 64  VVGEFGFRDASGTDYKLEYTA-DHRGFQP-TGDHLPRAVPSVHTKAAP 109


>UniRef50_Q16JC2 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 122

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +EE+   +Y F Y V D  +GD+K+Q E R+G
Sbjct: 26  KEEHHPAQYKFEYGVKDELTGDHKTQWEQREG 57



 Score = 33.1 bits (72), Expect = 8.3
 Identities = 14/26 (53%), Positives = 18/26 (69%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHG 592
           V G+YTL ++DG  R VEY +D H G
Sbjct: 60  VKGQYTLEDSDGGHRLVEYESDAHGG 85


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 520,693,913
Number of Sequences: 1657284
Number of extensions: 7633101
Number of successful extensions: 24489
Number of sequences better than 10.0: 135
Number of HSP's better than 10.0 without gapping: 23210
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24383
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 67908372675
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).