SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30006
         (796 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5A509 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_O77362 Cluster: Putative uncharacterized protein MAL3P4...    35   2.7  
UniRef50_A0C8G4 Cluster: Chromosome undetermined scaffold_158, w...    34   4.7  
UniRef50_A6DC54 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_Q1V1X8 Cluster: Putative uncharacterized protein; n=2; ...    33   8.3  

>UniRef50_Q5A509 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 157

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +2

Query: 488 FCNDKLLCISS*TNSFLFI---IQSL*CVFFFVHEFCLFVYFYFEISW*YY*SLKMICFL 658
           FCN  + C S+    F+FI    + L C++F    F +++Y YF I +  Y  +  I F+
Sbjct: 18  FCNHYVHCSSTNREIFIFIRMLTKLLGCIYFV---FYMYIYSYFHILYISYPIINKILFV 74

Query: 659 LLMCC 673
            L  C
Sbjct: 75  YLFVC 79


>UniRef50_O77362 Cluster: Putative uncharacterized protein
           MAL3P4.27; n=2; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein MAL3P4.27 - Plasmodium
           falciparum (isolate 3D7)
          Length = 1146

 Score = 34.7 bits (76), Expect = 2.7
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = -3

Query: 686 YYWNDNTLKVRNKSS*EINNITMKFQSKNKRISKTREQKKIHTIMTV**IKTNLFN*KCT 507
           +Y N   L++    S  INNI + + +KNK + K  + K I+TI +   +   + +  CT
Sbjct: 605 FYNNITNLQIARPLS--INNIPISYMNKNKALKKAYKDKYIYTINSYTELDDLICSQPCT 662

Query: 506 V-VYHYKNLRLN 474
           V +Y Y  L  N
Sbjct: 663 VIIYQYDMLIKN 674


>UniRef50_A0C8G4 Cluster: Chromosome undetermined scaffold_158, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_158, whole genome
            shotgun sequence - Paramecium tetraurelia
          Length = 2894

 Score = 33.9 bits (74), Expect = 4.7
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -3

Query: 752  FWPLRGFTKYSRFKDK-PALGQQYYWNDNTLKVRNKSS*EINNITMKFQSKNKRISKTRE 576
            FW    FT+YS ++ K   +   + WNDN L +    +  I NI+ K   K   + K ++
Sbjct: 2472 FWKFSDFTQYSNYQSKFTKINDFFVWNDN-LYISIDQTIRIWNISQKSTIK---VIKEKK 2527

Query: 575  QKKIHTI 555
            +  IH+I
Sbjct: 2528 KDHIHSI 2534


>UniRef50_A6DC54 Cluster: Putative uncharacterized protein; n=1;
           Caminibacter mediatlanticus TB-2|Rep: Putative
           uncharacterized protein - Caminibacter mediatlanticus
           TB-2
          Length = 241

 Score = 33.5 bits (73), Expect = 6.2
 Identities = 16/50 (32%), Positives = 31/50 (62%)
 Frame = +3

Query: 486 IFVMINYCAFLVKQIRFYLLYSHYSVYFFLFTSFAYSFIFTLKFHGDIIN 635
           +F+++N   +L  ++ F++  S + V FF+F+SF   F+F LK   + +N
Sbjct: 22  LFLILNNIFYLNDELSFFISSSIF-VLFFIFSSFLSFFVFKLKIKIEELN 70


>UniRef50_Q1V1X8 Cluster: Putative uncharacterized protein; n=2;
           Candidatus Pelagibacter ubique|Rep: Putative
           uncharacterized protein - Candidatus Pelagibacter ubique
           HTCC1002
          Length = 333

 Score = 33.1 bits (72), Expect = 8.3
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = +2

Query: 569 FFVHEFCLFVYFYFEISW*YY*SLKMICFLLLMCCHSNSTVARG 700
           FF+  FCLF  FYF IS+ +   LK+I +      H N T A G
Sbjct: 5   FFIFNFCLFFIFYFIISF-FAKELKLIDYPNSEKTHKNPTPAIG 47


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 654,209,845
Number of Sequences: 1657284
Number of extensions: 12286013
Number of successful extensions: 27702
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 26301
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27531
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 67908372675
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).