SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0034
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q25490 Cluster: Apolipophorins precursor [Contains: Apo...   101   1e-20
UniRef50_Q8I297 Cluster: Putative uncharacterized protein PFA021...    34   2.9  
UniRef50_Q5YYK8 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_A2DPG0 Cluster: Putative uncharacterized protein; n=1; ...    32   8.9  
UniRef50_A0EI89 Cluster: Chromosome undetermined scaffold_98, wh...    32   8.9  

>UniRef50_Q25490 Cluster: Apolipophorins precursor [Contains:
            Apolipophorin-2 (Apolipophorin II) (apoLp-2);
            Apolipophorin-1 (Apolipophorin I) (apoLp-1)]; n=5;
            Ditrysia|Rep: Apolipophorins precursor [Contains:
            Apolipophorin-2 (Apolipophorin II) (apoLp-2);
            Apolipophorin-1 (Apolipophorin I) (apoLp-1)] - Manduca
            sexta (Tobacco hawkmoth) (Tobacco hornworm)
          Length = 3305

 Score =  101 bits (242), Expect = 1e-20
 Identities = 44/83 (53%), Positives = 60/83 (72%)
 Frame = +2

Query: 5    TVTYPTSSDSPYIFSGEACLDLDKKKQGHKTSVRYLINISNNRNQEAIAAEIGFFHPRFD 184
            T+T+PTS D P+   GEACLDLDK + GHKTS R+L++ SN+ +++   AEIGFFHP+ +
Sbjct: 2157 TLTHPTSQDLPFPIKGEACLDLDKNRPGHKTSARFLVDYSNSGSEDKAVAEIGFFHPKIE 2216

Query: 185  KEVVIKSNAVFKVPEPNRYILES 253
            KE VI+ NA  K PE   + +ES
Sbjct: 2217 KEAVIRLNAFMKRPENGCFKIES 2239



 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 41/76 (53%), Positives = 54/76 (71%)
 Frame = +1

Query: 259  SLCHSSLGADRVSKLLLDVSPTKFVFLAQTPFVKVIDLEGTVDVQSKAKTQQAKLRFKLL 438
            SLCHS+LG DRV+K++ + +P    FLA TPFVK ID+EG+ +V  + +TQQ   R  LL
Sbjct: 2242 SLCHSALGTDRVAKVMFETTPNSVKFLADTPFVKAIDVEGSFNVNQQQRTQQCLFRICLL 2301

Query: 439  EGKEVSVQALAKDFQY 486
            EGK V + AL KD+QY
Sbjct: 2302 EGKPVQMSALVKDYQY 2317



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +3

Query: 510  DRKLSIVGHLVPEKRVDITADIILSGDKK 596
            +RKLS VGHL+PEKRVDI+ DIILSGDKK
Sbjct: 2326 NRKLSYVGHLIPEKRVDISTDIILSGDKK 2354


>UniRef50_Q8I297 Cluster: Putative uncharacterized protein PFA0215w;
           n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PFA0215w - Plasmodium falciparum
           (isolate 3D7)
          Length = 2359

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 65  DLDKKKQGHKTSVRYLINISNNRNQEAIAAEIGFFHPRFD 184
           D+ K K+   T ++Y  N +NN N   +  E+ + H  FD
Sbjct: 457 DVFKNKRNDNTKIKYNYNNNNNNNNNVLEYELNYVHNSFD 496


>UniRef50_Q5YYK8 Cluster: Putative uncharacterized protein; n=1;
           Nocardia farcinica|Rep: Putative uncharacterized protein
           - Nocardia farcinica
          Length = 120

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = -1

Query: 481 GSLSPEPGR*PPCPLEA*TS-TWPAGSSPCFA 389
           G+++P  G   PCPL+     TWPAG+ P +A
Sbjct: 8   GTMAPVTGAPEPCPLDCLVEITWPAGARPWWA 39


>UniRef50_A2DPG0 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 1122

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query: 41   IFSGEACLD-LDKKKQGHKTSVRYLINISNNRNQEAIAAEIGFFHPRFDKEVVIKSNAVF 217
            +FS + C+D L+KK Q H+ S  +  N SN ++ + I   I     +  KE+ I++++  
Sbjct: 780  LFSQD-CIDKLNKKPQKHQVSQPHGKN-SNPKSIQRIKDRISDQKFQSQKEITIETDSYI 837

Query: 218  KVPEPNRYILES*SAYVTPLSALIASPN 301
             +P      L S  + +TP  A   +PN
Sbjct: 838  NIPIEKSNSLTSFDSILTPPPAFGNNPN 865


>UniRef50_A0EI89 Cluster: Chromosome undetermined scaffold_98, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_98,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 837

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 23/77 (29%), Positives = 36/77 (46%)
 Frame = +2

Query: 20  TSSDSPYIFSGEACLDLDKKKQGHKTSVRYLINISNNRNQEAIAAEIGFFHPRFDKEVVI 199
           TS++ P I +    L  DKK QGH+  +  L   +N  NQ     E+G    ++D E   
Sbjct: 51  TSTNKPAIETRTVVLCTDKKCQGHENLIEQLTQDNNKLNQR--IHELGLQIDKYDSEQQT 108

Query: 200 KSNAVFKVPEPNRYILE 250
             +   ++ E  R +LE
Sbjct: 109 WMSTAIEI-ESMRKLLE 124


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 613,805,271
Number of Sequences: 1657284
Number of extensions: 12350969
Number of successful extensions: 32422
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 31516
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32417
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).