SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30005
         (981 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9TWZ1 Cluster: Protein disulphide isomerase isoform/mu...    42   0.032
UniRef50_A6NGG8 Cluster: Uncharacterized protein ENSP00000332809...    37   0.69 
UniRef50_P30101 Cluster: Protein disulfide-isomerase A3 precurso...    37   0.91 
UniRef50_A4QUK0 Cluster: Putative uncharacterized protein; n=1; ...    34   4.8  

>UniRef50_Q9TWZ1 Cluster: Protein disulphide isomerase
           isoform/multifunctional endoplasmic reticulum luminal
           polypeptide; n=8; Endopterygota|Rep: Protein disulphide
           isomerase isoform/multifunctional endoplasmic reticulum
           luminal polypeptide - Drosophila melanogaster (Fruit
           fly)
          Length = 489

 Score = 41.5 bits (93), Expect = 0.032
 Identities = 27/76 (35%), Positives = 37/76 (48%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADGKQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP* 228
           LNE+G DF  GDKPVV  RD    +   +   S   +    ++  +  +LEP++K   P 
Sbjct: 302 LNEYGYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLA-NELEPYIKSE-PI 358

Query: 229 PGKRTGPVK*PFGKNF 276
           P     PVK    KNF
Sbjct: 359 PESNDAPVKVAVAKNF 374


>UniRef50_A6NGG8 Cluster: Uncharacterized protein ENSP00000332809;
            n=8; Eutheria|Rep: Uncharacterized protein
            ENSP00000332809 - Homo sapiens (Human)
          Length = 1288

 Score = 37.1 bits (82), Expect = 0.69
 Identities = 23/92 (25%), Positives = 40/92 (43%)
 Frame = +2

Query: 98   PAATQTANKFVMRRGVQHRKSTNVHKGPARWASWSHS*NSEGHNRENERAQ*SSRSARTF 277
            P AT  + +       Q  K+T++++ P +  +W HS    G NR +E +    R +R  
Sbjct: 927  PPATSQSPEVKGGTWSQAEKATSLYRQPRKAIAWHHSGPPSGQNRTSESSLARPRQSRER 986

Query: 278  KETGSRTATGTQLHRISMAAMVAEQLSEAWLP 373
                 R A+ T+ H +  A      L  ++ P
Sbjct: 987  SPPVGRKASPTRTHWVPQADKRRRSLPSSYRP 1018


>UniRef50_P30101 Cluster: Protein disulfide-isomerase A3 precursor;
           n=53; Eumetazoa|Rep: Protein disulfide-isomerase A3
           precursor - Homo sapiens (Human)
          Length = 505

 Score = 36.7 bits (81), Expect = 0.91
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>UniRef50_A4QUK0 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1525

 Score = 34.3 bits (75), Expect = 4.8
 Identities = 18/59 (30%), Positives = 32/59 (54%)
 Frame = +2

Query: 218  EGHNRENERAQ*SSRSARTFKETGSRTATGTQLHRISMAAMVAEQLSEAWLPFWEELGE 394
            +G+NR+ ERA  ++   R  KE  +  A   Q  + S A   AE+ + AW  ++ ++G+
Sbjct: 1280 QGYNRDKERAAQAAEQERLRKEAEAAAAV-QQQQQSSSATPSAEEHAAAWARYYAQIGQ 1337


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 932,006,037
Number of Sequences: 1657284
Number of extensions: 18949621
Number of successful extensions: 46550
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 44878
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46535
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 91856548575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).