SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4QQE8 Cluster: Endonuclease-reverse transcriptase; n=4...   146   5e-34
UniRef50_UPI0000E490F6 Cluster: PREDICTED: similar to endonuclea...   105   2e-21
UniRef50_Q8T5G5 Cluster: Polyprotein; n=35; Schistosoma japonicu...    95   1e-18
UniRef50_UPI0000E48520 Cluster: PREDICTED: similar to endonuclea...    93   6e-18
UniRef50_UPI0000E4A93D Cluster: PREDICTED: similar to endonuclea...    89   1e-16
UniRef50_UPI0000E4958A Cluster: PREDICTED: similar to endonuclea...    83   8e-15
UniRef50_A4KWG0 Cluster: Reverse transcriptase; n=3; Ostrinia nu...    81   3e-14
UniRef50_UPI0000E496F7 Cluster: PREDICTED: similar to endonuclea...    77   7e-13
UniRef50_UPI0000E495D7 Cluster: PREDICTED: similar to endonuclea...    76   1e-12
UniRef50_O97916 Cluster: Reverse transcriptase-like; n=70; Bos t...    76   1e-12
UniRef50_UPI00015B45BA Cluster: PREDICTED: similar to ENSANGP000...    73   7e-12
UniRef50_UPI0000F30BC1 Cluster: Eomesodermin; n=22; Bos taurus|R...    71   5e-11
UniRef50_UPI0000E4635A Cluster: PREDICTED: similar to reverse tr...    70   8e-11
UniRef50_UPI0000F32779 Cluster: UPI0000F32779 related cluster; n...    70   8e-11
UniRef50_UPI0000E48997 Cluster: PREDICTED: similar to reverse tr...    66   8e-10
UniRef50_UPI0000F1FDAD Cluster: PREDICTED: similar to reverse tr...    65   2e-09
UniRef50_UPI0000E4A747 Cluster: PREDICTED: similar to endonuclea...    65   2e-09
UniRef50_UPI0000E4800E Cluster: PREDICTED: similar to protein F2...    63   7e-09
UniRef50_O16589 Cluster: Putative uncharacterized protein F21E9....    61   3e-08
UniRef50_Q10126 Cluster: Uncharacterized protein F52C9.6; n=7; C...    57   5e-07
UniRef50_UPI0000E4A090 Cluster: PREDICTED: similar to reverse tr...    55   3e-06
UniRef50_UPI0000E48AC5 Cluster: PREDICTED: similar to novel EGF ...    55   3e-06
UniRef50_Q76IN8 Cluster: Reverse transcriptase; n=1; Ciona intes...    53   8e-06
UniRef50_UPI00015B42A6 Cluster: PREDICTED: similar to polyprotei...    52   1e-05
UniRef50_Q6L4B3 Cluster: Polyprotein, putative; n=6; core eudico...    52   2e-05
UniRef50_Q572J7 Cluster: Reverse transcriptase precursor, putati...    52   2e-05
UniRef50_O44323 Cluster: Reverse transcriptase; n=1; Forficula a...    51   3e-05
UniRef50_A7S2E3 Cluster: Predicted protein; n=9; Nematostella ve...    50   7e-05
UniRef50_Q1HW07 Cluster: Reverse transcriptase; n=1; Penaeus mon...    50   1e-04
UniRef50_Q572K4 Cluster: Reverse transcriptase, putative; n=2; P...    49   2e-04
UniRef50_Q1AKH8 Cluster: Reverse transcriptase family member; n=...    49   2e-04
UniRef50_Q5BQT0 Cluster: SJCHGC09821 protein; n=1; Schistosoma j...    46   9e-04
UniRef50_Q5BQS2 Cluster: SJCHGC09829 protein; n=1; Schistosoma j...    46   9e-04
UniRef50_Q4F8Q3 Cluster: Reverse transcriptase; n=1; Aedes aegyp...    46   9e-04
UniRef50_Q95SX7 Cluster: Probable RNA-directed DNA polymerase fr...    46   0.001
UniRef50_UPI0000E46D01 Cluster: PREDICTED: similar to sodium dep...    46   0.002
UniRef50_Q01HH7 Cluster: OSIGBa0142I02-OSIGBa0101B20.12 protein;...    46   0.002
UniRef50_Q6C7P5 Cluster: Ylli protein; n=24; Yarrowia lipolytica...    46   0.002
UniRef50_Q4P0U8 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-...    45   0.003
UniRef50_UPI00015B5DC1 Cluster: PREDICTED: similar to CG11502-PA...    44   0.004
UniRef50_UPI0000F1D59F Cluster: PREDICTED: similar to pol-like p...    44   0.004
UniRef50_Q76IL9 Cluster: Pol-like protein; n=1; Danio rerio|Rep:...    44   0.004
UniRef50_Q7XUD8 Cluster: OSJNBa0088A01.7 protein; n=2; Oryza sat...    44   0.005
UniRef50_Q0E285 Cluster: Os02g0261600 protein; n=2; Oryza sativa...    44   0.005
UniRef50_Q03278 Cluster: Retrovirus-related Pol polyprotein from...    44   0.005
UniRef50_UPI0000E47DA3 Cluster: PREDICTED: similar to ENSANGP000...    44   0.006
UniRef50_Q5K671 Cluster: Reverse transcriptase; n=2; Bombyx mori...    44   0.006
UniRef50_UPI0000E493DE Cluster: PREDICTED: similar to endonuclea...    43   0.008
UniRef50_Q2R8K4 Cluster: Retrotransposon protein, putative, LINE...    43   0.008
UniRef50_UPI0000E4A923 Cluster: PREDICTED: similar to angiotensi...    43   0.011
UniRef50_UPI0000F33B2A Cluster: UPI0000F33B2A related cluster; n...    43   0.011
UniRef50_Q8W2Y2 Cluster: Putative reverse transcriptase; n=1; Or...    43   0.011
UniRef50_UPI0000D578AF Cluster: PREDICTED: similar to RNA-direct...    42   0.014
UniRef50_Q76IK9 Cluster: Pol-like protein; n=8; Clupeocephala|Re...    42   0.019
UniRef50_Q64IZ3 Cluster: Reverse transcriptase; n=6; Cyprinodont...    41   0.033
UniRef50_Q76IP0 Cluster: Reverse transcriptase; n=1; Ciona intes...    41   0.033
UniRef50_Q5BT30 Cluster: SJCHGC02932 protein; n=1; Schistosoma j...    41   0.033
UniRef50_Q4QQE6 Cluster: Endonuclease-reverse transcriptase; n=2...    41   0.033
UniRef50_A0NG79 Cluster: ENSANGP00000027469; n=2; Anopheles gamb...    41   0.033
UniRef50_UPI00015B43B0 Cluster: PREDICTED: similar to reverse tr...    41   0.044
UniRef50_UPI0000E46857 Cluster: PREDICTED: similar to bcnt, part...    41   0.044
UniRef50_Q76IN6 Cluster: Reverse transcriptase; n=5; Rasborinae|...    41   0.044
UniRef50_Q60UL0 Cluster: Putative uncharacterized protein CBG199...    41   0.044
UniRef50_P16423 Cluster: Retrovirus-related Pol polyprotein from...    41   0.044
UniRef50_UPI0000E47148 Cluster: PREDICTED: similar to endonuclea...    40   0.058
UniRef50_UPI0000D57951 Cluster: PREDICTED: similar to RNA-direct...    40   0.058
UniRef50_UPI0000D578A9 Cluster: PREDICTED: similar to RNA-direct...    40   0.058
UniRef50_Q4QQD8 Cluster: Polyprotein; n=1; Schistosoma mansoni|R...    40   0.058
UniRef50_Q2WBW5 Cluster: Putative origin recognition complex sub...    40   0.058
UniRef50_UPI0000E46BAD Cluster: PREDICTED: similar to ReO_6; n=3...    40   0.077
UniRef50_UPI0000F32C97 Cluster: UPI0000F32C97 related cluster; n...    40   0.077
UniRef50_Q0IR74 Cluster: Os11g0670100 protein; n=1; Oryza sativa...    40   0.077
UniRef50_Q2HED9 Cluster: Putative uncharacterized protein; n=1; ...    40   0.077
UniRef50_Q2H1R0 Cluster: Putative uncharacterized protein; n=5; ...    40   0.077
UniRef50_Q76IM1 Cluster: Pol-like protein; n=2; Clupeocephala|Re...    40   0.10 
UniRef50_Q2QYF0 Cluster: Retrotransposon protein, putative, uncl...    40   0.10 
UniRef50_Q01379 Cluster: Contains reverse transcriptase and cys ...    40   0.10 
UniRef50_A2X084 Cluster: Putative uncharacterized protein; n=1; ...    39   0.13 
UniRef50_UPI0000F31248 Cluster: UPI0000F31248 related cluster; n...    39   0.18 
UniRef50_Q76IM5 Cluster: Pol-like protein; n=1; Tetraodon nigrov...    39   0.18 
UniRef50_O64463 Cluster: Gene, , similar to reverse transcriptas...    39   0.18 
UniRef50_A5B1W4 Cluster: Putative uncharacterized protein; n=1; ...    39   0.18 
UniRef50_A4PSD6 Cluster: RNA-directed DNA polymerase (Reverse tr...    39   0.18 
UniRef50_Q8I7P8 Cluster: ORF1; n=2; Drosophila melanogaster|Rep:...    39   0.18 
UniRef50_Q76IP1 Cluster: Reverse transcriptase; n=1; Ciona intes...    39   0.18 
UniRef50_Q76IN9 Cluster: Reverse transcriptase; n=1; Ciona intes...    39   0.18 
UniRef50_Q76IK6 Cluster: Pol-like protein; n=1; Ciona intestinal...    39   0.18 
UniRef50_O46180 Cluster: Non-LTR retrotransposon reverse transcr...    39   0.18 
UniRef50_O15639 Cluster: Multifunctional protein; n=55; Dictyost...    39   0.18 
UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-...    38   0.23 
UniRef50_Q2GUS1 Cluster: Putative uncharacterized protein; n=10;...    38   0.23 
UniRef50_UPI0000E4A8F6 Cluster: PREDICTED: similar to endonuclea...    38   0.31 
UniRef50_Q76IL7 Cluster: Pol-like protein; n=3; Danio rerio|Rep:...    38   0.31 
UniRef50_Q4SVV7 Cluster: Chromosome undetermined SCAF13717, whol...    38   0.31 
UniRef50_Q2QLN0 Cluster: Retrotransposon protein, putative, LINE...    38   0.31 
UniRef50_P11369 Cluster: Retrovirus-related Pol polyprotein LINE...    38   0.31 
UniRef50_Q64IV5 Cluster: Reverse transcriptase; n=2; Kryptolebia...    38   0.41 
UniRef50_Q0DC48 Cluster: Os06g0484800 protein; n=6; Oryza sativa...    38   0.41 
UniRef50_Q01N39 Cluster: H0215A08.3 protein; n=9; Oryza sativa|R...    38   0.41 
UniRef50_UPI0000D576CB Cluster: PREDICTED: similar to RNA-direct...    37   0.54 
UniRef50_Q8LJX1 Cluster: Putative reverse transcriptase; n=1; So...    37   0.54 
UniRef50_Q7XWB0 Cluster: OSJNBa0061A09.16 protein; n=3; Oryza sa...    37   0.54 
UniRef50_UPI0000E4A5CE Cluster: PREDICTED: similar to Gamma-glut...    37   0.72 
UniRef50_UPI0000E483B1 Cluster: PREDICTED: similar to endonuclea...    37   0.72 
UniRef50_UPI00005A16F9 Cluster: PREDICTED: similar to reverse tr...    37   0.72 
UniRef50_Q6QI57 Cluster: LRRGT00151; n=3; Rattus norvegicus|Rep:...    37   0.72 
UniRef50_A6RCU0 Cluster: Predicted protein; n=8; Ajellomyces cap...    37   0.72 
UniRef50_UPI00015B5C72 Cluster: PREDICTED: similar to zinc metal...    36   0.95 
UniRef50_UPI0000E47234 Cluster: PREDICTED: hypothetical protein;...    36   0.95 
UniRef50_Q9YW31 Cluster: ORF MSV061 putative LINE reverse transc...    36   0.95 
UniRef50_Q7X6R8 Cluster: OSJNBa0071G03.15 protein; n=1; Oryza sa...    36   0.95 
UniRef50_Q01HQ6 Cluster: OSIGBa0153E02-OSIGBa0093I20.19 protein;...    36   0.95 
UniRef50_A2EB34 Cluster: Reverse transcriptase, putative; n=1; T...    36   0.95 
UniRef50_Q2GM14 Cluster: Putative uncharacterized protein; n=1; ...    36   0.95 
UniRef50_Q6Q278 Cluster: AcuC; n=2; Acinetobacter|Rep: AcuC - Ac...    36   1.3  
UniRef50_O93521 Cluster: Reverse transcriptase; n=42; Atherinomo...    36   1.7  
UniRef50_Q7XR27 Cluster: OSJNBa0014F04.20 protein; n=3; Oryza sa...    36   1.7  
UniRef50_Q17003 Cluster: Putative reverse transcriptase; n=29; C...    36   1.7  
UniRef50_O44318 Cluster: Reverse transcriptase; n=1; Limulus pol...    36   1.7  
UniRef50_A6RFJ6 Cluster: Predicted protein; n=6; Ajellomyces cap...    36   1.7  
UniRef50_A6R5U3 Cluster: Predicted protein; n=10; Ajellomyces ca...    36   1.7  
UniRef50_P14381 Cluster: Transposon TX1 uncharacterized 149 kDa ...    36   1.7  
UniRef50_Q6TXF7 Cluster: LRRGT00042; n=1; Rattus norvegicus|Rep:...    35   2.2  
UniRef50_Q0Q535 Cluster: Reverse transcriptase; n=1; Phytophthor...    35   2.2  
UniRef50_O44319 Cluster: Reverse transcriptase; n=1; Anurida mar...    35   2.2  
UniRef50_UPI0000E49EC7 Cluster: PREDICTED: similar to endonuclea...    35   2.9  
UniRef50_UPI0000E49710 Cluster: PREDICTED: similar to endonuclea...    35   2.9  
UniRef50_UPI0000E46FAA Cluster: PREDICTED: similar to Rte-1 elem...    35   2.9  
UniRef50_Q10WH5 Cluster: Serine/threonine protein kinase; n=1; T...    35   2.9  
UniRef50_Q10N74 Cluster: Retrotransposon protein, putative, uncl...    35   2.9  
UniRef50_Q0IX63 Cluster: Os10g0463600 protein; n=4; Oryza sativa...    35   2.9  
UniRef50_Q01KW5 Cluster: H0211A12.9 protein; n=2; Oryza sativa|R...    35   2.9  
UniRef50_A3BM93 Cluster: Putative uncharacterized protein; n=1; ...    35   2.9  
UniRef50_Q2H8L4 Cluster: Putative uncharacterized protein; n=1; ...    35   2.9  
UniRef50_Q2GMR4 Cluster: Putative uncharacterized protein; n=1; ...    35   2.9  
UniRef50_A6QZP1 Cluster: Predicted protein; n=37; Ajellomyces ca...    35   2.9  
UniRef50_UPI00015B461D Cluster: PREDICTED: similar to ORF2-encod...    34   3.8  
UniRef50_UPI0000E46784 Cluster: PREDICTED: similar to endonuclea...    34   3.8  
UniRef50_UPI0000D57957 Cluster: PREDICTED: similar to RNA-direct...    34   3.8  
UniRef50_UPI0000D578A4 Cluster: PREDICTED: similar to RNA-direct...    34   3.8  
UniRef50_UPI00005A5FEA Cluster: PREDICTED: similar to ORF2; n=1;...    34   3.8  
UniRef50_Q2QUY9 Cluster: Retrotransposon protein, putative, LINE...    34   3.8  
UniRef50_Q9Y1H5 Cluster: Pol; n=64; root|Rep: Pol - Dictyosteliu...    34   3.8  
UniRef50_Q9Y1H3 Cluster: Pol; n=24; Dictyostelium discoideum|Rep...    34   3.8  
UniRef50_Q6IFU2 Cluster: Pol polyprotein; n=6; Schistosoma|Rep: ...    34   3.8  
UniRef50_O44315 Cluster: Reverse transcriptase; n=1; Dugesiella ...    34   3.8  
UniRef50_Q59K55 Cluster: Polyprotein of L1-like non-LTR retrotra...    34   3.8  
UniRef50_Q2HI82 Cluster: Putative uncharacterized protein; n=3; ...    34   3.8  
UniRef50_Q2HBK6 Cluster: Putative uncharacterized protein; n=1; ...    34   3.8  
UniRef50_Q2GYS3 Cluster: Putative uncharacterized protein; n=1; ...    34   3.8  
UniRef50_Q2GN74 Cluster: Putative uncharacterized protein; n=3; ...    34   3.8  
UniRef50_Q2GM97 Cluster: Putative uncharacterized protein; n=1; ...    34   3.8  
UniRef50_Q2GM30 Cluster: Putative uncharacterized protein; n=1; ...    34   3.8  
UniRef50_Q08810 Cluster: Translation initiation factor IF-2, chl...    34   3.8  
UniRef50_Q7YXU7 Cluster: ORF2; n=1; Girardia tigrina|Rep: ORF2 -...    34   5.1  
UniRef50_Q76IM9 Cluster: Reverse transcriptase; n=1; Ciona intes...    34   5.1  
UniRef50_Q49P02 Cluster: Reverse transcriptase-like protein; n=1...    34   5.1  
UniRef50_Q59KQ0 Cluster: Polyprotein of L1-like non-LTR retrotra...    34   5.1  
UniRef50_O29548 Cluster: Probable phosphoenolpyruvate synthase; ...    34   5.1  
UniRef50_UPI00015557D7 Cluster: PREDICTED: similar to reverse tr...    33   6.7  
UniRef50_UPI0000E487CB Cluster: PREDICTED: similar to endonuclea...    33   6.7  
UniRef50_UPI0000E47679 Cluster: PREDICTED: hypothetical protein;...    33   6.7  
UniRef50_UPI0000E47200 Cluster: PREDICTED: similar to endonuclea...    33   6.7  
UniRef50_UPI0000E45C95 Cluster: PREDICTED: similar to endonuclea...    33   6.7  
UniRef50_UPI0000E45C58 Cluster: PREDICTED: similar to endonuclea...    33   6.7  
UniRef50_UPI00015A401A Cluster: UPI00015A401A related cluster; n...    33   6.7  
UniRef50_Q64IU0 Cluster: Reverse transcriptase; n=1; Kryptolebia...    33   6.7  
UniRef50_Q84TB4 Cluster: Putative reverse transcriptase; n=4; Or...    33   6.7  
UniRef50_A3B2E1 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_Q8IS68 Cluster: LINE1-like RNA-directed DNA polymerase;...    33   6.7  
UniRef50_Q4F8Q0 Cluster: Reverse transcriptase; n=1; Aedes aegyp...    33   6.7  
UniRef50_Q2HBP7 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_A6R672 Cluster: Predicted protein; n=42; Ajellomyces ca...    33   6.7  
UniRef50_A2QSQ0 Cluster: Remark: Mars; n=34; Pezizomycotina|Rep:...    33   6.7  
UniRef50_UPI00015B446A Cluster: PREDICTED: hypothetical protein;...    33   8.8  
UniRef50_UPI0000E4955E Cluster: PREDICTED: similar to fibropelli...    33   8.8  
UniRef50_UPI0000587485 Cluster: PREDICTED: similar to endonuclea...    33   8.8  
UniRef50_Q0ATZ2 Cluster: Putative uncharacterized protein; n=1; ...    33   8.8  
UniRef50_A6CKY3 Cluster: Putative uncharacterized protein; n=1; ...    33   8.8  
UniRef50_Q9FL83 Cluster: Non-LTR retroelement reverse transcript...    33   8.8  
UniRef50_Q2QXT4 Cluster: Retrotransposon protein, putative, uncl...    33   8.8  
UniRef50_Q2HVE2 Cluster: RNA-directed DNA polymerase (Reverse tr...    33   8.8  
UniRef50_Q9U8F6 Cluster: Reverse transcriptase; n=1; Nasonia vit...    33   8.8  
UniRef50_Q22A62 Cluster: Putative uncharacterized protein; n=1; ...    33   8.8  

>UniRef50_Q4QQE8 Cluster: Endonuclease-reverse transcriptase; n=43;
            Eumetazoa|Rep: Endonuclease-reverse transcriptase -
            Schistosoma mansoni (Blood fluke)
          Length = 992

 Score =  146 bits (355), Expect = 5e-34
 Identities = 72/170 (42%), Positives = 105/170 (61%), Gaps = 2/170 (1%)
 Frame = -3

Query: 504  GIEWSENI-LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSK 328
            GI+W+  + L+DLD+ADD+ L++ T  QMQ K   +  ++   GL IN  K+  +R  + 
Sbjct: 718  GIQWTGRMQLDDLDFADDLALLSQTQQQMQEKTTSVAAASAAVGLNINKGKSKTLRYNTI 777

Query: 327  NTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMT 151
             T P+ L     E V    Y+ G ++   GGSD D+  RI KAR A+ QLK +W S  ++
Sbjct: 778  CTNPITLDGEALEDVEIFTYL-GSIIDEHGGSDADVRARIGKARAAYLQLKNIWSSKQLS 836

Query: 150  RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
               K+ +F++ VK+VLL+G ETWR TK +  ++QVF+N CLR ILRI WP
Sbjct: 837  TNTKVRIFNTNVKTVLLYGAETWRTTKAIIQKIQVFINSCLRKILRIRWP 886



 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 42/119 (35%), Positives = 68/119 (57%)
 Frame = -1

Query: 812 IEQSVELAD*K*FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRV 633
           +EQS+E      ++  + +EK+  ++         L+  G+P KI+ II+  Y G  C++
Sbjct: 616 VEQSIEWNS-SLYINFIDYEKAFDSV-DRTTLWKLLRHYGVPEKIVNIIRNSYDGLNCQI 673

Query: 632 VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTLGALNGAKISWKTLTMQM 456
           VH   L    E+  GV+QGCLLSP LF++++D IM+   +T G ++G  I W T  MQ+
Sbjct: 674 VHGGQLTDSFEVKTGVRQGCLLSPFLFLLVIDWIMK--TSTSGGMHG--IQW-TGRMQL 727


>UniRef50_UPI0000E490F6 Cluster: PREDICTED: similar to
            endonuclease-reverse transcriptase; n=5;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            endonuclease-reverse transcriptase - Strongylocentrotus
            purpuratus
          Length = 1030

 Score =  105 bits (251), Expect = 2e-21
 Identities = 58/160 (36%), Positives = 97/160 (60%), Gaps = 3/160 (1%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQ- 304
            + +L +ADDIVL+  T +++Q  ++ +  ++   GL++N  KT +++ +SK+   L +  
Sbjct: 760  INNLRFADDIVLIAETPEELQTLVDKVYKASCDLGLKVNIAKT-EVQAISKSKCNLNIDI 818

Query: 303  --DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTL 130
              D   +V   VY+ G++  N G S  DI+ RIRKA  AF +L  +W S  ++   K+ L
Sbjct: 819  ANDRLKQVEDFVYLGGKIAEN-GSSTSDIKNRIRKAGAAFQRLNNIWTSKSISSHTKMQL 877

Query: 129  FDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRI 10
            + S++ S+LL+G E+W V K  +NRLQVF   CLR I+ +
Sbjct: 878  YQSLILSILLYGAESWTVKKEDSNRLQVFEMACLRRIMGV 917



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/56 (42%), Positives = 35/56 (62%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G P+K+I ++QALY  S   V  +  L    + T GV+QGC +SP LF +LL+ +M
Sbjct: 687 GYPSKLIRLLQALYDQSQSTVRVNGELTEWFKTTVGVRQGCAISPQLFNILLELVM 742


>UniRef50_Q8T5G5 Cluster: Polyprotein; n=35; Schistosoma
            japonicum|Rep: Polyprotein - Schistosoma japonicum (Blood
            fluke)
          Length = 1091

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 56/160 (35%), Positives = 85/160 (53%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTP-LKLQ 304
            L DL+YADDIVL++   D+MQ  L  L ++    G+R + +K   +     N+ P L + 
Sbjct: 807  LTDLEYADDIVLLSEDADKMQDFLTTLNMNVSMLGMRFSPSKCKMLLQDWLNSAPKLVIG 866

Query: 303  DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFD 124
                E        G L+S  G   ++I  RI KAR AFA L+ +W    +    K  ++ 
Sbjct: 867  RETIECVNRFTYLGSLISPNGLVSDEISARIHKARSAFANLRHLWRRRDIRLMTKGRVYC 926

Query: 123  SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + V+SVL +GCETW +      R+ VF ++CLR+I R+ W
Sbjct: 927  AAVRSVLPYGCETWPLRVEDIRRILVFDHRCLRNIARVCW 966



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 26/61 (42%), Positives = 39/61 (63%)
 Frame = -1

Query: 710 CLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           CL  +G+P K I +IQALY  +TCRV     L + +  ++GV+Q C LSP LF  ++D +
Sbjct: 727 CLSLKGVPEKYINLIQALYSNTTCRVRAYGRLSSELTTSSGVRQACPLSPFLFNFIIDIL 786

Query: 530 M 528
           +
Sbjct: 787 L 787


>UniRef50_UPI0000E48520 Cluster: PREDICTED: similar to
            endonuclease-reverse transcriptase; n=2;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            endonuclease-reverse transcriptase - Strongylocentrotus
            purpuratus
          Length = 958

 Score = 93.5 bits (222), Expect = 6e-18
 Identities = 57/172 (33%), Positives = 90/172 (52%), Gaps = 3/172 (1%)
 Frame = -3

Query: 516  DNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
            D   G+     ++ +L +ADDIVL+      +Q  ++ +  S+   GL+IN  KT +++ 
Sbjct: 661  DTKIGVRVQGQLINNLRFADDIVLIADNDRDLQTIVDLVHQSSSNFGLKINITKT-EVQA 719

Query: 336  MSKNTTPLKLQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWE 166
            +SK    L +   G +   V    Y+ G + S  G   E+++ RI KA GAF  LK +W 
Sbjct: 720  ISKQPQLLNINVGGEQLKQVDKFTYLGGTI-SQTGSCSEEVKHRIGKAIGAFQALKKIWA 778

Query: 165  SSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRI 10
            S  +    K+ L+  +V S+LL+G ETW + K   NRL  F   CLR I+ +
Sbjct: 779  SQDIRCSTKVDLYKVLVLSILLYGAETWTLKKVDENRLHTFEMACLRRIMGV 830



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/56 (42%), Positives = 35/56 (62%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G  +K I ++QALY+ S+  V  +  L    + T GV+QGC LSP LF +LL+ +M
Sbjct: 600 GYSSKYIHLLQALYQQSSSAVRVNGELTDWFKTTVGVRQGCALSPQLFNILLEAVM 655


>UniRef50_UPI0000E4A93D Cluster: PREDICTED: similar to
            endonuclease-reverse transcriptase; n=5;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            endonuclease-reverse transcriptase - Strongylocentrotus
            purpuratus
          Length = 1253

 Score = 89.4 bits (212), Expect = 1e-16
 Identities = 55/161 (34%), Positives = 85/161 (52%), Gaps = 1/161 (0%)
 Frame = -3

Query: 483  ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQ 304
            I+ DLD+ADDI L++  L+Q Q  L  +  S  K GLR+N+ KT  M    +    +K  
Sbjct: 998  IITDLDFADDIALLSEELEQAQKLLSRVETSVGKVGLRMNSGKTKFMSFNHRGIITIKTN 1057

Query: 303  D-CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLF 127
            D    E   +    G L+ +   +++D++ R   A  A ++L  +W+SS + R+ K  LF
Sbjct: 1058 DETQLENVPDFKYLGALMVS---TEKDVKARKSAAWRACSKLGRIWKSS-LPRQFKQRLF 1113

Query: 126  DSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             + V+SVLL+GCE W VT  L   L     + LR+   + W
Sbjct: 1114 VATVESVLLYGCEAWAVTTKLAKELDGCYTRLLRTAFNVHW 1154



 Score = 41.5 bits (93), Expect = 0.025
 Identities = 24/86 (27%), Positives = 43/86 (50%)
 Frame = -1

Query: 773  LRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT 594
            +  +   K+  T++ G K    L   GIP +++  I  +Y  +  +V+         E+ 
Sbjct: 891  ITFIDIRKAFDTIHRG-KMLRILTAYGIPEQLVNAIGKMYEDTKAKVISPDGETDLFEIM 949

Query: 593  AGVKQGCLLSPLLFIMLLDDIMREVV 516
            AGV QG  L+P LF+++LD  +R  +
Sbjct: 950  AGVLQGDTLAPYLFVIVLDYALRAAI 975


>UniRef50_UPI0000E4958A Cluster: PREDICTED: similar to
           endonuclease-reverse transcriptase, partial; n=7;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease-reverse transcriptase, partial -
           Strongylocentrotus purpuratus
          Length = 787

 Score = 83.0 bits (196), Expect = 8e-15
 Identities = 44/166 (26%), Positives = 90/166 (54%), Gaps = 1/166 (0%)
 Frame = -3

Query: 504 GIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN 325
           GI+  +  + ++ YADD  LM    + +Q    +L  +  + G++IN  K    +VM+++
Sbjct: 258 GIQMGDMRINNIRYADDTTLMELIFENLQISTNELEKACRRWGMKINATKC---KVMTED 314

Query: 324 TTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTR 148
              + L +   E   +    G  + +    +ED++ R R A  AF +LK  +W +  ++R
Sbjct: 315 HQDISLNNTNIEKVEKFVFLGSTVPS---IEEDVKRRTRLAAWAFGRLKSAIWSNQDISR 371

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRI 10
            +K+ ++ +++  +  +G E+W + K+  N+L+VF  +CLR+IL +
Sbjct: 372 SLKVRIYRALILPIATYGAESWTLRKSDRNKLEVFEMRCLRTILGV 417



 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 24/85 (28%), Positives = 51/85 (60%)
 Frame = -1

Query: 773 LRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT 594
           L  + F+ +  T++  A    CL+  G+   ++ +I+++Y+ + C V+ +  +    ++ 
Sbjct: 169 LNFVDFKAAFDTIWREA-LWKCLRSIGVDKPLVDLIESMYKQTKCSVMVNGKITEWFDVI 227

Query: 593 AGVKQGCLLSPLLFIMLLDDIMREV 519
            GV+QGCLLSP LF + L+ +M+++
Sbjct: 228 TGVRQGCLLSPSLFNLFLEYVMKDI 252


>UniRef50_A4KWG0 Cluster: Reverse transcriptase; n=3; Ostrinia
           nubilalis|Rep: Reverse transcriptase - Ostrinia
           nubilalis (European corn borer)
          Length = 497

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 50/169 (29%), Positives = 89/169 (52%), Gaps = 1/169 (0%)
 Frame = -3

Query: 513 NTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVM 334
           N  GI  +   +  L +ADDIV+M  T++ +   L+ L  ++++ GL++N +KT  M   
Sbjct: 227 NGFGININGEYITHLRFADDIVVMAETVEDLNTMLDGLSRASQQVGLKMNMDKTKIMSNA 286

Query: 333 SKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSV 157
               TPLK+ D   E V   VY+   +   +   ++++  RI+    AF +L+ +  S +
Sbjct: 287 RVVPTPLKVGDTTLELVDNYVYLGQTVQLGRSNFEKEVNRRIQLGWAAFGKLRVILTSEI 346

Query: 156 MTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRI 10
             + +K  +FD  V  V+++G ETW +T  L  RL+V      R++L +
Sbjct: 347 -PQCLKSKVFDQCVLPVMVYGSETWSLTMGLIRRLKVTQRAMERAMLGV 394



 Score = 36.7 bits (81), Expect = 0.72
 Identities = 19/61 (31%), Positives = 33/61 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++  I  + I  ++ LY  +T  V        PI++  GV+QG ++SP LF   L+D+ 
Sbjct: 162 LQRCQIDYRHIEALKGLYENATMSVRLQDQNSKPIQLQRGVRQGDVISPKLFTTALEDVF 221

Query: 527 R 525
           +
Sbjct: 222 K 222


>UniRef50_UPI0000E496F7 Cluster: PREDICTED: similar to
            endonuclease-reverse transcriptase; n=5;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            endonuclease-reverse transcriptase - Strongylocentrotus
            purpuratus
          Length = 890

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 46/160 (28%), Positives = 82/160 (51%)
 Frame = -3

Query: 483  ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQ 304
            ++ D D+ADDI L++  L++ Q  LE +  +A + GL+IN+ KT  M    +        
Sbjct: 652  MITDTDFADDIALISDNLEKAQKLLEQVESAANQVGLQINSTKTEFMMYNLREGEICTAD 711

Query: 303  DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFD 124
                +   +    G  +       +D+ IR  KA  A  +L  +W+S+ + R++K+  F 
Sbjct: 712  RTKLKQVQDFQYLGSWVDQL---KQDLNIRKAKAWTALNKLTAIWKSN-LGRKLKVRFFR 767

Query: 123  SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + V++VLL+G E W +T +L  +L     + LR+ L + W
Sbjct: 768  ASVETVLLYGSEAWTLTSSLAKQLDGCYTRLLRAALNVNW 807



 Score = 33.5 bits (73), Expect = 6.7
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVK-QGCLLSPLLFIMLLDDI 531
           L+  GIP+ I   +  +Y+ +T +V           + AGV+ QG  L+P LFI+ LD  
Sbjct: 566 LRAYGIPHTIFTAVGVMYKYTTAQVRSPDGETDSFTILAGVQVQGDTLAPYLFIIALDYA 625

Query: 530 MR 525
           +R
Sbjct: 626 LR 627


>UniRef50_UPI0000E495D7 Cluster: PREDICTED: similar to
           endonuclease-reverse transcriptase; n=5;
           Deuterostomia|Rep: PREDICTED: similar to
           endonuclease-reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 604

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 49/167 (29%), Positives = 90/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQ 304
           ++ +L +ADD  L++ T +QMQ  ++    +++K GL+IN  KT  +      T  L+ +
Sbjct: 344 LVRELLFADDSALVSHTPEQMQHVIDVFSSASKKFGLQINIKKTEVL--FQPGTDHLEEE 401

Query: 303 DCGFE------VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
           +   +      V    Y+ G  +S  G  D ++  R+ KA  AF +L+  +W +  ++ R
Sbjct: 402 EILVDGTALNQVDDFTYL-GSTISKDGRIDSELVKRMSKASSAFGRLRTRLWNNHHVSTR 460

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +K  +  +IV S LL+G E+W +  +   +L  F+ + LR+I+RI W
Sbjct: 461 VKCKICRAIVLSTLLYGAESWTLYTSQVKKLHAFMMRHLRAIMRISW 507



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/62 (32%), Positives = 35/62 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ G P K  G++++L+ G   +V           ++ GVKQGC+L+P LF + L  ++
Sbjct: 248 LRKYGCPEKFTGMVESLHTGMMAKVKEAGETSHSFPVSNGVKQGCVLAPTLFSIFLSAML 307

Query: 527 RE 522
            E
Sbjct: 308 EE 309


>UniRef50_O97916 Cluster: Reverse transcriptase-like; n=70; Bos
           taurus|Rep: Reverse transcriptase-like - Bos taurus
           (Bovine)
          Length = 335

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 48/176 (27%), Positives = 86/176 (48%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
           NAG G+   GI+ +   + +L YADD  L    + ++++ L  ++  +EK GL++N  KT
Sbjct: 59  NAGLGEAQAGIKIARRNINNLRYADDTTLWQK-MKKLKSLLMKVKEESEKVGLKLNIQKT 117

Query: 351 VDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
             M   S   T  ++     E   +    G  ++  G    +I+ R+   R     L  +
Sbjct: 118 KIMA--SGPITSWQIDGETVETVADFIFLGAKVTAGGDCSHEIKRRLLLGRKVMTHLNSI 175

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            +S  +T   K+ L  ++V SV+++GC++W + K    R+  F   C R +LR+ W
Sbjct: 176 LKSRDITLPTKVRLVKAMVFSVVMYGCKSWTIKKAERQRMDAFELWCWRRLLRVPW 231



 Score = 34.7 bits (76), Expect = 2.9
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 3/119 (2%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRG--STCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P  +  +++ LY G  +T R  H+       ++   V+QGC+LSP LF +  + IMR 
Sbjct: 2   GTPGHLTCLLRNLYAGQETTVRTGHETTYW--FQIGKKVRQGCILSPCLFNLYAEYIMRN 59

Query: 521 VVTTLG-ALNGAKISWKTLTMQMT*C**RQLWIKCKQNLKTSVYLRRKEACVLTPTKLS 348
               LG A  G KI+ + +   +       LW K K+ LK S+ ++ KE       KL+
Sbjct: 60  --AGLGEAQAGIKIARRNIN-NLRYADDTTLWQKMKK-LK-SLLMKVKEESEKVGLKLN 113


>UniRef50_UPI00015B45BA Cluster: PREDICTED: similar to
           ENSANGP00000027469, partial; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to
           ENSANGP00000027469, partial - Nasonia vitripennis
          Length = 758

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 43/155 (27%), Positives = 79/155 (50%), Gaps = 4/155 (2%)
 Frame = -3

Query: 471 LDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT----VDMRVMSKNTTPLKLQ 304
           L YADD+ ++    + +    E L  +AE  GL ++ + T    VD   + +    L++ 
Sbjct: 410 LGYADDLDILGDCRETVARNAEILIKAAEYTGLEVSESNTKYMIVDKLGICRGEGDLRVG 469

Query: 303 DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFD 124
           +  FE  +E    G  ++++   +  I  R+      F  +  + +S +++R +K+ ++ 
Sbjct: 470 NFTFEKVSEFRYLGTTINDRNEINVKINKRLHSGNACFYAVSNLLKSRLLSRNVKIRIYR 529

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSI 19
            I+  V+L+ CETW +TK   NR +VF NK LR I
Sbjct: 530 RIILPVVLYECETWALTKQADNRFRVFENKVLRKI 564


>UniRef50_UPI0000F30BC1 Cluster: Eomesodermin; n=22; Bos taurus|Rep:
           Eomesodermin - Bos Taurus
          Length = 324

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 44/154 (28%), Positives = 75/154 (48%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
           NAG  +   GI+ +   + +L YADD  LM  + +++++ L  ++   EK GL+IN  KT
Sbjct: 59  NAGLDEAQAGIKIAGRNINNLKYADDTTLMAESKEELKSLLMKVKEENEKVGLKINIQKT 118

Query: 351 VDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
             M   S   T  ++     E   +    G  ++  G    +I+ R+   R A   L  +
Sbjct: 119 KIM--ASDPITSWQIDGETIETVRDFIFLGSKITTDGDRSHEIKRRLLLGRKAMTNLDSI 176

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            +S  +T    + L  S+V  VL++GCE+W + K
Sbjct: 177 LKSRDITLPTNVHLVKSMVLPVLMYGCESWTIKK 210



 Score = 40.7 bits (91), Expect = 0.044
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           GIP+ +I +++ LY G    V          ++  GV+QGC+LSP LF +  + IMR
Sbjct: 2   GIPDHLICLLRNLYAGQEATVRTGHGTTDWFQIGKGVRQGCILSPCLFNLYAEYIMR 58


>UniRef50_UPI0000E4635A Cluster: PREDICTED: similar to reverse
           transcriptase-like; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to reverse
           transcriptase-like - Strongylocentrotus purpuratus
          Length = 281

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 40/167 (23%), Positives = 84/167 (50%)
 Frame = -3

Query: 504 GIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN 325
           G+++    + +L YAD+  L+  + +++   L  +++++E++ L +NT KT  M V    
Sbjct: 67  GVKFGGKKIMNLRYADETTLVCSSREELMDLLNRIKLASEEKDLLLNTKKTKIMAV---- 122

Query: 324 TTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRR 145
                  D  ++  TE  ++G ++  +  S  +I  R+  AR     +  +W+S  ++  
Sbjct: 123 -------DRDYD-DTEFTVAGNMIEVELESTTEIRRRMAMARSTVQNMSHIWKSRGLSLS 174

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +K+ L  +   S+  +G E+W +TK    R+  F   C R +L++ W
Sbjct: 175 LKVRLLQATSFSIATYGSESWAMTKNDRKRVDAFEMWCYRRLLQVSW 221



 Score = 40.7 bits (91), Expect = 0.044
 Identities = 26/76 (34%), Positives = 37/76 (48%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G P+ II +I+ LY      V           +  GV+QGC+LSP LF +  +DIMR+ +
Sbjct: 2   GFPSHIIELIKNLYHHQEATVRTSNGNTEWFGIGRGVRQGCILSPNLFNIYSEDIMRKAL 61

Query: 515 TTLGALNGAKISWKTL 468
              G   G K   K +
Sbjct: 62  E--GFKGGVKFGGKKI 75


>UniRef50_UPI0000F32779 Cluster: UPI0000F32779 related cluster; n=9;
           Bos taurus|Rep: UPI0000F32779 UniRef100 entry - Bos
           Taurus
          Length = 263

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 41/159 (25%), Positives = 78/159 (49%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +L Y DD  L+  T +++++ L  ++  +EK GL++N  KT  M   S   +  ++  
Sbjct: 1   INNLRYGDDTTLIAETEEELKSLLMKVKEESEKVGLKLNIQKTKIMA--SGPISSWEIDG 58

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDS 121
              E  ++    G  ++  G    +I+ R+   R     L  +++S  +T   K+ L  +
Sbjct: 59  ETVETVSDFIFLGSKITEDGDCSHEIKRRLLLERKVMTNLDSIFKSRDITLPTKVCLVKA 118

Query: 120 IVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +V  +++ GCE+W V K    R+  F   C R +LR+ W
Sbjct: 119 MVFPLVVHGCESWTVKKAEGQRIDAFELWCWRRLLRVPW 157


>UniRef50_UPI0000E48997 Cluster: PREDICTED: similar to reverse
           transcriptase-like; n=6; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to reverse
           transcriptase-like - Strongylocentrotus purpuratus
          Length = 415

 Score = 66.5 bits (155), Expect = 8e-10
 Identities = 44/170 (25%), Positives = 80/170 (47%), Gaps = 3/170 (1%)
 Frame = -3

Query: 504 GIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN 325
           GI++    + +L YADD  L+  + D +++    +  + +K  L +N  KT  +     +
Sbjct: 136 GIKFGGKNISNLRYADDTALIESSKDGIESLTHAVNDAGKKLNLHLNVKKTKLLVAGKTS 195

Query: 324 TTPLKLQDCGF---EVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVM 154
            T   +Q  G    +V +  Y+ G   ++      DI+IRI  A+     L  +W    +
Sbjct: 196 DTDCNIQIDGETVKDVESFKYL-GSTKNSDASCTNDIKIRIAIAKKRMVDLHVLWNDRNI 254

Query: 153 TRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  +K+ L  ++V S LL+G E+W + K   NR+        R +L+I W
Sbjct: 255 STGLKIKLVKTLVWSALLYGAESWTLLKADENRIMAAEMWFWRKMLKISW 304



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = -1

Query: 701 QRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           + G P  +  +IQ+LY     R+  D       E+  G +QGC+LSP LFI   +  MRE
Sbjct: 70  EMGFPKHLFTLIQSLYVNQRARIRWDGEHTEEFEIGKGARQGCILSPYLFITYTESGMRE 129

Query: 521 V-VTTLGALNGAK 486
             V   G   G K
Sbjct: 130 ADVAHYGIKFGGK 142


>UniRef50_UPI0000F1FDAD Cluster: PREDICTED: similar to reverse
           transcriptase-like; n=1; Danio rerio|Rep: PREDICTED:
           similar to reverse transcriptase-like - Danio rerio
          Length = 249

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 34/129 (26%), Positives = 61/129 (47%)
 Frame = -3

Query: 390 AEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRI 211
           +E  GL +N  KT  M      T  + + +   E   +    G  + + G S  +I  RI
Sbjct: 35  SEHMGLYLNIKKTNVMTTACNGTVHITIDNEEIESVQDFVFLGSKIDHNGESGPEIRQRI 94

Query: 210 RKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKC 31
              R A   ++ VW+S V++   K+ + ++IV  + ++ CE+W + K    ++  F   C
Sbjct: 95  ALGRSAMQGMEKVWKSKVISIVTKIRIINAIVFPIFMYACESWTLKKKDRRKIDAFELWC 154

Query: 30  LRSILRIFW 4
            R ++RI W
Sbjct: 155 WRQMMRIPW 163


>UniRef50_UPI0000E4A747 Cluster: PREDICTED: similar to
           endonuclease-reverse transcriptase; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease-reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 555

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
           G  +S  G  D ++  R+ KA  AF +L+  +W +  ++ R+K  ++ +IV S LL+G E
Sbjct: 371 GSTISKDGRIDSELVKRMSKASSAFGRLRTRLWNNHHVSTRVKCKIYRAIVLSTLLYGAE 430

Query: 87  TWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +W + K+   +L  F+ + LR+I+RI W
Sbjct: 431 SWTLYKSQVKKLHAFMMRHLRAIMRISW 458



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/62 (32%), Positives = 35/62 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ G P K  G++++L+ G   +V           ++ GVKQGC+L+P LF + L  ++
Sbjct: 247 LRKYGCPEKFTGMVESLHTGMMAKVKEAGETSHSFPVSNGVKQGCVLAPTLFSIFLSAML 306

Query: 527 RE 522
            E
Sbjct: 307 EE 308


>UniRef50_UPI0000E4800E Cluster: PREDICTED: similar to protein
           F28E10.3 [imported] - Caenorhabditis elegans; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           protein F28E10.3 [imported] - Caenorhabditis elegans -
           Strongylocentrotus purpuratus
          Length = 824

 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 38/169 (22%), Positives = 80/169 (47%), Gaps = 1/169 (0%)
 Frame = -3

Query: 513 NTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVM 334
           +++GI  +   +  L +ADDIV+++  L+ ++  L++L  ++   GL++N  KT  M   
Sbjct: 166 SSKGININGKNMSHLRFADDIVIISHNLNDLEIMLQELDDASRLTGLKMNMKKTKVMAGS 225

Query: 333 SKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSV 157
           +K+  P+++     E V   +Y+           D +I  RI+     F +   + +   
Sbjct: 226 AKDPKPIQVNGTKMEQVEDYIYLGQRFSLQDKNQDNEIRRRIKAGWQGFGRYSTIMKGK- 284

Query: 156 MTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRI 10
           +   +K  +++  +   + +  ETW +T  +  +L    +   RSIL I
Sbjct: 285 LPLCLKKKVYNQCIIPAISYAAETWTLTSKMERKLAASQHNMERSILSI 333


>UniRef50_O16589 Cluster: Putative uncharacterized protein F21E9.5;
            n=1; Caenorhabditis elegans|Rep: Putative uncharacterized
            protein F21E9.5 - Caenorhabditis elegans
          Length = 864

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 49/165 (29%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = -3

Query: 510  TRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR--- 340
            T GI  +   L +L +ADDIVL+          L +L       GL+INT KT  +R   
Sbjct: 557  TEGIRVNGQNLTNLRFADDIVLVAHNPRTASQMLTELVEKCSSVGLKINTGKTKVLRNRF 616

Query: 339  -------VMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL 181
                   +   NTT + + D    V+  +Y+ G  +++      ++  R R A  AF  +
Sbjct: 617  AYKRKVEIRCPNTTNIIIDD----VNEYIYL-GRQINDSNNLLPELHRRRRAAWAAFTNI 671

Query: 180  KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQV 46
            K   +  +   R++  LFDS V   L +G E W  TK L  R++V
Sbjct: 672  KSTTDQ-ITCPRLRANLFDSTVLPALTYGSEAWTFTKELAERVRV 715


>UniRef50_Q10126 Cluster: Uncharacterized protein F52C9.6; n=7;
           Caenorhabditis elegans|Rep: Uncharacterized protein
           F52C9.6 - Caenorhabditis elegans
          Length = 279

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 46/151 (30%), Positives = 74/151 (49%), Gaps = 6/151 (3%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           L +L +ADDIVL+    +     L++L     + GL INT KT  +R  ++   P K+  
Sbjct: 8   LTNLRFADDIVLIANHPNTASKMLQELVQKCSEVGLEINTGKTKVLR--NRLADPSKVYF 65

Query: 300 CGFEVSTEV-----YIS-GELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIK 139
                +T++     YI  G  ++       +I  R R A  AF   K   +S +  ++I+
Sbjct: 66  GSPSSTTQLDDVDEYIYLGRQINAHNNLMPEIHRRRRAAWAAFNGSKNTTDS-ITDKKIR 124

Query: 138 LTLFDSIVKSVLLFGCETWRVTKTLTNRLQV 46
           + LFDSIV   L +G E W   K L+ R+++
Sbjct: 125 VNLFDSIVLPALTYGSEAWTFNKALSERVRI 155


>UniRef50_UPI0000E4A090 Cluster: PREDICTED: similar to reverse
           transcriptase-like; n=4; Deuterostomia|Rep: PREDICTED:
           similar to reverse transcriptase-like -
           Strongylocentrotus purpuratus
          Length = 565

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 23/88 (26%), Positives = 46/88 (52%)
 Frame = -3

Query: 267 SGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
           SG +++ +G S  +I  R+  AR     +  +W+S  ++  +K+ L  +   ++  +G E
Sbjct: 112 SGSIITTKGESTTEIRRRMAMARSTVQNMSHIWKSRGLSLNLKVRLLQATSFTIATYGSE 171

Query: 87  TWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +W +TK    R+  F   C R +L++ W
Sbjct: 172 SWAMTKNDRKRVDAFEMWCYRRLLQVSW 199



 Score = 42.3 bits (95), Expect = 0.014
 Identities = 27/77 (35%), Positives = 37/77 (48%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G P+ II +I+ LY      V           +  GV+QGC+LSP LF +  +DIMR  +
Sbjct: 2   GFPSHIIELIKNLYHDQEATVRTSNGNTEWFGIGRGVRQGCILSPNLFNIYSEDIMRNAL 61

Query: 515 TTLGALNGAKISWKTLT 465
              G   G K   K +T
Sbjct: 62  E--GFNGGVKFGGKKIT 76


>UniRef50_UPI0000E48AC5 Cluster: PREDICTED: similar to novel EGF
           domain containing protein; n=2; Eumetazoa|Rep:
           PREDICTED: similar to novel EGF domain containing
           protein - Strongylocentrotus purpuratus
          Length = 3832

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 27/82 (32%), Positives = 44/82 (53%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCET 85
           G +LS +G   E +  RI + + A  +LK +W +  +T   K+ L  S+V S+ L  CET
Sbjct: 29  GAILSVEGSKLEVLS-RIAQTKAAVTKLKVIWTNKNITISSKIRLMRSLVISIFLDACET 87

Query: 84  WRVTKTLTNRLQVFVNKCLRSI 19
           W +T  +  R+Q    +C R +
Sbjct: 88  WTITADIGRRIQALEMRCFRKL 109


>UniRef50_Q76IN8 Cluster: Reverse transcriptase; n=1; Ciona
           intestinalis|Rep: Reverse transcriptase - Ciona
           intestinalis (Transparent sea squirt)
          Length = 806

 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 2/78 (2%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+++ +P K + I+Q LY G+   V         + +  GVKQGC LSPLLF ++LD+++
Sbjct: 504 LRRQQVPEKFVRIVQDLYDGAVTTVSVGGRATPQLVVKRGVKQGCPLSPLLFNLVLDELI 563

Query: 527 REVVTTLGAL--NGAKIS 480
            E+ ++ G    +G+K+S
Sbjct: 564 DELSSSFGYTLDDGSKLS 581


>UniRef50_UPI00015B42A6 Cluster: PREDICTED: similar to polyprotein;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            polyprotein - Nasonia vitripennis
          Length = 1249

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 4/128 (3%)
 Frame = -3

Query: 375  LRINTNKTVDMRVMSKNTTP---LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRK 205
            L IN +K+VD+    +NTTP   ++++    + S      G  L  +    +  ++ + K
Sbjct: 1037 LSINESKSVDIFFSKRNTTPHTCIQIKGHTLKWSNSAKYLGVTLDRKLSWVKHTKLTLSK 1096

Query: 204  ARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVT-KTLTNRLQVFVNKCL 28
            A GAF QL+P + +  ++ + KL  F +I++S+  +    W    ++    ++    + L
Sbjct: 1097 ALGAFIQLRPFFNNKSVSYKTKLRAFSAIIRSIQTYAIPVWGAAGESHLKPIEGSFFRML 1156

Query: 27   RSILRIFW 4
            RSIL I W
Sbjct: 1157 RSILDIPW 1164



 Score = 36.7 bits (81), Expect = 0.72
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = -1

Query: 689  PNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI-MREVVT 513
            P+ +IG IQ+     + RV     L +   +TAGV QG  LSP LF +   DI  RE + 
Sbjct: 938  PHYLIGTIQSFLTDRSLRVKVGHSLSSSKPITAGVPQGSKLSPTLFNLYGYDIPQREGII 997

Query: 512  TLGALNGAKISWKTLTMQMT*C 447
            T  A+    I+    T Q++ C
Sbjct: 998  T--AIYADDIAVLRTTRQISQC 1017


>UniRef50_Q6L4B3 Cluster: Polyprotein, putative; n=6; core
           eudicotyledons|Rep: Polyprotein, putative - Solanum
           demissum (Wild potato)
          Length = 868

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 36/152 (23%), Positives = 68/152 (44%), Gaps = 5/152 (3%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV-----MSKNTTPLKLQD 301
           +ADDIVL+  T D++ A+LE  R + E +G R++  KT  +       + +    ++L  
Sbjct: 437 FADDIVLIDETRDRVNARLEVWRQTLESKGFRLSRTKTEYLGCKFSDGLDETDVEVRLAA 496

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDS 121
                       G ++   G  D+D+  R+  A   +     V     ++ ++K   +  
Sbjct: 497 QVIPKKESFRYLGAVIQGSGDIDDDVTHRVGAAWMKWRLASGVLCDKKISPKLKGKFYRV 556

Query: 120 IVKSVLLFGCETWRVTKTLTNRLQVFVNKCLR 25
           +V+  LL+G E W V     +++ V   + LR
Sbjct: 557 VVRPALLYGAECWPVKNAHVHKMHVAEMRMLR 588


>UniRef50_Q572J7 Cluster: Reverse transcriptase precursor, putative;
           n=1; Phytophthora infestans|Rep: Reverse transcriptase
           precursor, putative - Phytophthora infestans (Potato
           late blight fungus)
          Length = 885

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/75 (32%), Positives = 46/75 (61%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+ +G P+K   I++A +  +T + + +  L   I +T+G++QGC L+PLLFI+ + D++
Sbjct: 635 LEAKGFPSKFRAIVKATHENTTVKFMANGTLSRAIAVTSGIRQGCPLAPLLFILAV-DLL 693

Query: 527 REVVTTLGALNGAKI 483
            + V     L G ++
Sbjct: 694 YDAVHQEQRLKGLRL 708


>UniRef50_O44323 Cluster: Reverse transcriptase; n=1; Forficula
           auricularia|Rep: Reverse transcriptase - Forficula
           auricularia (European earwig)
          Length = 1033

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           ++ RG P  +I  I A YR S  R   +  +   ++ T GVKQG  LSP+LF +++D ++
Sbjct: 473 MEVRGFPKPMINYIMACYRRSKTRFTFNGWISDTVKPTCGVKQGDPLSPILFNLVMDRMI 532

Query: 527 REVVTTLGALNGAK 486
           R++   +G   G+K
Sbjct: 533 RKLPKEVGVNVGSK 546


>UniRef50_A7S2E3 Cluster: Predicted protein; n=9; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 428

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+ADDI L++ T   +Q K   L   A   GL+IN  K
Sbjct: 61  SVGKGEN--GIRWKFTSKLDDLDFADDIALLSSTKHHIQEKTAKLDGEARGAGLKINLEK 118

Query: 354 TVDMRVMSK 328
           T  +R+ +K
Sbjct: 119 TKMLRINAK 127



 Score = 39.9 bits (89), Expect = 0.077
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           +++ G+P KII I++  Y    C V      G    +  GVKQGC +S L F
Sbjct: 1   MEKYGVPEKIIRIVRLFYEDFQCAVEDQGETGEWFNIKTGVKQGCNMSGLCF 52


>UniRef50_Q1HW07 Cluster: Reverse transcriptase; n=1; Penaeus
           monodon|Rep: Reverse transcriptase - Penaeus monodon
           (Penoeid shrimp)
          Length = 382

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+ RGIP++IIG+I +LY G+   V     +     + +GV+QGC+L+P LF   +D IM
Sbjct: 271 LRLRGIPSQIIGLIASLYTGTESAVKCGGGMSNFFPVKSGVRQGCVLAPTLFNTCMDWIM 330


>UniRef50_Q572K4 Cluster: Reverse transcriptase, putative; n=2;
           Phytophthora infestans|Rep: Reverse transcriptase,
           putative - Phytophthora infestans (Potato late blight
           fungus)
          Length = 1513

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/75 (30%), Positives = 45/75 (60%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+ +G P K   I++  +  +T + + +  L   +E+T+G++QGC L+PLLFI+ + D++
Sbjct: 578 LEAKGFPPKFREIVRTTHEATTVQFMANGSLSRALEVTSGIRQGCPLAPLLFILAV-DLL 636

Query: 527 REVVTTLGALNGAKI 483
            + V     L G ++
Sbjct: 637 YDAVQNDQDLEGVRL 651


>UniRef50_Q1AKH8 Cluster: Reverse transcriptase family member; n=6;
           Papilionoideae|Rep: Reverse transcriptase family member
           - Glycine max (Soybean)
          Length = 377

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 34/151 (22%), Positives = 70/151 (46%), Gaps = 4/151 (2%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSK----NTTPLKLQDC 298
           +ADDIVL+  + +++  +LE  R + E  G R++ +K+  M         + + +K+ D 
Sbjct: 122 FADDIVLLGESREELNERLETWRRALETHGFRLSRSKSEYMECQFNKRRVSNSEVKIGDH 181

Query: 297 GFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSI 118
                T     G ++ + G  + D+  RI+     + +   V   + +  ++K   + + 
Sbjct: 182 IIPQVTRFKYLGSVIQDDGEIEGDVNHRIQAGWMKWRKASGVLCDAKVPIKLKGKFYRTA 241

Query: 117 VKSVLLFGCETWRVTKTLTNRLQVFVNKCLR 25
           V+  +L+G E W V     N++ V   + LR
Sbjct: 242 VRPTILYGTECWAVKSQHENKVGVAEMRMLR 272


>UniRef50_Q5BQT0 Cluster: SJCHGC09821 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09821 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 85

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 20/50 (40%), Positives = 35/50 (70%)
 Frame = -3

Query: 234 DEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCET 85
           D D++  I  AR AF QLK +W+ + ++  IK+++F++ VK++ L+G ET
Sbjct: 15  DADVKALIDMARAAFRQLKNIWDFNHLSVNIKVSIFNTNVKTLQLYGAET 64


>UniRef50_Q5BQS2 Cluster: SJCHGC09829 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09829 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 77

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 28/68 (41%), Positives = 35/68 (51%)
 Frame = +2

Query: 2   GQNMRSIDLKHLFTNTCSRFVSVLVTLQVSHPKRRTLLTMESNRVSLIRRVMTLDSQTGF 181
           GQ   +I  + L  NTC+      V L VS P RRT LT E   ++L+     L+S T F
Sbjct: 4   GQQTFNILRRQLLINTCTLLRMFAVVLHVSAPYRRTDLTFELKSLTLMLVDSCLESHTFF 63

Query: 182 NCAKAPLA 205
           NC  A LA
Sbjct: 64  NCRNAALA 71


>UniRef50_Q4F8Q3 Cluster: Reverse transcriptase; n=1; Aedes
           aegypti|Rep: Reverse transcriptase - Aedes aegypti
           (Yellowfever mosquito)
          Length = 265

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 22/63 (34%), Positives = 39/63 (61%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ G+P  II +IQ LY  +T RV+    L    ++   V+QGC LS  LF++ ++ ++
Sbjct: 26  LERFGLPRTIITMIQRLYADATSRVLVKGSLTNSFQIKRSVRQGCPLSMTLFVLYIEALI 85

Query: 527 REV 519
           R++
Sbjct: 86  RQI 88


>UniRef50_Q95SX7 Cluster: Probable RNA-directed DNA polymerase from
            transposon BS; n=7; melanogaster subgroup|Rep: Probable
            RNA-directed DNA polymerase from transposon BS -
            Drosophila melanogaster (Fruit fly)
          Length = 906

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 39/161 (24%), Positives = 73/161 (45%), Gaps = 12/161 (7%)
 Frame = -3

Query: 465  YADDIVLM------TPTLDQMQAKLEDLRISAEKRGLRINTNKTVD----MRVMSKNTTP 316
            YADDI L+            +Q  L  L    ++  L++N  KT++    ++ +S  T P
Sbjct: 678  YADDIALLYSSNCCNEAARGLQEYLTTLAAWCKRWILKVNPQKTINPCFTLKTLSPVTAP 737

Query: 315  LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWE-SSVMTRRIK 139
            ++L+    +  ++    G  L  +      ++   R+      QL+ +    S MT R K
Sbjct: 738  IELEGVILDQPSQAKYLGITLDKRLTFGPHLKATTRRCYQRMQQLRWLLNRKSTMTLRAK 797

Query: 138  LTLFDSIVKSVLLFGCETWRV-TKTLTNRLQVFVNKCLRSI 19
              ++   V  + L+G + W +  K+  NR+QV  N+ +R+I
Sbjct: 798  RAVYVHCVAPIWLYGIQIWGIAAKSNYNRIQVLQNRAMRAI 838


>UniRef50_UPI0000E46D01 Cluster: PREDICTED: similar to sodium
           dependent phosphate transporter isoform NaPi-3b; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           sodium dependent phosphate transporter isoform NaPi-3b -
           Strongylocentrotus purpuratus
          Length = 561

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ G P K  G+I++L+ G   +V           ++ GVKQGC+L+P LF + L  ++
Sbjct: 465 LRKYGCPEKFTGMIESLHTGMMAKVKEAGETSDSFPVSNGVKQGCVLAPTLFSIFLSAML 524

Query: 527 RE 522
            E
Sbjct: 525 EE 526


>UniRef50_Q01HH7 Cluster: OSIGBa0142I02-OSIGBa0101B20.12 protein; n=2;
            Oryza sativa|Rep: OSIGBa0142I02-OSIGBa0101B20.12 protein
            - Oryza sativa (Rice)
          Length = 1230

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 2/73 (2%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L+ RG P K    I  L   ST +++ +   G  I+   G++QG  LSPLLFI+ +D + 
Sbjct: 859  LQNRGFPPKWREWITGLLSASTSKIILNGTPGEAIKHGKGLRQGDPLSPLLFILAIDPLQ 918

Query: 527  R--EVVTTLGALN 495
            R  +  T LGA++
Sbjct: 919  RLLDKATELGAIS 931


>UniRef50_Q6C7P5 Cluster: Ylli protein; n=24; Yarrowia
           lipolytica|Rep: Ylli protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 1301

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+   +I  I A+ + +  R+    VL  P+ +  GV+QGC LSP LFI+ +D ++
Sbjct: 631 LRNVGVSELMINRILAVQQNAVTRINIRGVLSRPVRIKIGVRQGCPLSPTLFIIAVDALV 690

Query: 527 REV 519
           R +
Sbjct: 691 RRL 693


>UniRef50_Q4P0U8 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1276

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/66 (33%), Positives = 40/66 (60%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           LKQ G+P  I   I+ALY     +V+ +     P  + +GV+QG  LS +L+++ L+ ++
Sbjct: 564 LKQVGLPEPIRHAIKALYANVKLKVMVNGFASKPFPVRSGVRQGDPLSCILYVLFLEPLI 623

Query: 527 REVVTT 510
           R++ T+
Sbjct: 624 RKIQTS 629


>UniRef50_Q9XXW0 Cluster: Endonuclease and reverse
           transcriptase-like protein; n=9; cellular organisms|Rep:
           Endonuclease and reverse transcriptase-like protein -
           Bombyx mori (Silk moth)
          Length = 960

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/63 (36%), Positives = 36/63 (57%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G+P+ ++ II+      + R   +    +P  +TAGV QG +LSPLLF + ++DI R   
Sbjct: 617 GVPDSLVLIIRDFLSNRSFRYRVEGTRSSPRPLTAGVPQGSVLSPLLFSLFINDIPRSPP 676

Query: 515 TTL 507
           T L
Sbjct: 677 TQL 679


>UniRef50_UPI00015B5DC1 Cluster: PREDICTED: similar to CG11502-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG11502-PA - Nasonia vitripennis
          Length = 463

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV- 519
           G+P K++ +IQ    GST +V     +  P  +  G+KQG  LS +LF + L+ ++R++ 
Sbjct: 345 GVPKKLVRLIQICLNGSTGKVRVGGNVSEPFTIRDGLKQGDGLSTVLFNLTLEYVVRKMQ 404

Query: 518 VTTLGA-LNG 492
           V+ LGA LNG
Sbjct: 405 VSQLGATLNG 414


>UniRef50_UPI0000F1D59F Cluster: PREDICTED: similar to pol-like
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol-like protein - Danio rerio
          Length = 557

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 18/59 (30%), Positives = 35/59 (59%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L++ G P K I  +  LY+    +++ +  L   + + +GV+QGC LSPLL++  ++ +
Sbjct: 73  LEKMGFPGKFIAWVGLLYKDLNSKIIVNGHLSKAVNIHSGVRQGCPLSPLLYVACIEPL 131


>UniRef50_Q76IL9 Cluster: Pol-like protein; n=1; Danio rerio|Rep:
           Pol-like protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1267

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/78 (28%), Positives = 44/78 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           LK  G  +  I +++ LY  +TC V     L  PIE+  G++QGC LS  L+ ++++ ++
Sbjct: 631 LKAFGFGDSFISMVKVLYNKATCMVKMAGGLSVPIEIHKGIRQGCPLSGQLYSIVIEPLL 690

Query: 527 REVVTTLGALNGAKISWK 474
            ++   L  L+  ++ ++
Sbjct: 691 CKLRRWLTGLSVPELDFQ 708


>UniRef50_Q7XUD8 Cluster: OSJNBa0088A01.7 protein; n=2; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBa0088A01.7 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1324

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 2/73 (2%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L+ RG+P K    I  L   ST ++  + + G  I    G++QG  +SPLLFI+ +D + 
Sbjct: 1054 LQNRGLPQKWRDWISGLLSTSTSKITLNGIPGETIRHWKGLRQGDPISPLLFILAIDPLQ 1113

Query: 527  R--EVVTTLGALN 495
            R  +  T +G L+
Sbjct: 1114 RLLDKATDIGILS 1126


>UniRef50_Q0E285 Cluster: Os02g0261600 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os02g0261600 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 958

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+++G   + I  + AL   ST +V+ +   G  I+   G++QG  LSPLLFI+ +D + 
Sbjct: 604 LQRKGFSTRWIDWLGALLSSSTSQVLLNGSPGQRIKHGRGLRQGDPLSPLLFILAIDPLQ 663

Query: 527 R--EVVTTLGALNGAKISWKTLTMQMT 453
           R     T LGA+  +K+  +T  +Q++
Sbjct: 664 RILSKATELGAI--SKLRGRTTRLQIS 688


>UniRef50_Q03278 Cluster: Retrovirus-related Pol polyprotein from
           type-1 retrotransposable element R2 (Retrovirus-related
           Pol polyprotein from type I retrotransposable element
           R2) [Includes: Reverse transcriptase (EC 2.7.7.49);
           Endonuclease]; n=1; Nasonia vitripennis|Rep:
           Retrovirus-related Pol polyprotein from type-1
           retrotransposable element R2 (Retrovirus-related Pol
           polyprotein from type I retrotransposable element R2)
           [Includes: Reverse transcriptase (EC 2.7.7.49);
           Endonuclease] - Nasonia vitripennis (Parasitic wasp)
          Length = 1025

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 25/74 (33%), Positives = 41/74 (55%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+++ +P ++   I  +YR S  R+   +  G  I    GV+QG  LSPLLF  ++D ++
Sbjct: 473 LRRKKLPLEMRNYIMWVYRNSKTRLEVVKTKGRWIRPARGVRQGDPLSPLLFNCVMDAVL 532

Query: 527 REVVTTLGALNGAK 486
           R +    G L GA+
Sbjct: 533 RRLPENTGFLMGAE 546


>UniRef50_UPI0000E47DA3 Cluster: PREDICTED: similar to
            ENSANGP00000029527; n=13; Strongylocentrotus
            purpuratus|Rep: PREDICTED: similar to ENSANGP00000029527
            - Strongylocentrotus purpuratus
          Length = 1715

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 25/84 (29%), Positives = 46/84 (54%)
 Frame = -1

Query: 776  FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEM 597
            F+ LL  EK+   ++  A     L    I  + + ++++LY     +V+ D  +  P  +
Sbjct: 1093 FVALLDAEKAFDKVWH-AGLFQKLTSTSIHPQHLNMVRSLYNSMQSQVLWDGTVSDPFPI 1151

Query: 596  TAGVKQGCLLSPLLFIMLLDDIMR 525
              GV+QG +LSPLL+I  +D++M+
Sbjct: 1152 LQGVRQGGVLSPLLYITFIDELMK 1175


>UniRef50_Q5K671 Cluster: Reverse transcriptase; n=2; Bombyx
           mori|Rep: Reverse transcriptase - Bombyx mori (Silk
           moth)
          Length = 1114

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 21/68 (30%), Positives = 41/68 (60%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+ RG+P +  G I  LY  ++  +  +  + +P+++  GV+QG  LSP+LF +++D I+
Sbjct: 546 LRLRGMPVQFCGYIAHLYDTASTTLAVNNEMSSPVKVGRGVRQGDPLSPILFNVVMDLIL 605

Query: 527 REVVTTLG 504
             +   +G
Sbjct: 606 ASLPERVG 613


>UniRef50_UPI0000E493DE Cluster: PREDICTED: similar to
           endonuclease-reverse transcriptase; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease-reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 1186

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 25/66 (37%), Positives = 35/66 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           LK  GI   I+  I+    G   RVV          +T+GV QG +L PLLF++ ++DI 
Sbjct: 755 LKHNGIRGHILNWIEGFLTGRRQRVVLRNGTSRWRSVTSGVPQGSILGPLLFLIFVNDIP 814

Query: 527 REVVTT 510
             V+TT
Sbjct: 815 DMVLTT 820


>UniRef50_Q2R8K4 Cluster: Retrotransposon protein, putative, LINE
           subclass; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           LINE subclass - Oryza sativa subsp. japonica (Rice)
          Length = 540

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 4/127 (3%)
 Frame = -3

Query: 465 YADDIV-LMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD---C 298
           Y DD+V  + PT+++++A +E L I  E  GLR N  K   + +         LQD   C
Sbjct: 19  YTDDVVTFIRPTVEEIRAAMEVLSIFGEASGLRTNFAKCSTLPIQCNEADLQILQDEQPC 78

Query: 297 GFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSI 118
                   Y+ G LLS      ED++  I K      +  P+W S +MT   + T+ +++
Sbjct: 79  QVASFPCTYL-GLLLSIFRLKKEDLQPLIDK----IGRRLPLWMSHLMTSIGRATMVNAV 133

Query: 117 VKSVLLF 97
           + S+ ++
Sbjct: 134 LSSIPIY 140


>UniRef50_UPI0000E4A923 Cluster: PREDICTED: similar to angiotensin
           converting enzyme, partial; n=3; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to angiotensin
           converting enzyme, partial - Strongylocentrotus
           purpuratus
          Length = 926

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = -3

Query: 495 WSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM 343
           +S  ++ D D+ADDI L++  L++ Q  LE +  +A + GL+IN+ KT  M
Sbjct: 356 YSAVMITDTDFADDIALISDNLEKAQKLLEQVESAASQVGLQINSTKTAFM 406


>UniRef50_UPI0000F33B2A Cluster: UPI0000F33B2A related cluster; n=3;
           Bos taurus|Rep: UPI0000F33B2A UniRef100 entry - Bos
           Taurus
          Length = 253

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 33/159 (20%), Positives = 70/159 (44%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +L YADD  LM  + +++++ L  ++  +E+ GL++N  K    ++     T  ++  
Sbjct: 2   INNLRYADDTTLMAESEEELKSLLMKVKGESERVGLKLNIQKN---KMAPSPITSWQIDG 58

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDS 121
              E  T+    G  ++       +I+  +   R A   L    +     R   +    +
Sbjct: 59  ETVETVTDFIFLGSKITADDDCSHEIKRHLLLGRKAMTNLDSYIKKQ---RHHSVDKVKA 115

Query: 120 IVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           ++  V+++GC++    K    +  VF   C R +LR+ W
Sbjct: 116 MIFPVVMYGCKS-NHKKAECRKTDVFELWCWRRLLRVPW 153


>UniRef50_Q8W2Y2 Cluster: Putative reverse transcriptase; n=1; Oryza
           sativa (japonica cultivar-group)|Rep: Putative reverse
           transcriptase - Oryza sativa subsp. japonica (Rice)
          Length = 581

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 2/73 (2%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI- 531
           L+++G  ++    +  +   ST RV+ +   G+PI+   G++QG  LSPLLFI+ +D + 
Sbjct: 124 LQRKGFTSRWTNWVSNILASSTTRVLLNGCPGSPIKHGRGLRQGDPLSPLLFILAIDPLH 183

Query: 530 -MREVVTTLGALN 495
            + E  T LG ++
Sbjct: 184 HLLEKATKLGHMS 196


>UniRef50_UPI0000D578AF Cluster: PREDICTED: similar to RNA-directed
            DNA polymerase from mobile element jockey (Reverse
            transcriptase); n=7; Tribolium castaneum|Rep: PREDICTED:
            similar to RNA-directed DNA polymerase from mobile
            element jockey (Reverse transcriptase) - Tribolium
            castaneum
          Length = 1336

 Score = 42.3 bits (95), Expect = 0.014
 Identities = 24/67 (35%), Positives = 38/67 (56%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L Q GIP  ++ +I++   G   +V  +  +  P ++ AGV QG +LSPLL+ +   DI 
Sbjct: 1076 LHQTGIPLAMVQMIRSFLVGRRFQVRINNSVSDPQDLEAGVPQGSVLSPLLYSIFTHDIP 1135

Query: 527  REVVTTL 507
            +   TTL
Sbjct: 1136 KTDRTTL 1142


>UniRef50_Q76IK9 Cluster: Pol-like protein; n=8; Clupeocephala|Rep:
           Pol-like protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1148

 Score = 41.9 bits (94), Expect = 0.019
 Identities = 16/59 (27%), Positives = 35/59 (59%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L++ G P + +  +  LY     +++ +  L   + + +GV+QGC LSPLL+++ ++ +
Sbjct: 613 LEKMGFPGRFLAWVGLLYNDLVSKIIVNGHLTKAVNICSGVRQGCPLSPLLYVVCIEPL 671


>UniRef50_Q64IZ3 Cluster: Reverse transcriptase; n=6;
           Cyprinodontiformes|Rep: Reverse transcriptase - Fundulus
           heteroclitus (Killifish) (Mummichog)
          Length = 128

 Score = 41.1 bits (92), Expect = 0.033
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L++ G    II  IQ+LY+  T R+  +  +G    +  G  QGC LSP LF + ++ +
Sbjct: 11  LERMGFNEPIIRCIQSLYKEPTARIKMNGHVGGSFNLFRGTWQGCCLSPSLFAIYIEPL 69


>UniRef50_Q76IP0 Cluster: Reverse transcriptase; n=1; Ciona
           intestinalis|Rep: Reverse transcriptase - Ciona
           intestinalis (Transparent sea squirt)
          Length = 1104

 Score = 41.1 bits (92), Expect = 0.033
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G+P  +I  I  LY   + ++  +  +  PIE+  GV+QG  LSPLLF  ++D  + E+ 
Sbjct: 544 GLPPPLITYISNLYPNCSTKLKVNGKISKPIEVRRGVRQGDPLSPLLFNAVMDWALSELD 603

Query: 515 TTLGALNG 492
             +G   G
Sbjct: 604 PRVGVQIG 611


>UniRef50_Q5BT30 Cluster: SJCHGC02932 protein; n=1; Schistosoma
          japonicum|Rep: SJCHGC02932 protein - Schistosoma
          japonicum (Blood fluke)
          Length = 63

 Score = 41.1 bits (92), Expect = 0.033
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = -3

Query: 84 WRVTKTLTNRLQVFVNKCLRSILRIFWP 1
          WR T  +  R+Q F+N CLR IL + WP
Sbjct: 2  WRTTSNILRRVQAFINNCLRKILNVRWP 29


>UniRef50_Q4QQE6 Cluster: Endonuclease-reverse transcriptase; n=2;
           Schistosoma|Rep: Endonuclease-reverse transcriptase -
           Schistosoma mansoni (Blood fluke)
          Length = 831

 Score = 41.1 bits (92), Expect = 0.033
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L+  GI N +     +  +G    V ++  L  P  +T+GV QG +L PLLF+M ++DI
Sbjct: 582 LRSFGINNPLYSWFVSFLKGRKQMVNYNDCLSLPRPITSGVIQGSVLGPLLFLMYINDI 640


>UniRef50_A0NG79 Cluster: ENSANGP00000027469; n=2; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000027469 - Anopheles gambiae
           str. PEST
          Length = 371

 Score = 41.1 bits (92), Expect = 0.033
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV- 519
           GIP K+I +++      TC+V  D  L  P   T G++QG  L+ LLF + L+  +R+  
Sbjct: 171 GIPAKLIRLVRMTMTNVTCQVRVDGKLSGPFATTKGLRQGNGLACLLFNLTLERAIRDSR 230

Query: 518 VTTLGAL 498
           V T G +
Sbjct: 231 VETTGTI 237


>UniRef50_UPI00015B43B0 Cluster: PREDICTED: similar to reverse
            transcriptase homolog, partial; n=1; Nasonia
            vitripennis|Rep: PREDICTED: similar to reverse
            transcriptase homolog, partial - Nasonia vitripennis
          Length = 1316

 Score = 40.7 bits (91), Expect = 0.044
 Identities = 18/72 (25%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = -3

Query: 225  IEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETW-RVTKTLTNRLQ 49
            ++I++ KAR AF  L  ++ +  +  + K+  +  +++ +L + C  W   + +   R++
Sbjct: 977  LDIQLVKARKAFRSLSKLFYNKYLEPKAKIICYCLLIRPILSYACPLWYNQSASSMERIR 1036

Query: 48   VFVNKCLRSILR 13
            VF   CLR+ L+
Sbjct: 1037 VFERACLRACLK 1048


>UniRef50_UPI0000E46857 Cluster: PREDICTED: similar to bcnt,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to bcnt, partial - Strongylocentrotus
           purpuratus
          Length = 434

 Score = 40.7 bits (91), Expect = 0.044
 Identities = 20/53 (37%), Positives = 33/53 (62%)
 Frame = -1

Query: 686 NKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +K+I ++QALY  S   V  +  L    + T G++QGC +SP LF +L++ +M
Sbjct: 332 SKLIRLLQALYEQSQSTVRVNGELTEWFKTTVGIRQGCAISPQLFNILIELVM 384


>UniRef50_Q76IN6 Cluster: Reverse transcriptase; n=5;
           Rasborinae|Rep: Reverse transcriptase - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 1193

 Score = 40.7 bits (91), Expect = 0.044
 Identities = 22/66 (33%), Positives = 36/66 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+Q  +   ++ +I+ +Y  S   V   +  G  I +  GVKQG  LSPLLF + LD ++
Sbjct: 612 LEQMNVDPHMVNLIREIYTNSCTSVELGRKEGPDIPVRVGVKQGDPLSPLLFNLALDPLI 671

Query: 527 REVVTT 510
           + +  T
Sbjct: 672 QSLERT 677


>UniRef50_Q60UL0 Cluster: Putative uncharacterized protein CBG19937;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG19937 - Caenorhabditis
           briggsae
          Length = 152

 Score = 40.7 bits (91), Expect = 0.044
 Identities = 19/46 (41%), Positives = 31/46 (67%)
 Frame = -1

Query: 659 LYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           +YRG++ RV        PI++ +GVKQG  +SP LF M L++++R+
Sbjct: 1   MYRGASIRVKDRSEKTDPIQIKSGVKQGDPISPTLFNMCLENVIRK 46


>UniRef50_P16423 Cluster: Retrovirus-related Pol polyprotein from
           type-2 retrotransposable element R2DM
           (Retrovirus-related Pol polyprotein from type II
           retrotransposable element R2DM) [Includes: Protease (EC
           3.4.23.-); Reverse transcriptase (EC 2.7.7.49);
           Endonuclease]; n=26; Drosophila|Rep: Retrovirus-related
           Pol polyprotein from type-2 retrotransposable element
           R2DM (Retrovirus-related Pol polyprotein from type II
           retrotransposable element R2DM) [Includes: Protease (EC
           3.4.23.-); Reverse transcriptase (EC 2.7.7.49);
           Endonuclease] - Drosophila melanogaster (Fruit fly)
          Length = 1057

 Score = 40.7 bits (91), Expect = 0.044
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G P   +  +Q  Y G    +  D           GVKQG  LSP+LF +++D ++
Sbjct: 499 LRAYGAPKGFVDYVQNTYEGGGTSLNGDGWSSEEFVPARGVKQGDPLSPILFNLVMDRLL 558

Query: 527 REVVTTLGALNGAKIS 480
           R + + +GA  G  I+
Sbjct: 559 RTLPSEIGAKVGNAIT 574


>UniRef50_UPI0000E47148 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 810

 Score = 40.3 bits (90), Expect = 0.058
 Identities = 25/87 (28%), Positives = 44/87 (50%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+  T+      G  +   GI +     I+      T RVV D      I++ +G
Sbjct: 456 ILDFSKAFDTVPHQRLLGK-IDHYGIRDNTKNWIKTWLTARTQRVVVDGAASETIDVESG 514

Query: 587 VKQGCLLSPLLFIMLLDDIMREVVTTL 507
           V QG +L PL+F++ ++DI  ++ +T+
Sbjct: 515 VPQGTVLGPLMFLLYINDIGEDISSTI 541


>UniRef50_UPI0000D57951 Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase); n=2; Tribolium castaneum|Rep: PREDICTED:
           similar to RNA-directed DNA polymerase from mobile
           element jockey (Reverse transcriptase) - Tribolium
           castaneum
          Length = 971

 Score = 40.3 bits (90), Expect = 0.058
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           LKQ    +++  +I +     T +V     L  PI + AGV QG +LSPLL+++   DI
Sbjct: 625 LKQLHFSDQLTQLIHSFLSHRTLKVREGNELSNPISINAGVPQGSVLSPLLYLIYCHDI 683


>UniRef50_UPI0000D578A9 Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to RNA-directed DNA polymerase from mobile
           element jockey (Reverse transcriptase) - Tribolium
           castaneum
          Length = 894

 Score = 40.3 bits (90), Expect = 0.058
 Identities = 24/67 (35%), Positives = 37/67 (55%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L Q GIP  ++ +I++   G   +V  +  +  P E+ A V QG +LSPLL+ +   DI 
Sbjct: 799 LHQTGIPLAMVQMIRSFLDGRRFQVRINNSVSDPQELVALVPQGSVLSPLLYSIFTHDIP 858

Query: 527 REVVTTL 507
           +   TTL
Sbjct: 859 KTDRTTL 865


>UniRef50_Q4QQD8 Cluster: Polyprotein; n=1; Schistosoma mansoni|Rep:
           Polyprotein - Schistosoma mansoni (Blood fluke)
          Length = 1144

 Score = 40.3 bits (90), Expect = 0.058
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = -1

Query: 704 KQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           K+ G P  +   +   YR ST  V   +     +  T GVKQG  LSPLLFIM+LD+++
Sbjct: 595 KRYGAPELLCRYLNNYYRRSTSCVNRTE-----LHPTCGVKQGDPLSPLLFIMVLDEVL 648



 Score = 33.5 bits (73), Expect = 6.7
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMS 331
           L  + YADD+V+  P  + +Q KL+ + I   + G  +N  K+  + ++S
Sbjct: 664 LNYIAYADDLVVFAPNAELLQRKLDRISILLHEAGWSVNPEKSRTLDLIS 713


>UniRef50_Q2WBW5 Cluster: Putative origin recognition complex
           subunit 3 protein; n=1; Platynereis dumerilii|Rep:
           Putative origin recognition complex subunit 3 protein -
           Platynereis dumerilii (Dumeril's clam worm)
          Length = 966

 Score = 40.3 bits (90), Expect = 0.058
 Identities = 42/173 (24%), Positives = 77/173 (44%), Gaps = 7/173 (4%)
 Frame = -3

Query: 516 DNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
           D ++GI   +NI+  L YADD+VL + +   +Q  +  L     K  L ++ NKT ++ V
Sbjct: 55  DVSQGITIGDNIVTHLLYADDMVLCSESAKGLQILINGLYTFCTKWHLILSINKT-NVMV 113

Query: 336 MSKNTTPLKLQ-DCGFE---VSTEVYISGELLSNQGGS-DEDIEIRIRKARGAFAQLKPV 172
             K    +  Q   G +   ++      G + S++G     ++     KAR A   L   
Sbjct: 114 FRKKREIVNFQFKYGVDEIAITDNYKYLGVIFSSRGAMFKNNVSHLNEKARNAEFALSTH 173

Query: 171 WESSV--MTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSI 19
            + SV  +   +   +FD  +  +L +G E W   K L    ++ ++   R++
Sbjct: 174 VKCSVGYLQPVLAFKMFDVQISPILEYGSEVWFNNKELAEFEKIHLSYMKRTL 226



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 20/66 (30%), Positives = 33/66 (50%)
 Frame = -1

Query: 680 IIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTLGA 501
           ++ ++  +Y  + CRV     +G  IE   GV QG ++SP LF   L D+ + +  + G 
Sbjct: 1   MLKLLMDMYAKAKCRVKWKGKVGKEIESEYGVLQGGIMSPNLFTEYLTDLNKYLDVSQGI 60

Query: 500 LNGAKI 483
             G  I
Sbjct: 61  TIGDNI 66


>UniRef50_UPI0000E46BAD Cluster: PREDICTED: similar to ReO_6; n=3;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           ReO_6 - Strongylocentrotus purpuratus
          Length = 1194

 Score = 39.9 bits (89), Expect = 0.077
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = -1

Query: 617 LGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           L +   MTAGV QG  L PLLF++L+DD +RE
Sbjct: 723 LSSTRSMTAGVPQGTRLGPLLFLVLIDDALRE 754


>UniRef50_UPI0000F32C97 Cluster: UPI0000F32C97 related cluster; n=6;
           Bos taurus|Rep: UPI0000F32C97 UniRef100 entry - Bos
           Taurus
          Length = 265

 Score = 39.9 bits (89), Expect = 0.077
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           N G      GI+ +E  + +L YADD  LM  + +++++ L  ++  +EK GL++N  K
Sbjct: 175 NTGLEGAPAGIKIAERHINNLKYADDTTLMAESEEELKSLLMKVKEDSEKAGLKLNIQK 233



 Score = 39.5 bits (88), Expect = 0.10
 Identities = 25/75 (33%), Positives = 37/75 (49%)
 Frame = -1

Query: 704 KQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           K+ GIP+ +  +++ LY G    V          ++  GV+QGC+L P LF    + IMR
Sbjct: 115 KEMGIPDHLTCLLRNLYAGQEATVRTGHGTTDWFQIGKGVRQGCILLPYLFNFYAEYIMR 174

Query: 524 EVVTTLGALNGAKIS 480
                 GA  G KI+
Sbjct: 175 NTGLE-GAPAGIKIA 188


>UniRef50_Q0IR74 Cluster: Os11g0670100 protein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: Os11g0670100 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 2121

 Score = 39.9 bits (89), Expect = 0.077
 Identities = 23/61 (37%), Positives = 34/61 (55%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L  RG PN  I  I++L + S   V+ + + G  I    G++QG  LSP LFI++ D + 
Sbjct: 1842 LAVRGFPNNWISWIKSLLQTSKSAVLLNGIPGKWINCKKGLRQGDPLSPYLFILVADVLQ 1901

Query: 527  R 525
            R
Sbjct: 1902 R 1902


>UniRef50_Q2HED9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 500

 Score = 39.9 bits (89), Expect = 0.077
 Identities = 18/70 (25%), Positives = 36/70 (51%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ G+P   +  +     G + ++  D  +    E+ AGV QG  LSP+LF++ +  + 
Sbjct: 64  LRELGVPLWTLRWVDLFTAGRSAKLWFDGTMSESYEVAAGVPQGSPLSPILFLLFISTLY 123

Query: 527 REVVTTLGAL 498
           + +    GA+
Sbjct: 124 KRLEAVRGAI 133


>UniRef50_Q2H1R0 Cluster: Putative uncharacterized protein; n=5;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1554

 Score = 39.9 bits (89), Expect = 0.077
 Identities = 18/70 (25%), Positives = 37/70 (52%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L++ G+P   +  + +   G + ++  D  +    E+ AGV QG  LSP+LF++ +  + 
Sbjct: 1035 LRELGVPLWTLRWVDSFTDGRSAKLWFDGTMSERYEVAAGVPQGSPLSPILFLLFISTLY 1094

Query: 527  REVVTTLGAL 498
            + +    GA+
Sbjct: 1095 KRLEAVRGAI 1104


>UniRef50_Q76IM1 Cluster: Pol-like protein; n=2; Clupeocephala|Rep:
           Pol-like protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1329

 Score = 39.5 bits (88), Expect = 0.10
 Identities = 17/67 (25%), Positives = 38/67 (56%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G  N+ + +++ALY      +  +  L AP ++  G++QGC LS +L+ + ++ ++ ++ 
Sbjct: 650 GFNNEFVSMLKALYNDVESVLKFNGNLCAPFKVFRGIRQGCALSGMLYTLAIEPLLIKIR 709

Query: 515 TTLGALN 495
             L  L+
Sbjct: 710 AKLSGLS 716


>UniRef50_Q2QYF0 Cluster: Retrotransposon protein, putative,
           unclassified; n=6; Oryza sativa|Rep: Retrotransposon
           protein, putative, unclassified - Oryza sativa subsp.
           japonica (Rice)
          Length = 1407

 Score = 39.5 bits (88), Expect = 0.10
 Identities = 23/61 (37%), Positives = 33/61 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L  RG P+  IG I  L   S   V+ + + G+ I    G++QG  LSP LFI++ D + 
Sbjct: 293 LAVRGFPDNWIGWINKLLTSSKSLVLINGIPGSWINCRRGLRQGDPLSPYLFILVADVLQ 352

Query: 527 R 525
           R
Sbjct: 353 R 353


>UniRef50_Q01379 Cluster: Contains reverse transcriptase and cys
           finger domains; ORF2; n=2; Neurospora crassa|Rep:
           Contains reverse transcriptase and cys finger domains;
           ORF2 - Neurospora crassa
          Length = 1154

 Score = 39.5 bits (88), Expect = 0.10
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = -1

Query: 692 IPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVT 513
           +P  II  + +   G    +  D     P  +TAGV QG  LSP+LFI+ +  + R++ T
Sbjct: 614 LPTWIIRWVASFVAGRRGSLFFDDETSRPYAITAGVPQGSPLSPILFILFITPLYRKLAT 673


>UniRef50_A2X084 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 317

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 20/83 (24%), Positives = 46/83 (55%)
 Frame = -1

Query: 704 KQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           ++ GI    + +I+A+Y   T  ++ +        +T+G++QG LLSPLLF ++L +++ 
Sbjct: 180 RKMGITGTYLNMIKAIYDKPTANIILNGEKLKEFLLTSGMRQGSLLSPLLFNIVL-EVLA 238

Query: 524 EVVTTLGALNGAKISWKTLTMQM 456
             +  +  + G +I  + + + +
Sbjct: 239 MAIREVKEITGIQIGKEEVKLSL 261


>UniRef50_UPI0000F31248 Cluster: UPI0000F31248 related cluster; n=2;
           Bos taurus|Rep: UPI0000F31248 UniRef100 entry - Bos
           Taurus
          Length = 313

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G+P+ +I +++ LY G    V          ++  GV+QGC+LSP LF    + I+R+
Sbjct: 2   GLPDHLICLLRNLYAGQEATVRTGHGTTDWFQIRKGVRQGCILSPCLFNFYAEYIIRD 59


>UniRef50_Q76IM5 Cluster: Pol-like protein; n=1; Tetraodon
           nigroviridis|Rep: Pol-like protein - Tetraodon
           nigroviridis (Green puffer)
          Length = 1318

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 2/69 (2%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRG--STCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDD 534
           +++ G     I  IQALY G  S  ++  +  L AP     GV+QGC LS +L+ + L+ 
Sbjct: 635 MERFGFRTSFIAKIQALYGGIESVLKLSFNGSLCAPFRACRGVRQGCALSGMLYALSLEP 694

Query: 533 IMREVVTTL 507
           ++ ++ +++
Sbjct: 695 LLCKIRSSI 703


>UniRef50_O64463 Cluster: Gene, , similar to reverse transcriptase
           genes of various retrotransposons; n=1; Chlorella
           vulgaris|Rep: Gene, , similar to reverse transcriptase
           genes of various retrotransposons - Chlorella vulgaris
           (Green alga)
          Length = 191

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 6/137 (4%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCG 295
           DL YADD  L+  T   +Q  ++      E+ G+ I+ +KT  +   S    P +   CG
Sbjct: 36  DLGYADDFALLATTPAHLQRLIDAAAEFCEQTGMVISVDKTKIVVFSSSLPGPFQWL-CG 94

Query: 294 FE----VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWES--SVMTRRIKLT 133
                 V    Y+       QG +    ++  R   GA+AQL+  +      M+  + L 
Sbjct: 95  GAPLHWVQQFEYLGAPFDGAQGINLTFGKLH-RNMWGAWAQLRQQYGKLHCSMSAGLLLR 153

Query: 132 LFDSIVKSVLLFGCETW 82
           L+D+ V     +GCE W
Sbjct: 154 LYDACVPPTASYGCEVW 170


>UniRef50_A5B1W4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 594

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 5/163 (3%)
 Frame = -3

Query: 522 SGDNTRGIEWSENILEDLDYADD-IVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVD 346
           SG   RG    E I+  L +ADD I+      +Q+ A    L       GLRIN +K++ 
Sbjct: 131 SGCRIRGRGEEEMIVSHLLFADDTIIFCEARKEQLSALSWILAWFEAASGLRINLDKSII 190

Query: 345 MRVMSKNTTPLKLQDCGFEVST--EVYISGELLSNQGGSD--EDIEIRIRKARGAFAQLK 178
           + V           + G +V     VY+   L ++       + +E R+RK     AQ  
Sbjct: 191 IPVGEVEDIEEMAVELGCKVGLLPTVYLGLPLGAHHKAVFMWDGVEERMRKR---LAQ-- 245

Query: 177 PVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQ 49
             WE   +++  ++TL  S + S+ ++    +R+ K++ NRL+
Sbjct: 246 --WERQYISKGGRITLIKSTMASLPIYNMSLFRMPKSVANRLE 286


>UniRef50_A4PSD6 Cluster: RNA-directed DNA polymerase (Reverse
           transcriptase); Ribonuclease H; n=6; Medicago
           truncatula|Rep: RNA-directed DNA polymerase (Reverse
           transcriptase); Ribonuclease H - Medicago truncatula
           (Barrel medic)
          Length = 869

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 21/60 (35%), Positives = 33/60 (55%)
 Frame = -1

Query: 710 CLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           CL+  G P+  I +I      ST  V+ +     PI+ T G++QG  LSP LFI+ ++ +
Sbjct: 154 CLQDFGFPDDTIKLIMHCVTSSTFSVLWNGNKWPPIKPTHGLRQGDPLSPYLFIICMEKL 213


>UniRef50_Q8I7P8 Cluster: ORF1; n=2; Drosophila melanogaster|Rep: ORF1
            - Drosophila melanogaster (Fruit fly)
          Length = 884

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 9/147 (6%)
 Frame = -3

Query: 423  MQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTP-------LKLQDCGFEVSTEVYIS 265
            MQ+ L +L I  +K  ++IN NKT +    +K   P       L++ D   +    +   
Sbjct: 715  MQSYLNELDIYYKKWKIKINPNKT-NAIFFTKRRKPRYLPDRQLRILDSPIQWVDNIRYL 773

Query: 264  GELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
            G +   +      I   I K       L P +   S ++   K+ +F +I   +L++G  
Sbjct: 774  GIIFDKKLTFKYHINNTIMKVNKIICTLYPLINRKSKLSISNKIIIFKTIFNPILMYGSP 833

Query: 87   TW-RVTKTLTNRLQVFVNKCLRSILRI 10
             W R  +T   +LQ+  NK L+ I+ +
Sbjct: 834  VWGRCAQTHIKKLQICQNKLLKLIMNL 860


>UniRef50_Q76IP1 Cluster: Reverse transcriptase; n=1; Ciona
           intestinalis|Rep: Reverse transcriptase - Ciona
           intestinalis (Transparent sea squirt)
          Length = 998

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 18/60 (30%), Positives = 34/60 (56%)
 Frame = -3

Query: 516 DNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRV 337
           D + G+   E  +  L +ADDIVL++ +   +Q  ++ L     + GLR+N+ K+  +R+
Sbjct: 502 DQSFGVTVGEARVNHLAFADDIVLLSSSQPGLQRLIDQLTTHLGESGLRVNSTKSASIRI 561



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 21/72 (29%), Positives = 36/72 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +K+ G+P  ++  ++ LY  S   +     L   I++  GVKQG  LSP LF  ++D  +
Sbjct: 439 VKRLGVPPPLLKYVEELYADSETFLRGSGELSPSIKVRRGVKQGEPLSPHLFNAVIDWAL 498

Query: 527 REVVTTLGALNG 492
             +  + G   G
Sbjct: 499 SSLDQSFGVTVG 510


>UniRef50_Q76IN9 Cluster: Reverse transcriptase; n=1; Ciona
           intestinalis|Rep: Reverse transcriptase - Ciona
           intestinalis (Transparent sea squirt)
          Length = 779

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 21/70 (30%), Positives = 37/70 (52%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G+P  ++  I+ LY GS+  ++ +      I +  G+KQG  LS  LF+ ++D  M  + 
Sbjct: 254 GVPPPLLKYIENLYEGSSTTIIANGERSPRIRVRRGIKQGDPLSIPLFLGVMDWAMSNLN 313

Query: 515 TTLGALNGAK 486
             +G+  G K
Sbjct: 314 PNVGSSIGGK 323


>UniRef50_Q76IK6 Cluster: Pol-like protein; n=1; Ciona
           intestinalis|Rep: Pol-like protein - Ciona intestinalis
           (Transparent sea squirt)
          Length = 1239

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 20/63 (31%), Positives = 35/63 (55%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           LK  G  ++II  I+ +Y    C V ++  +    ++  GV+QG  LSP LF+M ++ + 
Sbjct: 633 LKAFGFGSRIIKWIRTVYDAPKCAVTNNGYVSKYFDIRRGVRQGDPLSPTLFVMAIEMLA 692

Query: 527 REV 519
            E+
Sbjct: 693 IEL 695


>UniRef50_O46180 Cluster: Non-LTR retrotransposon reverse
           transcriptase; n=2; Drosophila subobscura|Rep: Non-LTR
           retrotransposon reverse transcriptase - Drosophila
           subobscura (Fruit fly)
          Length = 467

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 11/139 (7%)
 Frame = -3

Query: 465 YADDIVLM-----TPTL-DQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSK----NTTP 316
           YADD+ ++       TL + M AKL  L    + RGL IN +KT  +   +K    +  P
Sbjct: 302 YADDVAIIFSGKFPQTLCELMTAKLARLSEWTKSRGLGINPSKTELVLFTTKYKIPSLNP 361

Query: 315 LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGA-FAQLKPVWESSVMTRRIK 139
             L  C    S      G ++  +   +  I+ R++KA  A +   K +     M  RI 
Sbjct: 362 PILNGCRLSFSDSASYLGLVIDKKLSWNLSIKDRVKKATIALYTCKKAIGLKWGMNPRIV 421

Query: 138 LTLFDSIVKSVLLFGCETW 82
             ++ +IV+ +LL+G   W
Sbjct: 422 QWIYLAIVRPILLYGVAVW 440


>UniRef50_O15639 Cluster: Multifunctional protein; n=55;
           Dictyostelium discoideum|Rep: Multifunctional protein -
           Dictyostelium discoideum (Slime mold)
          Length = 1260

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = -1

Query: 686 NKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           N+ I +I  L   S  R+  +     P E+  GVKQG  LSP LF+++++ + R+++
Sbjct: 655 NQYINLIMNLLTKSEARIEINGRTTIPFEIKRGVKQGDPLSPTLFVLVIEALARKIL 711


>UniRef50_Q6UV17 Cluster: Endonuclease and reverse
           transcriptase-like protein; n=25; Arthropoda|Rep:
           Endonuclease and reverse transcriptase-like protein -
           Bombyx mori (Silk moth)
          Length = 986

 Score = 38.3 bits (85), Expect = 0.23
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L   GIP  +   I +   G +  VV D      + + AGV QG +LSP LFI+ ++D++
Sbjct: 624 LPSYGIPEGLCKWIASFLDGRSITVVVDGDCSDTMTINAGVPQGSVLSPTLFILYINDML 683


>UniRef50_Q2GUS1 Cluster: Putative uncharacterized protein; n=10;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1559

 Score = 38.3 bits (85), Expect = 0.23
 Identities = 19/63 (30%), Positives = 33/63 (52%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L++ G P  ++   +    G    ++ D    AP  + AGV QG  LSP+LFI+ +  + 
Sbjct: 1048 LREMGFPRWLVLWTRDWLTGREATLLFDGKTAAPTAIRAGVPQGSPLSPVLFILYISSLY 1107

Query: 527  REV 519
            R++
Sbjct: 1108 RQL 1110


>UniRef50_UPI0000E4A8F6 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=5;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 736

 Score = 37.9 bits (84), Expect = 0.31
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = -1

Query: 704 KQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           K  GI    +  I+    G T +V+ +  L +  ++T+G+ QG +L PLLF++ ++D+
Sbjct: 139 KHCGIHGLTLQWIENFLTGRTQQVILEGQLSSEAKVTSGIPQGSVLGPLLFLIYINDL 196


>UniRef50_Q76IL7 Cluster: Pol-like protein; n=3; Danio rerio|Rep:
           Pol-like protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1284

 Score = 37.9 bits (84), Expect = 0.31
 Identities = 25/82 (30%), Positives = 40/82 (48%)
 Frame = -1

Query: 776 FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEM 597
           FL  L FEK+   +      G  LK  G     I  +Q LYRG+  R+  +  L    ++
Sbjct: 603 FLISLDFEKAFDRVEHDFLFG-VLKSFGFGENFIKWVQILYRGAVTRIKCNGFLTDCFKI 661

Query: 596 TAGVKQGCLLSPLLFIMLLDDI 531
              ++QGC LS LL+ ++ + +
Sbjct: 662 RRSIRQGCPLSALLYALVAEPL 683



 Score = 34.3 bits (75), Expect = 3.8
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = -3

Query: 516 DNTRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR 340
           D  +GIE    + +   YADD  L+   L  ++  +E ++   +  G +IN NKT  +R
Sbjct: 691 DRIKGIEVEGGVNKIFQYADDTTLILQDLASVKQAMETVQHFCKGSGAKINENKTGYLR 749


>UniRef50_Q4SVV7 Cluster: Chromosome undetermined SCAF13717, whole
            genome shotgun sequence; n=6; root|Rep: Chromosome
            undetermined SCAF13717, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 5257

 Score = 37.9 bits (84), Expect = 0.31
 Identities = 14/47 (29%), Positives = 32/47 (68%)
 Frame = -3

Query: 465  YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN 325
            + DDI +   +  Q++ KLE+ R + ++RG++++ +KT  MR++ ++
Sbjct: 1262 FTDDIAICRESWTQVEEKLEERRFALKRRGMKVSRSKTEYMRMIERD 1308


>UniRef50_Q2QLN0 Cluster: Retrotransposon protein, putative, LINE
           subclass; n=4; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           LINE subclass - Oryza sativa subsp. japonica (Rice)
          Length = 318

 Score = 37.9 bits (84), Expect = 0.31
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L+++G  ++    +  +   ST R++ +  LG PI+   G +Q   LSPLLFI+ +D +
Sbjct: 124 LQRKGFTSRWTNWVSNILASSTTRILLNGCLGTPIKHGRGRRQEDPLSPLLFILAIDPL 182


>UniRef50_P11369 Cluster: Retrovirus-related Pol polyprotein LINE-1
           (Long interspersed element- 1) (L1) [Includes: Reverse
           transcriptase (EC 2.7.7.49); Endonuclease]; n=566;
           cellular organisms|Rep: Retrovirus-related Pol
           polyprotein LINE-1 (Long interspersed element- 1) (L1)
           [Includes: Reverse transcriptase (EC 2.7.7.49);
           Endonuclease] - Mus musculus (Mouse)
          Length = 1281

 Score = 37.9 bits (84), Expect = 0.31
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRV-VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L++ GI    + +I+A+Y      + V+ + L A I + +G +QGC LSP LF ++L+ +
Sbjct: 624 LERSGIQGPYLNMIKAIYSKPVANIKVNGEKLEA-IPLKSGTRQGCPLSPYLFNIVLEVL 682

Query: 530 MREV 519
            R +
Sbjct: 683 ARAI 686


>UniRef50_Q64IV5 Cluster: Reverse transcriptase; n=2; Kryptolebias
           marmoratus|Rep: Reverse transcriptase - Rivulus
           marmoratus (Mangrove rivulus) (Kryptolebias marmoratus)
          Length = 121

 Score = 37.5 bits (83), Expect = 0.41
 Identities = 14/50 (28%), Positives = 29/50 (58%)
 Frame = -1

Query: 686 NKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           N  +  ++ LY   +  ++ ++ +   I++  G +QGC LSPLLF + ++
Sbjct: 18  NNFVKWVKILYNNPSAEIITNKNISRSIKINRGCRQGCPLSPLLFTLAIE 67


>UniRef50_Q0DC48 Cluster: Os06g0484800 protein; n=6; Oryza sativa|Rep:
            Os06g0484800 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 1661

 Score = 37.5 bits (83), Expect = 0.41
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRV-VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
            L+++G  +  I ++ +    S+  V ++ Q  GA      G++QGC LSP LF   L+++
Sbjct: 1139 LQRKGFHHHFINLVLSCINSSSFSVNINGQTYGA-FNANRGIRQGCPLSPYLFCFALNEL 1197

Query: 530  MREVVTTL--GALNGAKIS 480
              ++   L    +NG K+S
Sbjct: 1198 SDQLNEALQNHNINGIKLS 1216


>UniRef50_Q01N39 Cluster: H0215A08.3 protein; n=9; Oryza sativa|Rep:
           H0215A08.3 protein - Oryza sativa (Rice)
          Length = 1186

 Score = 37.5 bits (83), Expect = 0.41
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           LK +G  ++    +  L+R +T RV+ +   G  I    GV+QG  +SP++FI+ +D
Sbjct: 602 LKHKGFGDRWCAWVAMLFRTATTRVLINGNPGNEIHHRRGVRQGDPISPMIFILAMD 658


>UniRef50_UPI0000D576CB Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to RNA-directed DNA polymerase from mobile
           element jockey (Reverse transcriptase) - Tribolium
           castaneum
          Length = 494

 Score = 37.1 bits (82), Expect = 0.54
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = -1

Query: 683 KIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTL 507
           KI+ +IQ+     + +V  +  L +  ++TAGV QG +LSP L+ +   D+ +   T L
Sbjct: 211 KIVQLIQSFLHNRSFQVCFENHLSSVRQITAGVPQGSVLSPTLYNIYTHDVPKHPKTDL 269


>UniRef50_Q8LJX1 Cluster: Putative reverse transcriptase; n=1; Sorghum
            bicolor|Rep: Putative reverse transcriptase - Sorghum
            bicolor (Sorghum) (Sorghum vulgare)
          Length = 1998

 Score = 37.1 bits (82), Expect = 0.54
 Identities = 18/57 (31%), Positives = 31/57 (54%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
            +K +G   K +  +++++   T  V+ +   G  I    GV+QG  LSPLLF++  D
Sbjct: 1404 MKAKGFGQKWLNWMKSIFTSGTSNVLLNGTPGKTIHCLRGVRQGDPLSPLLFVLAAD 1460


>UniRef50_Q7XWB0 Cluster: OSJNBa0061A09.16 protein; n=3; Oryza
           sativa (japonica cultivar-group)|Rep: OSJNBa0061A09.16
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 764

 Score = 37.1 bits (82), Expect = 0.54
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = -1

Query: 764 LTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGV 585
           L FEK+  T+         ++Q+G  +K +  I  ++  ++  V+ + V G       GV
Sbjct: 609 LDFEKAFDTIEHSTILD-IMRQKGFDSKWLNWIDLIFSSASSSVLLNGVPGRNFYCKRGV 667

Query: 584 KQGCLLSPLLFIMLLDDIMREVV 516
           +QG  LSPLLF+ L  D+++ VV
Sbjct: 668 RQGDPLSPLLFV-LGADLLQSVV 689


>UniRef50_UPI0000E4A5CE Cluster: PREDICTED: similar to
           Gamma-glutamyltranspeptidase 1 precursor
           (Gamma-glutamyltransferase 1) (GGT 1) (CD224 antigen);
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Gamma-glutamyltranspeptidase 1 precursor
           (Gamma-glutamyltransferase 1) (GGT 1) (CD224 antigen) -
           Strongylocentrotus purpuratus
          Length = 625

 Score = 36.7 bits (81), Expect = 0.72
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           GI  K+   I+AL    T RV  D    +   +T+G+ QG +L P+LF++ ++D+
Sbjct: 437 GIQGKLSKWIKALLTCKTQRVRVDGAYSSWKNVTSGIPQGSVLGPILFLIYINDL 491


>UniRef50_UPI0000E483B1 Cluster: PREDICTED: similar to
           endonuclease-reverse transcriptase; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease-reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 483

 Score = 36.7 bits (81), Expect = 0.72
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           GI  K+   I+AL    T RV  D    +   +T+G+ QG +L P+LF++ ++D+
Sbjct: 263 GIQGKLSKWIKALLTCKTQRVRVDGAYSSWKNVTSGIPQGSVLGPILFLIYINDL 317


>UniRef50_UPI00005A16F9 Cluster: PREDICTED: similar to reverse
           transcriptase; n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to reverse transcriptase - Canis
           familiaris
          Length = 727

 Score = 36.7 bits (81), Expect = 0.72
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLL 540
           L+  GI    +  ++A+Y   T  ++ + + LGA   + +G +QGC LSP LF ++L
Sbjct: 151 LQSVGIEGTFLNTLKAIYEKPTANIILNGETLGA-FPLRSGTRQGCPLSPQLFNIVL 206


>UniRef50_Q6QI57 Cluster: LRRGT00151; n=3; Rattus norvegicus|Rep:
           LRRGT00151 - Rattus norvegicus (Rat)
          Length = 1073

 Score = 36.7 bits (81), Expect = 0.72
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRV-VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L++ GI    + I++A+Y      + ++ + L A I + +G +QGC LSP LF ++L+ +
Sbjct: 82  LERIGIQGPYLNIVKAIYSKPVANIKLNGEKLEA-IPLKSGTRQGCPLSPYLFNIVLEVL 140

Query: 530 MREV 519
            R +
Sbjct: 141 ARAI 144


>UniRef50_A6RCU0 Cluster: Predicted protein; n=8; Ajellomyces
            capsulatus NAm1|Rep: Predicted protein - Ajellomyces
            capsulatus NAm1
          Length = 1838

 Score = 36.7 bits (81), Expect = 0.72
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L++R +  +I+G + +  R  T  +   +    P+ +  G+ QG  +SP+L++    DI+
Sbjct: 1160 LRKRRMDERIVGWVASFLRNRTTTIQLRECTTEPLHVETGIPQGSPISPVLYLFYNADIL 1219

Query: 527  REV-VTTLGALNGAKI 483
             +  +   GA  G  I
Sbjct: 1220 EDAPLRVTGAAAGGWI 1235


>UniRef50_UPI00015B5C72 Cluster: PREDICTED: similar to zinc
           metalloprotease; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to zinc metalloprotease - Nasonia
           vitripennis
          Length = 788

 Score = 36.3 bits (80), Expect = 0.95
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV- 519
           G+P K++ +I+    GST +V     +  P  +   +KQG  LS +LF + L+  +R++ 
Sbjct: 672 GVPKKLVRLIEICLNGSTGKVRVGGNVSEPFMIRDDLKQGDGLSTVLFNLTLEYAVRKMQ 731

Query: 518 VTTLGA 501
           V+ LGA
Sbjct: 732 VSQLGA 737


>UniRef50_UPI0000E47234 Cluster: PREDICTED: hypothetical protein;
           n=3; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 762

 Score = 36.3 bits (80), Expect = 0.95
 Identities = 18/63 (28%), Positives = 35/63 (55%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+  K++  I+A   G   RV  +        +T+G+ QG +L P+LF++ ++D+ 
Sbjct: 420 LEAHGLEGKLLNWIRAFLTGRVQRVFVNGESSNWSPVTSGIPQGSVLGPVLFLVYINDLP 479

Query: 527 REV 519
            +V
Sbjct: 480 LDV 482


>UniRef50_Q9YW31 Cluster: ORF MSV061 putative LINE reverse
           transcriptase, similar to Caenorhabditis elegans
           GB:U00063; n=1; Melanoplus sanguinipes
           entomopoxvirus|Rep: ORF MSV061 putative LINE reverse
           transcriptase, similar to Caenorhabditis elegans
           GB:U00063 - Melanoplus sanguinipes entomopoxvirus
           (MsEPV)
          Length = 531

 Score = 36.3 bits (80), Expect = 0.95
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P  +I  I++LY  +  R++   V    I++  G+KQGC +S  LF + +D IM E
Sbjct: 260 GYPPHLINAIKSLYENT--RII---VKSKVIKINKGIKQGCAVSLSLFNIYIDHIMNE 312


>UniRef50_Q7X6R8 Cluster: OSJNBa0071G03.15 protein; n=1; Oryza
           sativa (japonica cultivar-group)|Rep: OSJNBa0071G03.15
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 637

 Score = 36.3 bits (80), Expect = 0.95
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 2/105 (1%)
 Frame = -1

Query: 827 LFASFIEQSVELAD*K*FLRLLT--FEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALY 654
           L A F  +S +L   K  + +L   FEK+  T+   A     ++  G P K +  +Q ++
Sbjct: 420 LVAHFHAESTDLQQSKREIIILKLDFEKAFDTIEHTAILS-VMQSMGFPQKWLNWVQMVF 478

Query: 653 RGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
             ++  V+ + V G       GV+QG  LSPL++++  + + R V
Sbjct: 479 SSASTAVLLNGVPGNSFTCKRGVRQGDPLSPLIYVLGAELLQRIV 523


>UniRef50_Q01HQ6 Cluster: OSIGBa0153E02-OSIGBa0093I20.19 protein;
            n=42; Oryza sativa|Rep: OSIGBa0153E02-OSIGBa0093I20.19
            protein - Oryza sativa (Rice)
          Length = 1752

 Score = 36.3 bits (80), Expect = 0.95
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = -1

Query: 662  ALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV--VTTLGALN 495
            AL   ST +V+ + + G  I    G++QG  LSPLLF++ +D + R +   T LG+L+
Sbjct: 1213 ALLYTSTSQVLLNGIPGQRITHGRGLRQGDPLSPLLFVLAIDPLQRLLTKATDLGSLS 1270


>UniRef50_A2EB34 Cluster: Reverse transcriptase, putative; n=1;
           Trichomonas vaginalis G3|Rep: Reverse transcriptase,
           putative - Trichomonas vaginalis G3
          Length = 111

 Score = 36.3 bits (80), Expect = 0.95
 Identities = 20/52 (38%), Positives = 26/52 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L++ GIPN+++  I  LY   T +          I    G KQGC LSPL F
Sbjct: 51  LREIGIPNELVNTINELYIYMTTKFRIGNRTTNEISGKMGFKQGCPLSPLFF 102


>UniRef50_Q2GM14 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 687

 Score = 36.3 bits (80), Expect = 0.95
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ G P  ++  I+    G    ++ D     P  + AGV QG  LSP+LFI+ +  + 
Sbjct: 228 LREMGYPRWLVLWIRDWLTGREATLLFDGKAATPTAIRAGVPQGSPLSPVLFILYIASLY 287

Query: 527 REV 519
           +++
Sbjct: 288 KQL 290


>UniRef50_Q6Q278 Cluster: AcuC; n=2; Acinetobacter|Rep: AcuC -
            Acinetobacter sp. BD413
          Length = 850

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 1/109 (0%)
 Frame = -3

Query: 435  TLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGEL 256
            TLD  Q ++     S+     + N    + MR+ SKNT    +   G  + T    SGEL
Sbjct: 736  TLDGNQTRVIPRMYSSTLATFKANQQSNILMRIDSKNTQQFPM---GSRIETS---SGEL 789

Query: 255  LSNQGGSDEDIEIRIRKARGAFAQLKPVWESSV-MTRRIKLTLFDSIVK 112
            +   G S++   +     R     LK VW   V  +  I LT F S+VK
Sbjct: 790  IGLMGQSNQ--SLLTHDIRDLKEPLKVVWGDQVKQSCNIPLTEFSSVVK 836


>UniRef50_O93521 Cluster: Reverse transcriptase; n=42;
           Atherinomorpha|Rep: Reverse transcriptase - Oryzias
           latipes (Medaka fish) (Japanese ricefish)
          Length = 1258

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 21/74 (28%), Positives = 34/74 (45%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G    II  I  LY   T R+  +      I +  G +QGC +S LLF + ++  + + +
Sbjct: 621 GFCKSIIETISGLYNKPTARIKINGDFTETITLERGTRQGCNMSALLFALYIEP-LGQWI 679

Query: 515 TTLGALNGAKISWK 474
                + G K+S K
Sbjct: 680 RQRADIKGVKVSGK 693


>UniRef50_Q7XR27 Cluster: OSJNBa0014F04.20 protein; n=3; Oryza
           sativa|Rep: OSJNBa0014F04.20 protein - Oryza sativa
           (Rice)
          Length = 723

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = -1

Query: 776 FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEM 597
           FL+L  FEK+  T+   A     L+    P K +  +Q ++  ++  V+ + V G   + 
Sbjct: 358 FLKL-DFEKAFDTIEHSAILS-VLQHMDFPEKWMQWVQMVFSSASSTVLLNGVPGNSFKC 415

Query: 596 TAGVKQGCLLSPLLFI 549
             GV+QG  LSPLLF+
Sbjct: 416 RRGVRQGDPLSPLLFV 431


>UniRef50_Q17003 Cluster: Putative reverse transcriptase; n=29;
           Culicidae|Rep: Putative reverse transcriptase -
           Anopheles gambiae (African malaria mosquito)
          Length = 1049

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GIP+ ++  +++     T  V  D+ +   I  ++GV QG  + PLLFI+ ++D+
Sbjct: 703 LDKLGIPSPLVQWLKSYLIHRTYIVKIDKHMSKEIVSSSGVPQGSNIGPLLFILFINDV 761


>UniRef50_O44318 Cluster: Reverse transcriptase; n=1; Limulus
           polyphemus|Rep: Reverse transcriptase - Limulus
           polyphemus (Atlantic horseshoe crab)
          Length = 1168

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++  +    + I++ +Y G +           PI +  GVKQG  +SP+LF + LD ++
Sbjct: 597 LERFAVHPHFVRIVEDMYSGCSTSFRVGSQSTRPIVLMRGVKQGDPMSPILFNIALDPLL 656

Query: 527 REV 519
           R++
Sbjct: 657 RQL 659


>UniRef50_A6RFJ6 Cluster: Predicted protein; n=6; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 1163

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 15/61 (24%), Positives = 32/61 (52%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ GIP  ++G + +        +  +       ++ AG+ QG  LSP+LF+   ++++
Sbjct: 776 LRRLGIPRDLVGWVASFMTNRKSTIAFEGQESDTFDIPAGIPQGSPLSPILFLFYNEELV 835

Query: 527 R 525
           R
Sbjct: 836 R 836


>UniRef50_A6R5U3 Cluster: Predicted protein; n=10; Ajellomyces
            capsulatus NAm1|Rep: Predicted protein - Ajellomyces
            capsulatus NAm1
          Length = 1390

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 15/61 (24%), Positives = 32/61 (52%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L++ GIP  ++G + +        +  +       ++ AG+ QG  LSP+LF+   ++++
Sbjct: 887  LRRLGIPRDLVGWVASFMTNRKSTIAFEGQESDTFDIPAGIPQGSPLSPILFLFYNEELV 946

Query: 527  R 525
            R
Sbjct: 947  R 947


>UniRef50_P14381 Cluster: Transposon TX1 uncharacterized 149 kDa
           protein; n=1; Xenopus laevis|Rep: Transposon TX1
           uncharacterized 149 kDa protein - Xenopus laevis
           (African clawed frog)
          Length = 1308

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = -1

Query: 683 KIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           + +G ++ +Y  + C V  +  L AP+    GV+QGC LS  L+ + ++  +
Sbjct: 619 QFVGYLKTMYASAECLVKINWSLTAPLAFGRGVRQGCPLSGQLYSLAIEPFL 670


>UniRef50_Q6TXF7 Cluster: LRRGT00042; n=1; Rattus norvegicus|Rep:
           LRRGT00042 - Rattus norvegicus (Rat)
          Length = 369

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRV-VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L++ GI    + I+ A+Y      + ++ + L A I   +G +QGC LSP LF ++L+ +
Sbjct: 5   LERTGIQGPYLNIVNAIYSKPVANIKLNGEKLEA-IPQKSGTRQGCPLSPYLFNIVLNVL 63

Query: 530 MR 525
            R
Sbjct: 64  TR 65


>UniRef50_Q0Q535 Cluster: Reverse transcriptase; n=1; Phytophthora
           ramorum|Rep: Reverse transcriptase - Phytophthora
           ramorum (Sudden oak death agent)
          Length = 704

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHD-QVLGAPIEMTAGVKQGCLLSPLLF 552
           L+++G+P+  I   + LY  +   V +      API +  GV QGC LSP LF
Sbjct: 594 LERQGVPSPFIACCRGLYADAVFTVGNAADGTTAPIALRVGVFQGCPLSPHLF 646


>UniRef50_O44319 Cluster: Reverse transcriptase; n=1; Anurida
           maritima|Rep: Reverse transcriptase - Anurida maritima
          Length = 1151

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRG--STCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDD 534
           L + G P+  +  ++  Y G  S  ++  D    A   +  GV QG  LSP+LF +++D 
Sbjct: 584 LSKSGAPDSFVTYVRNCYDGFASVVKLGRDT---AQTTVRQGVLQGDPLSPILFNLVIDQ 640

Query: 533 IMREVVTTLG 504
           I+R +  T+G
Sbjct: 641 IIRSLPETVG 650


>UniRef50_UPI0000E49EC7 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 499

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 2/117 (1%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q  L  L+     R +  N  K   + V  K T  +K      + S E  IS + L  
Sbjct: 303 ELQEDLNSLQQWKSDRLITFNLQKCQTISVTKKRTRIIKTYSIHGQ-SLEKVISTKYLGI 361

Query: 246 --QGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETW 82
             Q   + +I++  +KA    A L+     S  +R IK+  + ++++ VL +GC+ W
Sbjct: 362 HIQKNCNHNIDLVAKKANSTRAFLQR--NLSSCSRNIKVLCYKALLRPVLEYGCKVW 416


>UniRef50_UPI0000E49710 Cluster: PREDICTED: similar to
           endonuclease-reverse transcriptase; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease-reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 773

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           GI   +   I++   G T RVV +    +  ++ +GV QG +L P LF++ ++DI
Sbjct: 419 GITGNLHRWIKSFLTGRTQRVVINGTPSSASKVVSGVAQGSVLGPTLFLLYVNDI 473


>UniRef50_UPI0000E46FAA Cluster: PREDICTED: similar to Rte-1
           element; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Rte-1 element - Strongylocentrotus
           purpuratus
          Length = 395

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++  I    + I++ +Y  +  R+  D  +   I++  GV+QG  LSP +F   ++++ 
Sbjct: 219 LRKINIEEGYVRILEDIYTNAVARIHIDNDISKEIKIQRGVRQGDTLSPKIFTENIEEVF 278

Query: 527 REVVTTLGALNGA-KISWKTLT 465
           ++       LNG   I  +TLT
Sbjct: 279 KK-----SHLNGGINIDGETLT 295


>UniRef50_Q10WH5 Cluster: Serine/threonine protein kinase; n=1;
           Trichodesmium erythraeum IMS101|Rep: Serine/threonine
           protein kinase - Trichodesmium erythraeum (strain
           IMS101)
          Length = 606

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = -3

Query: 231 EDIEIRIRK-ARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETW 82
           +D  I +RK ++G FA +  VW+    T R+   L ++  K++ LF  E W
Sbjct: 40  KDRYIPLRKISKGGFANIYIVWDKKTQTERVLKVLLETSPKALELFDQEAW 90


>UniRef50_Q10N74 Cluster: Retrotransposon protein, putative,
           unclassified; n=4; Oryza sativa|Rep: Retrotransposon
           protein, putative, unclassified - Oryza sativa subsp.
           japonica (Rice)
          Length = 835

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 21/63 (33%), Positives = 33/63 (52%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+ R  P      IQAL   S   V+ + + G  I  + G++QG  LSP LFI++ D + 
Sbjct: 311 LRARNFPMCWQKWIQALLESSKSAVLLNGIPGRWINCSQGLRQGDPLSPYLFILVADTLQ 370

Query: 527 REV 519
           + +
Sbjct: 371 QMI 373


>UniRef50_Q0IX63 Cluster: Os10g0463600 protein; n=4; Oryza sativa
           (japonica cultivar-group)|Rep: Os10g0463600 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 615

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+ RG        I  L   ++ R++ + + G P     G++QG  LSP LFI+ +D I 
Sbjct: 168 LQCRGFSQHWRNWIVLLLSTASSRILLNGIAGEPTTHRRGLRQGDPLSPYLFILAIDPIQ 227

Query: 527 R 525
           R
Sbjct: 228 R 228


>UniRef50_Q01KW5 Cluster: H0211A12.9 protein; n=2; Oryza sativa|Rep:
            H0211A12.9 protein - Oryza sativa (Rice)
          Length = 1667

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L+Q G  N+ +  I  L+  S+ +V+ +   G  I    G++QG  LSP+LFI+ +    
Sbjct: 1419 LRQFGFGNRWLNWITNLFSTSSSQVLLNGSPGQKINHARGLRQGDPLSPMLFILAMKPFH 1478

Query: 527  R 525
            R
Sbjct: 1479 R 1479


>UniRef50_A3BM93 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 517

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L  +G P+  I  I+ L + S   V+   + G  I    G++QG  LSP LFI++ D + 
Sbjct: 165 LSVKGFPDNWISWIKNLLQTSKSAVLLHGIPGKWITCKKGLRQGDPLSPYLFILVADVLQ 224

Query: 527 R 525
           R
Sbjct: 225 R 225


>UniRef50_Q2H8L4 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 862

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT-AGVKQGCLLSPLLFIMLLDDI 531
           LK RGIP  ++  I A     T  +  +       E+  AG+ QG  LSP+LF+    D+
Sbjct: 573 LKARGIPESLVKWIDAFCSKRTATIAVNGFTSGRQELPQAGLPQGSPLSPVLFLFFNADL 632

Query: 530 MREVVTTLG 504
           ++  +   G
Sbjct: 633 VQHKIDANG 641


>UniRef50_Q2GMR4 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1279

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT-AGVKQGCLLSPLLFIMLLDDI 531
            LK RGIP  ++  I A     T  +  +       E+  AG+ QG  LSP+LF+    D+
Sbjct: 815  LKARGIPESLVKWIDAFCSKRTATIAVNGFTSGRQELPQAGLPQGSPLSPVLFLFFNADL 874

Query: 530  MREVVTTLG 504
            ++  +   G
Sbjct: 875  VQHKIDANG 883


>UniRef50_A6QZP1 Cluster: Predicted protein; n=37; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 709

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 16/58 (27%), Positives = 32/58 (55%)
 Frame = -1

Query: 701 QRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           Q+G P +++ +I +       +V+ +    A  +M  G  QG  LSP+LF++ L +++
Sbjct: 24  QQGWPRELLQLIDSFLTERRAQVLLEGTTTAAHQMQCGTPQGSPLSPILFLLCLAELL 81


>UniRef50_UPI00015B461D Cluster: PREDICTED: similar to ORF2-encoded
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to ORF2-encoded protein - Nasonia vitripennis
          Length = 608

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 13/27 (48%), Positives = 20/27 (74%)
 Frame = -1

Query: 599 MTAGVKQGCLLSPLLFIMLLDDIMREV 519
           +  GV QG +L PLLFI+ ++DI+ E+
Sbjct: 511 INTGVPQGTILGPLLFILYINDILHEI 537


>UniRef50_UPI0000E46784 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 576

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L++ GI  +++  I       + RVV D    A   + +GV QG +L PLLF++ +++I
Sbjct: 167 LQKCGIQGQLLNWINIWLTTRSQRVVIDGECSASAGVLSGVPQGSVLGPLLFLVYINNI 225


>UniRef50_UPI0000D57957 Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase), partial; n=2; Tribolium castaneum|Rep:
           PREDICTED: similar to RNA-directed DNA polymerase from
           mobile element jockey (Reverse transcriptase), partial -
           Tribolium castaneum
          Length = 466

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = -1

Query: 677 IGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDD 534
           I +I +     +C+V        P+ + +GV QG +LSP+L+I    D
Sbjct: 385 IKLIDSFLSNRSCKVKVQNSFSYPVPLLSGVPQGSVLSPILYIFYSSD 432


>UniRef50_UPI0000D578A4 Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to RNA-directed DNA polymerase from mobile
           element jockey (Reverse transcriptase) - Tribolium
           castaneum
          Length = 678

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = -1

Query: 677 IGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDD 534
           I +I +     +C+V        P+ + +GV QG +LSP+L+I    D
Sbjct: 345 IKLIDSFLSNRSCKVKVQNSFSYPVPLLSGVPQGSVLSPILYIFYSSD 392


>UniRef50_UPI00005A5FEA Cluster: PREDICTED: similar to ORF2; n=1;
           Canis lupus familiaris|Rep: PREDICTED: similar to ORF2 -
           Canis familiaris
          Length = 736

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           G       I +A+Y      +V   + LGA + + +G +QGC LSPLLF  +L+
Sbjct: 205 GTEGTFFSIFKAIYEKPMANIVLSGERLGASL-LRSGTRQGCPLSPLLFTTVLE 257


>UniRef50_Q2QUY9 Cluster: Retrotransposon protein, putative, LINE
           subclass; n=4; Oryza sativa|Rep: Retrotransposon
           protein, putative, LINE subclass - Oryza sativa subsp.
           japonica (Rice)
          Length = 579

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G  ++ IG I ++   S+ +++ +   G       G++QG  LSP+LFI+ +D + 
Sbjct: 88  LRHLGFGDRWIGWIISILSTSSSKIILNGKAGDSFLHGRGLRQGDPLSPMLFILAIDPLQ 147

Query: 527 R 525
           R
Sbjct: 148 R 148


>UniRef50_Q9Y1H5 Cluster: Pol; n=64; root|Rep: Pol - Dictyostelium
           discoideum (Slime mold)
          Length = 1275

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 17/59 (28%), Positives = 32/59 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           GIP K+I +I  L   S  ++  +       ++  GVKQG  +S  LF+++++ + R +
Sbjct: 602 GIPIKLINLIHKLLSDSQAKISINGKTTRKFDIKRGVKQGDPISATLFVIVIEILARTI 660


>UniRef50_Q9Y1H3 Cluster: Pol; n=24; Dictyostelium discoideum|Rep:
           Pol - Dictyostelium discoideum (Slime mold)
          Length = 1147

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 17/64 (26%), Positives = 35/64 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  GIP K   I+  L + +  ++  +  L   I +  G KQG  +SP +F ++L+ ++
Sbjct: 589 LEHIGIPPKFTAILLNLLKDTKNKIKINDFLVNGITIRRGTKQGDPISPTIFALVLEPLL 648

Query: 527 REVV 516
            +++
Sbjct: 649 IDII 652


>UniRef50_Q6IFU2 Cluster: Pol polyprotein; n=6; Schistosoma|Rep: Pol
            polyprotein - Schistosoma mansoni (Blood fluke)
          Length = 1227

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
            L   G+ N ++    +        V  +  L   + + +GV QGC+L PLLF++ ++DI
Sbjct: 865  LASYGVENPLLAWFDSFLSDRHQIVKINSSLSNSVPVRSGVIQGCVLGPLLFLVFINDI 923


>UniRef50_O44315 Cluster: Reverse transcriptase; n=1; Dugesiella
           sp.|Rep: Reverse transcriptase - Dugesiella sp
          Length = 743

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 20/62 (32%), Positives = 30/62 (48%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+Q   P  +I II   +R  T  V           +  G  QG +L PLL+ M++D ++
Sbjct: 168 LRQNRFPGNLIDIIVDYFRDRTISVRFGSTR-VTRNVVRGCPQGSVLGPLLWNMVIDPVL 226

Query: 527 RE 522
           RE
Sbjct: 227 RE 228


>UniRef50_Q59K55 Cluster: Polyprotein of L1-like non-LTR
           retrotransposon Zorro 1; n=2; Candida albicans|Rep:
           Polyprotein of L1-like non-LTR retrotransposon Zorro 1 -
           Candida albicans (Yeast)
          Length = 1197

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 22/83 (26%), Positives = 38/83 (45%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           LL F K+  +L         +K +  P   I    A+  G    +  +     P+ + AG
Sbjct: 634 LLDFSKAFDSLNHSYIHAVLMKYK-FPQSFINFCMAITSGHIGNIRINDKSSEPLRLLAG 692

Query: 587 VKQGCLLSPLLFIMLLDDIMREV 519
           V+QG  LSP +FI+ L+  + ++
Sbjct: 693 VRQGNPLSPTIFILCLEPFLAKL 715


>UniRef50_Q2HI82 Cluster: Putative uncharacterized protein; n=3;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 2049

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT-AGVKQGCLLSPLLFIMLLDDI 531
            LK RGIP  ++  I A     T  +  +       E+  AG+ QG  LSP+LF+    D+
Sbjct: 1443 LKARGIPEPLVKWIDAFCSKRTATIAVNGFTSGRQELPQAGLPQGSPLSPVLFLFFNADL 1502

Query: 530  MREVVTTLG 504
            ++  +   G
Sbjct: 1503 VQHKIDANG 1511


>UniRef50_Q2HBK6 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1620

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 17/63 (26%), Positives = 32/63 (50%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L++ G P  ++  I+    G    ++ D     P  + AG  QG  LSP+LFI+ +  + 
Sbjct: 1009 LREMGYPGWLVLWIRDWLTGREATLLFDGKAATPTAIRAGFPQGSPLSPVLFILYIASLY 1068

Query: 527  REV 519
            +++
Sbjct: 1069 KQL 1071


>UniRef50_Q2GYS3 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1206

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT-AGVKQGCLLSPLLFIMLLDDI 531
            LK RGIP  ++  I A     T  +  +       E+  AG+ QG  LSP+LF+    D+
Sbjct: 875  LKARGIPEPLVKWIDAFCSKRTATIAVNGFTSGRQELPQAGLPQGSPLSPVLFLFFNADL 934

Query: 530  MREVVTTLG 504
            ++  +   G
Sbjct: 935  VQHKIDANG 943


>UniRef50_Q2GN74 Cluster: Putative uncharacterized protein; n=3;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1481

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT-AGVKQGCLLSPLLFIMLLDDI 531
            LK RGIP  ++  I A     T  +  +       E+  AG+ QG  LSP+LF+    D+
Sbjct: 879  LKARGIPEPLVKWIDAFCSKRTATIAVNGFTSGRQELPQAGLPQGSPLSPVLFLFFNADL 938

Query: 530  MREVVTTLG 504
            ++  +   G
Sbjct: 939  VQHKIDANG 947


>UniRef50_Q2GM97 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 1155

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT-AGVKQGCLLSPLLFIMLLDDI 531
           LK RGIP  ++  I A     T  +  +       E+  AG+ QG  LSP+LF+    D+
Sbjct: 664 LKARGIPEPLVKWIDAFCSKRTATIAVNGFTSGRQELPQAGLPQGSPLSPVLFLFFNADL 723

Query: 530 MREVVTTLG 504
           ++  +   G
Sbjct: 724 VQHKIDANG 732


>UniRef50_Q2GM30 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1567

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT-AGVKQGCLLSPLLFIMLLDDI 531
            LK RGIP  ++  I A     T  +  +       E+  AG+ QG  LSP+LF+    D+
Sbjct: 951  LKARGIPEPLVKWIDAFCSKRTATIAVNGFTSGRQELPQAGLPQGSPLSPVLFLFFNADL 1010

Query: 530  MREVVTTLG 504
            ++  +   G
Sbjct: 1011 VQHKIDANG 1019


>UniRef50_Q08810 Cluster: Translation initiation factor IF-2,
           chloroplast; n=1; Galdieria sulphuraria|Rep: Translation
           initiation factor IF-2, chloroplast - Galdieria
           sulphuraria (Red alga)
          Length = 259

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 16/91 (17%), Positives = 46/91 (50%)
 Frame = -3

Query: 486 NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKL 307
           N   D+ Y ++ + +     ++  +  ++     K+G  +N N+ +D+ +++  +  LK+
Sbjct: 82  NCQSDIIYVEENITVNELASKIGVEATEILKVLFKKGKLLNINQILDLSLLNLISQELKI 141

Query: 306 QDCGFEVSTEVYISGELLSNQGGSDEDIEIR 214
                +    +YI+ E  ++Q  +D+ +++R
Sbjct: 142 NITTIDKKNNIYINTESNNDQNINDKHVKLR 172


>UniRef50_Q7YXU7 Cluster: ORF2; n=1; Girardia tigrina|Rep: ORF2 -
           Dugesia tigrina (Planarian)
          Length = 1171

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 18/59 (30%), Positives = 32/59 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           G+    + +I+ LY  +   V   +     +++  GVKQGC LS LLF + ++ I+R +
Sbjct: 458 GLGTSALTLIKNLYLDNYTNVTCGESKIENVKLNKGVKQGCPLSMLLFNIFINIIIRAI 516


>UniRef50_Q76IM9 Cluster: Reverse transcriptase; n=1; Ciona
            intestinalis|Rep: Reverse transcriptase - Ciona
            intestinalis (Transparent sea squirt)
          Length = 1540

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
            L+    P+ ++ +++ +Y G+TCRV         I    GV+QG  LS +LF ++ +
Sbjct: 925  LRHFDAPHYLVELVRDIYTGATCRVRSSVGETGDIPCDRGVRQGYPLSGILFNLVTE 981


>UniRef50_Q49P02 Cluster: Reverse transcriptase-like protein; n=1;
           Ixodes scapularis|Rep: Reverse transcriptase-like
           protein - Ixodes scapularis (Black-legged tick) (Deer
           tick)
          Length = 513

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVM 334
           L+ + +ADD+++   T + +Q +L+ L      RGL IN  K+  + ++
Sbjct: 28  LDGMAFADDLIVFASTPEGLQRRLDSLHSFVGARGLAINAEKSFTVSIV 76


>UniRef50_Q59KQ0 Cluster: Polyprotein of L1-like non-LTR
           retrotransposon Zorro 3; n=3; Candida albicans|Rep:
           Polyprotein of L1-like non-LTR retrotransposon Zorro 3 -
           Candida albicans (Yeast)
          Length = 1149

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+Q G   K    + A+      +V  + + G    +  GV+QG  +SPL+FI++L+  +
Sbjct: 590 LQQVGFGPKATNFLMAITAKQKAKVSINNIEGPCFPLKRGVRQGNPISPLIFILILETFL 649


>UniRef50_O29548 Cluster: Probable phosphoenolpyruvate synthase;
           n=9; Euryarchaeota|Rep: Probable phosphoenolpyruvate
           synthase - Archaeoglobus fulgidus
          Length = 753

 Score = 33.9 bits (74), Expect = 5.1
 Identities = 22/90 (24%), Positives = 42/90 (46%)
 Frame = -3

Query: 441 TPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISG 262
           T   D+++ K+E+++I  +K  L     KTV + +  +      L D   E   ++   G
Sbjct: 227 TYVYDRVKRKIEEVKIGEKKFMLTRKDGKTVKVELPPEKANERVLSD---EEIEKLVTLG 283

Query: 261 ELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
           EL+ +  G  +D+E  I   +    Q +P+
Sbjct: 284 ELIEDHYGKPQDVEWAIEGGKIYIVQSRPI 313


>UniRef50_UPI00015557D7 Cluster: PREDICTED: similar to reverse
           transcriptase-like; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to reverse transcriptase-like -
           Ornithorhynchus anatinus
          Length = 176

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 14/23 (60%), Positives = 18/23 (78%)
 Frame = -1

Query: 590 GVKQGCLLSPLLFIMLLDDIMRE 522
           GV QGC+LSP LFI+  + +MRE
Sbjct: 9   GVGQGCILSPYLFILDTEHLMRE 31


>UniRef50_UPI0000E487CB Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=7;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 1060

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  GI    +  I +L       VV D       ++T+GV QG ++ P LF++ ++DI 
Sbjct: 713 LQYYGISGDSLQWIMSLLTDRQQAVVVDGSKSTWRDVTSGVPQGSVIGPTLFLLYINDIQ 772

Query: 527 REVVTTL 507
             + +T+
Sbjct: 773 DNIQSTM 779


>UniRef50_UPI0000E47679 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 721

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           GI   I   I  L    + RV+ + V      + +GV QGC++ PLLF+  ++D+
Sbjct: 651 GIRGNIHEWIDNLLSNRSQRVLLEGVKSRTSPVLSGVPQGCMVRPLLFLHFINDL 705


>UniRef50_UPI0000E47200 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 597

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++ GI  +++  I       + RVV D        + +GV QG +L PLLFI+ +++I 
Sbjct: 521 LQKCGIQGQLLKWINIWLTTRSQRVVIDGECSVSAAVLSGVPQGSVLGPLLFIVYINNID 580

Query: 527 REVVTTL 507
             + ++L
Sbjct: 581 INISSSL 587


>UniRef50_UPI0000E45C95 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 837

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  GI    +  I +L       VV D       ++T+GV QG ++ P LF++ ++DI 
Sbjct: 652 LQYYGISGDSLQWIMSLLTDRQQAVVVDGSKSTWRDVTSGVPQGSVIGPTLFLLYINDIQ 711

Query: 527 REVVTTL 507
             + +T+
Sbjct: 712 DNIQSTM 718


>UniRef50_UPI0000E45C58 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 607

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  GI    +  I +L       VV D       ++T+GV QG ++ P LF++ ++DI 
Sbjct: 335 LQYYGISGDSLQWIMSLLTDRQQAVVVDGSKSTWRDVTSGVPQGSVIGPTLFLLYINDIQ 394

Query: 527 REVVTTL 507
             + +T+
Sbjct: 395 DNIQSTM 401


>UniRef50_UPI00015A401A Cluster: UPI00015A401A related cluster; n=1;
           Danio rerio|Rep: UPI00015A401A UniRef100 entry - Danio
           rerio
          Length = 1097

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           L+  G  +  I +++ LY      +  +  L AP ++  GV+QGC LS +L+++ ++
Sbjct: 438 LEAFGFSSSFISMVKVLYCDVESILKVNGDLCAPFKVFRGVRQGCALSGMLYVLAIE 494


>UniRef50_Q64IU0 Cluster: Reverse transcriptase; n=1; Kryptolebias
           marmoratus|Rep: Reverse transcriptase - Rivulus
           marmoratus (Mangrove rivulus) (Kryptolebias marmoratus)
          Length = 114

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 19/63 (30%), Positives = 30/63 (47%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + G     + II+ +Y  S   V  +        +  G KQG  LSPLLFI+ L+ + 
Sbjct: 11  LTKFGFKRSFLEIIKMIYSDSKATVTTNGSRSTQFLIQRGTKQGDPLSPLLFIIALEPLA 70

Query: 527 REV 519
           + +
Sbjct: 71  QAI 73


>UniRef50_Q84TB4 Cluster: Putative reverse transcriptase; n=4; Oryza
           sativa|Rep: Putative reverse transcriptase - Oryza
           sativa subsp. japonica (Rice)
          Length = 793

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           L+ +G   +    I  L+R ++ RV+ +   G PI    GV+QG  +SP++FI+ ++
Sbjct: 486 LEHKGFGLRWRSWIAMLFRTTSSRVLINGEPGCPILHRRGVRQGDPISPMIFILAMN 542


>UniRef50_A3B2E1 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 568

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 21/61 (34%), Positives = 30/61 (49%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L  R  P   I  I+ L   S   V+ + V G  I    G++QG  LSP LF+++ D + 
Sbjct: 60  LAVRCFPENWISWIKGLLSSSKSAVLLNGVPGRWIRCKKGLRQGDPLSPYLFVLVADVLQ 119

Query: 527 R 525
           R
Sbjct: 120 R 120


>UniRef50_Q8IS68 Cluster: LINE1-like RNA-directed DNA polymerase;
           n=1; Euprymna scolopes|Rep: LINE1-like RNA-directed DNA
           polymerase - Euprymna scolopes
          Length = 128

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           GI   +  II++       RVV D        + AGV QG +L P LF++
Sbjct: 73  GITGNVFSIIKSFLSDRLIRVVVDGQKSEACNINAGVPQGSILGPTLFLL 122


>UniRef50_Q4F8Q0 Cluster: Reverse transcriptase; n=1; Aedes
           aegypti|Rep: Reverse transcriptase - Aedes aegypti
           (Yellowfever mosquito)
          Length = 685

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = -1

Query: 590 GVKQGCLLSPLLFIMLLDDIMREV 519
           GVKQGC LSP LFI++L  ++  V
Sbjct: 653 GVKQGCPLSPQLFILMLHHVLASV 676


>UniRef50_Q2HBP7 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 1027

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMT----AGVKQGCLLSPLLFIMLL 540
           +K RGIP++++    A     T  +   QV G   E+     AG+ QG  LSP+LF+   
Sbjct: 670 MKARGIPDELLQWTNAFCSERTATI---QVNGYTSEVQSLPQAGLPQGSPLSPILFLFNA 726

Query: 539 DDIMREVVTTLGAL 498
           D + R + +  GA+
Sbjct: 727 DLVQRRIDSRGGAI 740


>UniRef50_A6R672 Cluster: Predicted protein; n=42; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 1411

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 16/60 (26%), Positives = 32/60 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           + Q+G P +++ +I +       +V  +    A  +M  G  QG  LSP+LF++ L +++
Sbjct: 731 MAQQGWPRELLQLIDSFLTERRAQVRLEGTTTAAHQMQCGTPQGSPLSPILFLLYLAELL 790


>UniRef50_A2QSQ0 Cluster: Remark: Mars; n=34; Pezizomycotina|Rep:
            Remark: Mars - Aspergillus niger
          Length = 1652

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRV-VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
            +K RGIP  ++  ++A     T  + ++ Q+        AG+ QG  LSP+LF+    D+
Sbjct: 1009 MKARGIPEDLLRWVEAFCSERTATIQINGQLSETHSLPQAGLPQGSPLSPILFLFFNADL 1068

Query: 530  MREVVTTLG 504
            ++  +   G
Sbjct: 1069 VQRQIDGKG 1077


>UniRef50_UPI00015B446A Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 472

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 13/29 (44%), Positives = 22/29 (75%)
 Frame = -1

Query: 605 IEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           I +T+GV QG  L PLLF + +DD+++++
Sbjct: 335 IPVTSGVPQGSHLGPLLFCVYIDDLVKQL 363


>UniRef50_UPI0000E4955E Cluster: PREDICTED: similar to fibropellin
           Ia; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to fibropellin Ia - Strongylocentrotus
           purpuratus
          Length = 955

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 14/62 (22%), Positives = 32/62 (51%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L++  I    + I++ +Y  +  R+  D  +    ++  GV+QG  LSP +F    +++ 
Sbjct: 618 LRKINIEEGYVRILEDIYTNAVARIYIDNDVSREFKIQRGVRQGDTLSPKIFTATTEEVF 677

Query: 527 RE 522
           ++
Sbjct: 678 KK 679


>UniRef50_UPI0000587485 Cluster: PREDICTED: similar to
           endonuclease/reverse transcriptase; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           endonuclease/reverse transcriptase - Strongylocentrotus
           purpuratus
          Length = 766

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 15/55 (27%), Positives = 30/55 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           GI N     I    R    +V+ +  +    ++T+GV QG ++ P+LF++ ++D+
Sbjct: 444 GIRNCTHAWIADFLRDRMQQVILEGTVSTKTQVTSGVPQGSVIGPMLFLLFINDL 498


>UniRef50_Q0ATZ2 Cluster: Putative uncharacterized protein; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Putative uncharacterized protein - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 744

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = -3

Query: 231 EDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLF 97
           E IE  I KA+  + ++KPV+E +  + RI+      I    LLF
Sbjct: 566 EAIEDEINKAKSQYTKIKPVYEGATFSGRIRYENLSDIELGALLF 610


>UniRef50_A6CKY3 Cluster: Putative uncharacterized protein; n=1;
           Bacillus sp. SG-1|Rep: Putative uncharacterized protein
           - Bacillus sp. SG-1
          Length = 181

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -1

Query: 620 VLGAPI-EMTAGVKQGCLLSPLLFIMLLDDIMREVVTTLGALNGAKI 483
           ++G  I E+  GV  G L  P+LF++++D I   + T +G   G+K+
Sbjct: 103 IIGVSIDELAVGVSIGLLGFPILFVLIVDIIKSFIYTLIGLTIGSKL 149


>UniRef50_Q9FL83 Cluster: Non-LTR retroelement reverse
           transcriptase-like protein; n=7; Arabidopsis
           thaliana|Rep: Non-LTR retroelement reverse
           transcriptase-like protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 1223

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 21/81 (25%), Positives = 38/81 (46%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G P + I  I      ++  V  +  L    + + G++QGC LSP LF++ + D++ +++
Sbjct: 620 GFPREFIHWINICITTASFSVQVNGELAGYFQSSRGLRQGCALSPYLFVICM-DVLSKML 678

Query: 515 TTLGALNGAKISWKTLTMQMT 453
               A        K  TM +T
Sbjct: 679 DKAAAARHFGYHPKCKTMGLT 699


>UniRef50_Q2QXT4 Cluster: Retrotransposon protein, putative,
           unclassified; n=3; Oryza sativa|Rep: Retrotransposon
           protein, putative, unclassified - Oryza sativa subsp.
           japonica (Rice)
          Length = 294

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = -1

Query: 605 IEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTL--GALNG 492
           I++  G++QG  LSPLLF++++D +   V T +  G L G
Sbjct: 69  IKLMRGLRQGDPLSPLLFVLVMDVLQAMVTTAMASGTLRG 108


>UniRef50_Q2HVE2 Cluster: RNA-directed DNA polymerase (Reverse
           transcriptase); Polynucleotidyl transferase,
           Ribonuclease H fold; n=1; Medicago truncatula|Rep:
           RNA-directed DNA polymerase (Reverse transcriptase);
           Polynucleotidyl transferase, Ribonuclease H fold -
           Medicago truncatula (Barrel medic)
          Length = 729

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 16/58 (27%), Positives = 31/58 (53%)
 Frame = -1

Query: 710 CLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           CLK+   P+K+I II       + +++ +         + G++QG  LSP LF++ ++
Sbjct: 22  CLKECKFPSKLINIIHHCISTPSYKIMWNGDKSESFYPSRGIRQGDPLSPYLFVICME 79


>UniRef50_Q9U8F6 Cluster: Reverse transcriptase; n=1; Nasonia
           vitripennis|Rep: Reverse transcriptase - Nasonia
           vitripennis (Parasitic wasp)
          Length = 1265

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = -1

Query: 710 CLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           CL+++GIP  +   I  +YR  +   +  +     I M  GVKQG        I +L+ +
Sbjct: 712 CLEKKGIPETVAAYISNMYRDCS-TAIRTRSGDVKIGMKRGVKQGIPCHLSFSIWVLEPL 770

Query: 530 MREVVTTLGA-LNGAKIS 480
           +  +  T G  + G  +S
Sbjct: 771 LERLQETSGVEIEGMNLS 788


>UniRef50_Q22A62 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 109

 Score = 33.1 bits (72), Expect = 8.8
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +1

Query: 400 EVFKFCLHLIQSWRHQHYVICIVKVFQDI 486
           +V+ + L+LIQS R Q YV+ I+  FQDI
Sbjct: 63  QVYNYQLNLIQSLRDQRYVLKILDYFQDI 91


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 880,524,132
Number of Sequences: 1657284
Number of extensions: 18778946
Number of successful extensions: 46416
Number of sequences better than 10.0: 185
Number of HSP's better than 10.0 without gapping: 44602
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46379
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 72553824147
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).