SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P04350 Cluster: Tubulin beta-4 chain; n=4602; root|Rep:...   175   9e-43
UniRef50_Q9VAX7 Cluster: CG4869-PA; n=8; Eukaryota|Rep: CG4869-P...   169   6e-41
UniRef50_P52275 Cluster: Tubulin beta-2 chain; n=115; Bilateria|...   164   2e-39
UniRef50_UPI0000E1F213 Cluster: PREDICTED: hypothetical protein;...   161   1e-38
UniRef50_Q9VRX3 Cluster: Probable tubulin beta chain CG32396; n=...   130   2e-29
UniRef50_UPI00005639CD Cluster: UPI00005639CD related cluster; n...   126   5e-28
UniRef50_UPI00005A581E Cluster: PREDICTED: similar to tubulin, b...   122   1e-26
UniRef50_A4HQN7 Cluster: Putative betatubulin; n=1; Nidula niveo...   115   1e-24
UniRef50_Q4P3J3 Cluster: Putative uncharacterized protein; n=1; ...   110   3e-23
UniRef50_A7P7V1 Cluster: Chromosome chr3 scaffold_8, whole genom...    98   2e-19
UniRef50_Q86ZZ0 Cluster: Alpha-tubulin; n=2; Pansporablastina|Re...    96   6e-19
UniRef50_A2E9Y7 Cluster: Tubulin/FtsZ family, C-terminal domain ...    95   1e-18
UniRef50_Q26236 Cluster: Beta-tubulin; n=5; Eukaryota|Rep: Beta-...    95   2e-18
UniRef50_A6RQ51 Cluster: Putative uncharacterized protein; n=1; ...    95   2e-18
UniRef50_UPI00003ABCC4 Cluster: UPI00003ABCC4 related cluster; n...    93   4e-18
UniRef50_P68363 Cluster: Tubulin alpha-1B chain; n=970; Eukaryot...    91   2e-17
UniRef50_Q227Z6 Cluster: Tubulin/FtsZ family, GTPase domain cont...    88   2e-16
UniRef50_Q4S633 Cluster: Chromosome 9 SCAF14729, whole genome sh...    87   4e-16
UniRef50_Q2U1M2 Cluster: Beta tubulin; n=649; root|Rep: Beta tub...    86   7e-16
UniRef50_A5AW70 Cluster: Putative uncharacterized protein; n=1; ...    85   2e-15
UniRef50_UPI0000ECCDAD Cluster: UPI0000ECCDAD related cluster; n...    84   4e-15
UniRef50_P09733 Cluster: Tubulin alpha-1 chain; n=493; Eukaryota...    83   5e-15
UniRef50_Q3UX10 Cluster: In vitro fertilized eggs cDNA, RIKEN fu...    83   6e-15
UniRef50_A5HWB6 Cluster: Bacterial tubulin B; n=8; Prosthecobact...    79   1e-13
UniRef50_UPI0000DC0432 Cluster: UPI0000DC0432 related cluster; n...    78   2e-13
UniRef50_A0DAZ7 Cluster: Chromosome undetermined scaffold_43, wh...    76   1e-12
UniRef50_A7M6D9 Cluster: Alpha-tubulin; n=1; Dugesia ryukyuensis...    75   2e-12
UniRef50_UPI0000DB78C0 Cluster: PREDICTED: similar to Tubulin al...    74   4e-12
UniRef50_UPI0000D9DAEA Cluster: PREDICTED: similar to tubulin, b...    71   3e-11
UniRef50_A5HWB9 Cluster: Bacterial tubulin A2; n=7; Prosthecobac...    71   4e-11
UniRef50_Q7Z1L8 Cluster: Alpha-tubulin; n=2; Eukaryota|Rep: Alph...    68   3e-10
UniRef50_A2EAH1 Cluster: Gamma tubulin, putative; n=5; Eukaryota...    66   1e-09
UniRef50_UPI00006CA67A Cluster: Tubulin/FtsZ family, GTPase doma...    64   3e-09
UniRef50_Q9D6T1 Cluster: Tubulin epsilon chain; n=9; Eukaryota|R...    64   3e-09
UniRef50_A7NXT4 Cluster: Chromosome chr5 scaffold_2, whole genom...    62   1e-08
UniRef50_Q5B300 Cluster: Putative uncharacterized protein; n=1; ...    60   4e-08
UniRef50_Q6JAE0 Cluster: Putative tubulin gamma-2 chain; n=1; Ze...    60   5e-08
UniRef50_Q24HJ8 Cluster: Tubulin/FtsZ family, GTPase domain cont...    60   5e-08
UniRef50_P23258 Cluster: Tubulin gamma-1 chain; n=213; cellular ...    60   5e-08
UniRef50_Q4S6A2 Cluster: Chromosome 9 SCAF14729, whole genome sh...    60   7e-08
UniRef50_Q23WP5 Cluster: Tubulin/FtsZ family, GTPase domain cont...    60   7e-08
UniRef50_Q9UJT0 Cluster: Tubulin epsilon chain; n=30; Eukaryota|...    60   7e-08
UniRef50_Q4SEQ2 Cluster: Chromosome 3 SCAF14614, whole genome sh...    59   9e-08
UniRef50_Q8N532 Cluster: TUBA1C protein; n=9; Amniota|Rep: TUBA1...    58   2e-07
UniRef50_UPI0000DB71EB Cluster: PREDICTED: similar to epsilon-tu...    58   3e-07
UniRef50_Q4QC95 Cluster: Epsilon tubulin, putative; n=6; Trypano...    58   3e-07
UniRef50_A1CPB9 Cluster: Tubulin gamma chain; n=9; Fungi/Metazoa...    57   5e-07
UniRef50_Q0D0J3 Cluster: Tubulin gamma chain; n=6; Fungi/Metazoa...    56   8e-07
UniRef50_Q22YZ9 Cluster: Tubulin/FtsZ family, GTPase domain cont...    55   2e-06
UniRef50_Q22E27 Cluster: Tubulin/FtsZ family, C-terminal domain ...    54   3e-06
UniRef50_A6RFR4 Cluster: Tubulin gamma chain; n=1; Ajellomyces c...    54   3e-06
UniRef50_UPI00005A2266 Cluster: PREDICTED: similar to Tubulin al...    53   6e-06
UniRef50_A7TZ32 Cluster: Beta-tubulin; n=1; Lepeophtheirus salmo...    53   6e-06
UniRef50_UPI0000D5556D Cluster: PREDICTED: similar to epsilon-tu...    52   2e-05
UniRef50_UPI00015B54E0 Cluster: PREDICTED: similar to Tubulin, e...    51   2e-05
UniRef50_Q4UCK3 Cluster: Tubulin gamma-chain (Gamma-tubulin), pu...    51   2e-05
UniRef50_Q3SEG3 Cluster: Beta tubulin,putative; n=2; Paramecium ...    51   3e-05
UniRef50_Q24D62 Cluster: Tubulin/FtsZ family, GTPase domain cont...    51   3e-05
UniRef50_Q22CD2 Cluster: Tubulin/FtsZ family, GTPase domain cont...    51   3e-05
UniRef50_Q3SD83 Cluster: Beta tubulin,putative; n=1; Paramecium ...    50   7e-05
UniRef50_UPI0000660846 Cluster: Homolog of Notothenia coriiceps ...    49   1e-04
UniRef50_Q3SEF9 Cluster: Alpha-tubulin,putative; n=1; Paramecium...    49   1e-04
UniRef50_Q3SEG7 Cluster: Theta tubuline, putative; n=1; Parameci...    49   1e-04
UniRef50_Q5B2Z8 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q8IK81 Cluster: Tubulin, putative; n=9; Plasmodium|Rep:...    48   2e-04
UniRef50_Q7QZN1 Cluster: GLP_680_43068_44504; n=1; Giardia lambl...    48   2e-04
UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba his...    48   2e-04
UniRef50_Q3ZJ98 Cluster: Tubulin gamma subunit; n=1; Monocercomo...    48   3e-04
UniRef50_A4D1N8 Cluster: Similar to beta-tubulin; n=2; Homo/Pan/...    48   3e-04
UniRef50_Q7R2Q0 Cluster: GLP_546_6876_8351; n=1; Giardia lamblia...    46   7e-04
UniRef50_Q24D61 Cluster: Tubulin/FtsZ family, GTPase domain cont...    45   0.002
UniRef50_Q22UN3 Cluster: Tubulin/FtsZ family, GTPase domain cont...    45   0.002
UniRef50_UPI0000DC0F37 Cluster: UPI0000DC0F37 related cluster; n...    44   0.003
UniRef50_A2ELX8 Cluster: Tubulin/FtsZ family, GTPase domain cont...    44   0.003
UniRef50_Q15670 Cluster: Alpha-tubulin isotype H2-alpha; n=5; Eu...    44   0.003
UniRef50_UPI0000DC0C7D Cluster: UPI0000DC0C7D related cluster; n...    44   0.004
UniRef50_Q3SEG4 Cluster: Alpha-tubulin,putative; n=1; Paramecium...    44   0.004
UniRef50_P53378 Cluster: Tubulin gamma chain; n=5; Saccharomycet...    44   0.004
UniRef50_UPI000155C428 Cluster: PREDICTED: similar to tubulin al...    43   0.006
UniRef50_UPI00005A03AE Cluster: PREDICTED: similar to tubulin, a...    42   0.011
UniRef50_A1BPT4 Cluster: Tubulin-like protein; n=1; Lygus lineol...    42   0.011
UniRef50_UPI00005A5664 Cluster: PREDICTED: similar to tubulin al...    42   0.015
UniRef50_Q3SEH6 Cluster: Iota_tubulin,putative; n=2; Paramecium ...    42   0.015
UniRef50_Q49MM4 Cluster: Beta-tubulin; n=1; Cactodera betulae|Re...    42   0.019
UniRef50_A0EC94 Cluster: Chromosome undetermined scaffold_89, wh...    41   0.034
UniRef50_UPI00005A297F Cluster: PREDICTED: similar to tubulin, a...    39   0.10 
UniRef50_UPI000156080D Cluster: PREDICTED: similar to Tubulin, a...    38   0.31 
UniRef50_A7Q8W1 Cluster: Chromosome chr5 scaffold_64, whole geno...    38   0.31 
UniRef50_Q3SEF7 Cluster: Alpha-tubulin,putative; n=3; Paramecium...    38   0.31 
UniRef50_A0BQ87 Cluster: Chromosome undetermined scaffold_120, w...    37   0.55 
UniRef50_A7R175 Cluster: Chromosome undetermined scaffold_340, w...    36   0.96 
UniRef50_O93807 Cluster: Tubulin gamma chain; n=8; Saccharomycet...    36   0.96 
UniRef50_UPI0000E47CF2 Cluster: PREDICTED: similar to cryptic tu...    34   3.9  
UniRef50_Q9N9D7 Cluster: Tubulin; n=1; Paramecium tetraurelia|Re...    34   3.9  
UniRef50_A0DI61 Cluster: Chromosome undetermined scaffold_51, wh...    34   3.9  
UniRef50_UPI00006CAF6E Cluster: hypothetical protein TTHERM_0046...    33   5.1  
UniRef50_Q8SRD2 Cluster: Tubulin gamma chain; n=1; Encephalitozo...    33   5.1  
UniRef50_UPI0001555715 Cluster: PREDICTED: similar to immunoglob...    33   6.7  
UniRef50_UPI0000F2BF49 Cluster: PREDICTED: similar to MGC53359 p...    33   6.7  
UniRef50_UPI0000DAE654 Cluster: hypothetical protein Rgryl_01000...    33   6.7  
UniRef50_UPI0000584751 Cluster: PREDICTED: similar to tubulin, d...    33   6.7  
UniRef50_Q5MAT5 Cluster: Acrosome-specific protein VAD1.3; n=4; ...    33   6.7  
UniRef50_A4S3U2 Cluster: Predicted protein; n=3; Ostreococcus|Re...    33   6.7  
UniRef50_Q3SEH3 Cluster: Beta_tubulin,putative; n=4; Paramecium ...    33   6.7  
UniRef50_A7QN35 Cluster: Chromosome undetermined scaffold_130, w...    33   8.9  

>UniRef50_P04350 Cluster: Tubulin beta-4 chain; n=4602; root|Rep:
           Tubulin beta-4 chain - Homo sapiens (Human)
          Length = 444

 Score =  175 bits (426), Expect = 9e-43
 Identities = 80/105 (76%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVA +FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNS 338



 Score =  161 bits (391), Expect = 1e-38
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ ++Q+KNS+YFVEWIPNN K AVCDIPPRGLKMA+TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>UniRef50_Q9VAX7 Cluster: CG4869-PA; n=8; Eukaryota|Rep: CG4869-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 522

 Score =  169 bits (411), Expect = 6e-41
 Identities = 76/86 (88%), Positives = 81/86 (94%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT++G+QQYRALTV ELT QM
Sbjct: 299 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQYRALTVAELTQQM 358

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 359 FDAKNMMTACDPRHGRYLTVACIFRG 384



 Score =  159 bits (385), Expect = 8e-38
 Identities = 69/85 (81%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G MSMKEVD Q+ N+Q+KNS+YFVEWIPNN K+AVCDIPPRGLKM++TFIGN+TAIQ I
Sbjct: 383 RGPMSMKEVDTQMYNVQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSATFIGNSTAIQEI 442

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 443 FKRISEQFTAMFRRKAFLHWYTGEG 467



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDLISEYQQYQ
Sbjct: 458 AFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQ 491


>UniRef50_P52275 Cluster: Tubulin beta-2 chain; n=115;
           Bilateria|Rep: Tubulin beta-2 chain - Caenorhabditis
           elegans
          Length = 450

 Score =  164 bits (398), Expect = 2e-39
 Identities = 73/86 (84%), Positives = 79/86 (91%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPL+++G Q YRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAMFRG 319



 Score =  163 bits (397), Expect = 3e-39
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSM+EVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA+TF+GN+TAIQ +
Sbjct: 318 RGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDLISEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQ 426


>UniRef50_UPI0000E1F213 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 580

 Score =  161 bits (391), Expect = 1e-38
 Identities = 72/86 (83%), Positives = 77/86 (89%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLNADLRKLA+NM PFP+LHF+ PGFAPLTSRG+QQYRALTV ELT QM
Sbjct: 453 SGVTMCLRFPGQLNADLRKLAMNMAPFPQLHFFMPGFAPLTSRGSQQYRALTVAELTQQM 512

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYL  A IFRG
Sbjct: 513 FDAKNMMAACDPRHGRYLMAAAIFRG 538



 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 32/43 (74%), Positives = 38/43 (88%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRG 381
           +GRM M+EVDEQ+ NIQNKNS+YF +W+PNN K AVCDIPPRG
Sbjct: 537 RGRMPMREVDEQIFNIQNKNSSYFADWLPNNLKTAVCDIPPRG 579


>UniRef50_Q9VRX3 Cluster: Probable tubulin beta chain CG32396; n=1;
           Drosophila melanogaster|Rep: Probable tubulin beta chain
           CG32396 - Drosophila melanogaster (Fruit fly)
          Length = 462

 Score =  130 bits (315), Expect = 2e-29
 Identities = 55/85 (64%), Positives = 71/85 (83%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMS +EVD+ +  ++NKN   FV+WIPNN K A+CDIPPRGLKM++TFIGNTTAIQT+
Sbjct: 317 RGRMSPREVDQLMTGVRNKNINNFVDWIPNNIKTAICDIPPRGLKMSATFIGNTTAIQTL 376

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+R+ +  ++M RRKA LHWYTGEG
Sbjct: 377 FQRLLDASMSMLRRKAHLHWYTGEG 401



 Score =  113 bits (272), Expect = 4e-24
 Identities = 55/86 (63%), Positives = 63/86 (73%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITTCLRFPGQLNA LRK+ VNMVPFPRLHF  PGFAPL +   QQ+   TV EL  Q+
Sbjct: 233 SGITTCLRFPGQLNAGLRKIYVNMVPFPRLHFLIPGFAPLVTCKQQQFSKGTVSELVQQI 292

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           F + N++ A D R G+ LT A IFRG
Sbjct: 293 FYSNNLLCAIDLRKGKLLTAAGIFRG 318


>UniRef50_UPI00005639CD Cluster: UPI00005639CD related cluster; n=1;
           Mus musculus|Rep: UPI00005639CD UniRef100 entry - Mus
           musculus
          Length = 377

 Score =  126 bits (304), Expect = 5e-28
 Identities = 58/97 (59%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +1

Query: 220 TREVFDRCDDI-QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMAS 396
           T+++FD  + + +G MSM+EVDEQ+ ++Q+KNS+Y VEWIPNN   A+CDI PR LKMA+
Sbjct: 260 TQQMFDAKNMMARGWMSMQEVDEQMLSVQSKNSSYLVEWIPNNVNTALCDILPRNLKMAA 319

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           TFI ++ AIQ  F  + EQF  MFR KAFLHWYTGEG
Sbjct: 320 TFISHSKAIQEQFNHILEQFTTMFRCKAFLHWYTGEG 356



 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 44/59 (74%), Positives = 48/59 (81%), Gaps = 1/59 (1%)
 Frame = +2

Query: 29  PGQLNADLRKLAVNMVPF-PRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNMM 202
           P +LN DL KLAVNMVPF P LHF+  GF  LTSRG QQY+ALT+PELT QMFDAKNMM
Sbjct: 212 PCKLNVDLCKLAVNMVPFSPCLHFFMLGFPLLTSRGIQQYQALTIPELTQQMFDAKNMM 270



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 3/32 (9%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQ 572
           A +HW    G D+MEF EAESN+N L+SEYQ+
Sbjct: 347 AFLHWYTGEGMDQMEFMEAESNIN-LVSEYQR 377


>UniRef50_UPI00005A581E Cluster: PREDICTED: similar to tubulin, beta
           3; n=2; Canis lupus familiaris|Rep: PREDICTED: similar
           to tubulin, beta 3 - Canis familiaris
          Length = 363

 Score =  122 bits (293), Expect = 1e-26
 Identities = 56/86 (65%), Positives = 68/86 (79%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQT 429
           ++GRMSMKE         +KNS+YF++WIPN  K+AVCDIP RGLKM+S FIGN+TAIQ 
Sbjct: 241 LRGRMSMKE---------SKNSSYFIKWIPNKVKVAVCDIPLRGLKMSSIFIGNSTAIQE 291

Query: 430 IFKRVSEQFVAMFRRKAFLHWYTGEG 507
           +FKR+SEQ  AMF+RK FLHWY GEG
Sbjct: 292 LFKRISEQITAMFQRKTFLHWYMGEG 317



 Score = 97.5 bits (232), Expect = 3e-19
 Identities = 43/50 (86%), Positives = 46/50 (92%)
 Frame = +2

Query: 110 FAPLTSRGAQQYRALTVPELTLQMFDAKNMMVACDPRHGRYLTVATIFRG 259
           FAPLT+RG+Q YRALTVPELT QMFDAKNMM ACDPRHGRYLTVAT+ RG
Sbjct: 194 FAPLTARGSQHYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVLRG 243



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 3/32 (9%)
 Frame = +3

Query: 492 VHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           +HW    G DE EFTEAESN NDL+ EYQQYQ
Sbjct: 310 LHWYMGEGMDETEFTEAESNTNDLVPEYQQYQ 341


>UniRef50_A4HQN7 Cluster: Putative betatubulin; n=1; Nidula
           niveotomentosa|Rep: Putative betatubulin - Nidula
           niveotomentosa
          Length = 173

 Score =  115 bits (276), Expect = 1e-24
 Identities = 51/83 (61%), Positives = 60/83 (72%)
 Frame = +2

Query: 14  TCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAK 193
           T LRFPGQLN DLRKLA N++PFPRLHF  P +AP     A  +   +VP+LT  +FD K
Sbjct: 7   TSLRFPGQLNGDLRKLATNLIPFPRLHFLMPSYAPFFDAKASHFEKSSVPDLTKAVFDRK 66

Query: 194 NMMVACDPRHGRYLTVATIFRGE 262
           N++VAC PR GRYLT A IFRGE
Sbjct: 67  NLLVACYPRFGRYLTAAVIFRGE 89



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 33/83 (39%), Positives = 52/83 (62%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G +S +E +  +  +Q KN   FVEWIP+N  +++  +PP G ++  T   N+TA+Q  
Sbjct: 87  RGEISSREAEVSVHELQQKNVQNFVEWIPDNVSVSLVSVPPVGQRLFFTAPSNSTAMQKE 146

Query: 433 FKRVSEQFVAMFRRKAFLHWYTG 501
            +   + F AMF+R+AFLHWY G
Sbjct: 147 NRGTLDSFSAMFKRRAFLHWYLG 169


>UniRef50_Q4P3J3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 291

 Score =  110 bits (265), Expect = 3e-23
 Identities = 47/78 (60%), Positives = 60/78 (76%)
 Frame = +1

Query: 274 EVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQ 453
           +V+ ++ N++ KN   FVEWIPNN   ++CDI P  LKM++TFI NTT+IQ +FKR  +Q
Sbjct: 141 DVENEMYNLREKNPAGFVEWIPNNVLTSLCDIAPPQLKMSATFIANTTSIQELFKRTHDQ 200

Query: 454 FVAMFRRKAFLHWYTGEG 507
           F  MFRRKAFLHWYTGEG
Sbjct: 201 FSLMFRRKAFLHWYTGEG 218



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/34 (67%), Positives = 27/34 (79%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESN+ DLI+EYQQY+
Sbjct: 209 AFLHWYTGEGMDEMEFTEAESNLMDLIAEYQQYE 242


>UniRef50_A7P7V1 Cluster: Chromosome chr3 scaffold_8, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr3 scaffold_8, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 176

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 45/76 (59%), Positives = 57/76 (75%)
 Frame = +1

Query: 289 LANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMF 468
           + ++QNKNS++F +WIP+N K ++ D PP GL MA  FIGN+T+IQ +FKRVSEQF A F
Sbjct: 1   MIHVQNKNSSHF-DWIPSNVKSSLYDTPPGGLSMAPIFIGNSTSIQEMFKRVSEQFTATF 59

Query: 469 RRKAFLHWYTGEGRMK 516
           RR AFLHW T E   K
Sbjct: 60  RRNAFLHWCTRESMDK 75



 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 47/86 (54%), Positives = 59/86 (68%)
 Frame = +1

Query: 259 RMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFK 438
           +M   E +  + N  NKNS++F +WIP+N K ++ D PP GL MA  FIGN+T+IQ +FK
Sbjct: 75  KMEFTETESNM-NGFNKNSSHF-DWIPSNVKSSLYDTPPGGLSMAPIFIGNSTSIQEMFK 132

Query: 439 RVSEQFVAMFRRKAFLHWYTGEGRMK 516
           RVSEQF A FRR AFLHW T E   K
Sbjct: 133 RVSEQFTATFRRNAFLHWCTRESMDK 158



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 3/31 (9%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQ 569
           A +HW      D+MEFTE ESNMN  +SE Q
Sbjct: 146 AFLHWCTRESMDKMEFTETESNMNGFVSENQ 176


>UniRef50_Q86ZZ0 Cluster: Alpha-tubulin; n=2; Pansporablastina|Rep:
           Alpha-tubulin - Trachipleistophora hominis
          Length = 386

 Score = 96.3 bits (229), Expect = 6e-19
 Identities = 43/103 (41%), Positives = 63/103 (61%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRFPG LN DL +   N+VP+PR+HF    ++P+ SR    +  L+V E+T   
Sbjct: 210 SSITASLRFPGDLNVDLTEFQTNLVPYPRIHFPLVAYSPMLSREKASHEQLSVQEITSAC 269

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           FD+KN MV C+P++G+Y+    +FRG+   K +     I +TK
Sbjct: 270 FDSKNQMVKCNPQNGKYMACCLLFRGDVNPKDVNQATLIAKTK 312



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGL--------KMAS 396
           C   +G ++ K+V++     + K S+ FVEW P   KI +    P  L        K A 
Sbjct: 290 CLLFRGDVNPKDVNQATLIAKTKRSSQFVEWCPTGFKIGMNKREPTVLDGGAMAPVKRAV 349

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R++ +F  MF ++AF+HWY GEG
Sbjct: 350 CMLSNTTAIAEAWARLNSKFDLMFDKRAFVHWYVGEG 386


>UniRef50_A2E9Y7 Cluster: Tubulin/FtsZ family, C-terminal domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Tubulin/FtsZ family, C-terminal domain containing
           protein - Trichomonas vaginalis G3
          Length = 320

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 41/86 (47%), Positives = 61/86 (70%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGIT+ +RFPG LN+D+RKLA N+ PF R+H++    APLT  G +Q    T+P +T  +
Sbjct: 100 SGITSSMRFPGMLNSDMRKLATNLTPFYRMHYFVSSVAPLTPEGVKQ----TIPSITTDL 155

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           F+ KN++V+C+ + G YL+ + IFRG
Sbjct: 156 FNTKNILVSCNCKKGIYLSASAIFRG 181



 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 34/81 (41%), Positives = 55/81 (67%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GR S +EV+EQ+ NI + NS+YF  WIP+N +   C++P  G  ++ TFIGN+TA++ I
Sbjct: 180 RGRFSSREVEEQMNNIPSINSSYFCSWIPSNIQTVECNVPHPGCNISGTFIGNSTAVKEI 239

Query: 433 FKRVSEQFVAMFRRKAFLHWY 495
           F R+ + +  MF + A++  Y
Sbjct: 240 FNRIDQNYSKMFDKGAYVQHY 260


>UniRef50_Q26236 Cluster: Beta-tubulin; n=5; Eukaryota|Rep:
           Beta-tubulin - Reticulomyxa filosa
          Length = 473

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 55/79 (69%)
 Frame = +1

Query: 271 KEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           +EVD  + +IQ K +  FV WIPNN K ++  +PP    ++ TF+ NTTAI+ +F+R+S 
Sbjct: 331 QEVDGIVKSIQEKMAEDFVNWIPNNIKSSIISVPPEDTLLSGTFVANTTAIKGVFQRISS 390

Query: 451 QFVAMFRRKAFLHWYTGEG 507
            F  M++RKAFLHWY GEG
Sbjct: 391 AFARMYKRKAFLHWYKGEG 409



 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 42/86 (48%), Positives = 59/86 (68%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           +GIT+ LRFPG+LN DLRK+AVN+VPFPRLHF+    +PL + G      LT+ E+T QM
Sbjct: 240 AGITSSLRFPGKLNGDLRKMAVNLVPFPRLHFFLIAQSPLFAPGEGAKVKLTIQEITDQM 299

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           + ++N M    P  G+YL+ +  +RG
Sbjct: 300 WSSRNFMANVVPGDGKYLSASLAYRG 325



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEF E++ N+ DL++EYQ  Q
Sbjct: 400 AFLHWYKGEGMDEMEFEESDKNVRDLVTEYQDKQ 433


>UniRef50_A6RQ51 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 573

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 41/105 (39%), Positives = 63/105 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT+ LRF G LN DL +   N+VP+PR+H+    +AP+ S     + +    ELTLQ 
Sbjct: 225 SSITSSLRFDGALNVDLNEFQTNLVPYPRIHYPLISYAPVISAARSSHESFKTQELTLQC 284

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           F+  N MV CDPR+G+Y+ VA ++RG+ + +   +     + KT+
Sbjct: 285 FEPNNQMVVCDPRNGKYMAVALLYRGDVVPRDCNAAVASLKAKTS 329


>UniRef50_UPI00003ABCC4 Cluster: UPI00003ABCC4 related cluster; n=1;
           Gallus gallus|Rep: UPI00003ABCC4 UniRef100 entry -
           Gallus gallus
          Length = 177

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 44/63 (69%), Positives = 49/63 (77%)
 Frame = -1

Query: 509 LPSPVYQCKKAFRLNIATNCSDTLLNMVCMAVVLPMKVEAILRPLGGMSHTAILQLLGIH 330
           +PSPVYQCKKA R N+A NCS+ LL    MAV+LPMKV  ILRP GGMS TA+  LLGIH
Sbjct: 115 MPSPVYQCKKALRRNMAVNCSEILLKSSWMAVLLPMKVADILRPRGGMSQTAVFTLLGIH 174

Query: 329 STK 321
           STK
Sbjct: 175 STK 177



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/35 (65%), Positives = 26/35 (74%), Gaps = 3/35 (8%)
 Frame = -2

Query: 574 YCWYSDIKSFMLDSASVNSISSYP---HQCTSARR 479
           YCWYS+ +SFML SASVNSISS P   +QC  A R
Sbjct: 93  YCWYSETRSFMLLSASVNSISSMPSPVYQCKKALR 127


>UniRef50_P68363 Cluster: Tubulin alpha-1B chain; n=970;
           Eukaryota|Rep: Tubulin alpha-1B chain - Homo sapiens
           (Human)
          Length = 451

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>UniRef50_Q227Z6 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 436

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 40/86 (46%), Positives = 56/86 (65%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRFPG  N+DLRK+A+N++PFPRLHF     AP  SRG+ Q      PE+   +
Sbjct: 234 SSITCTLRFPGLFNSDLRKIALNLIPFPRLHFLMSAIAPSYSRGSTQCYPPKFPEIKNLV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           ++ + M+ + D R+GR+L  + IFRG
Sbjct: 294 YNPRTMLCSTDWRYGRFLAASAIFRG 319



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 26/67 (38%), Positives = 43/67 (64%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GR+  K+  EQ+ N  N+ ++YFV+ IPNN K + CDIP   ++++   IGN+TAI+  
Sbjct: 318 RGRIPYKDFFEQVVNSSNEYNSYFVQQIPNNLKYSKCDIPLNSVRLSGVLIGNSTAIKDY 377

Query: 433 FKRVSEQ 453
             +  E+
Sbjct: 378 TNKGMEE 384



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/23 (69%), Positives = 19/23 (82%)
 Frame = +3

Query: 504 G*DEMEFTEAESNMNDLISEYQQ 572
           G +E+EF EA SN+ DLISEYQQ
Sbjct: 381 GMEEIEFKEAHSNVMDLISEYQQ 403


>UniRef50_Q4S633 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 404

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 38/89 (42%), Positives = 54/89 (60%)
 Frame = +2

Query: 20  LRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNM 199
           LRF G LN DL +   N+VP+PR+HF    +AP+ S G   +  LTV ELT   F+  N 
Sbjct: 197 LRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAGKAYHEQLTVTELTSACFEPTNQ 256

Query: 200 MVACDPRHGRYLTVATIFRGECL*KKLTS 286
           MV CDPR+G+Y+    ++RG+   K + +
Sbjct: 257 MVKCDPRNGKYMACCLLYRGDATPKDVNA 285



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G  + K+V+  +A+I+++ S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 275 RGDATPKDVNAAIASIKSRRSVQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 334

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 335 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 367


>UniRef50_Q2U1M2 Cluster: Beta tubulin; n=649; root|Rep: Beta
           tubulin - Aspergillus oryzae
          Length = 817

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 48/124 (38%), Positives = 68/124 (54%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T C RFPGQLN+DLRKL   MVP  RLHF+T G +PL+    Q   + +VP +T ++
Sbjct: 626 SGVTACFRFPGQLNSDLRKLTTTMVPLSRLHFFTLGVSPLS---RQTSESSSVPRITQKL 682

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARILSSGYPITARLPC 361
           F + ++  + D R  R L+  TIFRG+    ++ +     R K +       P   R  C
Sbjct: 683 FSSDSIAASVDHRISRSLSCLTIFRGKVSIAEIEAQLDNLRNKRSPDYIEWVPNDIR--C 740

Query: 362 VTYL 373
             YL
Sbjct: 741 TAYL 744



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 34/85 (40%), Positives = 57/85 (67%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G++S+ E++ QL N++NK S  ++EW+PN+ +       P    M+ T + N+T+IQ +
Sbjct: 707 RGKVSIAEIEAQLDNLRNKRSPDYIEWVPNDIRCTA--YLPHDYDMSGTLLINSTSIQKM 764

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F  VSEQF A++RRKA+++ YT  G
Sbjct: 765 FSHVSEQFSALYRRKAYINPYTWNG 789



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 19/27 (70%), Positives = 23/27 (85%)
 Frame = +3

Query: 498 W*G*DEMEFTEAESNMNDLISEYQQYQ 578
           W G DEM+F EAESNMNDLI EY+++Q
Sbjct: 787 WNGVDEMDFVEAESNMNDLIEEYREHQ 813


>UniRef50_A5AW70 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 581

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 37/63 (58%), Positives = 46/63 (73%)
 Frame = +2

Query: 38  LNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNMMVACDP 217
           +  DL K  VN++ FPRL+F+  GFAPLTS G+QQYR LT PELT Q +D KN+M   DP
Sbjct: 143 MTPDLWKFVVNLMSFPRLYFFMVGFAPLTSHGSQQYRTLTFPELTRQTWDTKNIMCVADP 202

Query: 218 RHG 226
           R+G
Sbjct: 203 RYG 205


>UniRef50_UPI0000ECCDAD Cluster: UPI0000ECCDAD related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECCDAD UniRef100 entry -
           Gallus gallus
          Length = 197

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 41/79 (51%), Positives = 50/79 (63%)
 Frame = -3

Query: 495 VPVQEGFPPKHSHELLRHPLEYGLYGRRVTNEGRSHFKTPRRYVTHGNLAVIGYPLDKIR 316
           VPVQEG  P+H  ELLR PLE  L GR V NEG  H +  R  V  G L V+G PL K+ 
Sbjct: 22  VPVQEGLAPEHGRELLRDPLEELLDGRAVANEGGGHLEATRGDVADGRLHVVGDPLHKVA 81

Query: 315 AVFVLNIRQLLVNFFHRHS 259
           AV VL+++ LLV+  H H+
Sbjct: 82  AVLVLHVQHLLVHLLHGHA 100



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/76 (40%), Positives = 40/76 (52%)
 Frame = -2

Query: 259 APEYRRNGQIPPVSRITRDHHVFGVEHLQRQLGYXXXXXXXXXXXXXXRKARGVEMQARK 80
           A E   + Q+  V+ +   HHV GVEHL RQLG+               +AR  EMQ  +
Sbjct: 101 ASEDGSHRQVAAVAGVAGGHHVLGVEHLLRQLGHRQGSVLLAAAARQRGEARHEEMQPGE 160

Query: 79  RHHVHSQLPQISVQLS 32
           RHHV  QL Q+ VQL+
Sbjct: 161 RHHVDRQLAQVGVQLA 176


>UniRef50_P09733 Cluster: Tubulin alpha-1 chain; n=493;
           Eukaryota|Rep: Tubulin alpha-1 chain - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 447

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 34/87 (39%), Positives = 53/87 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN DL +   N+VP+PR+HF    ++P+ S+    + + +V E+T   
Sbjct: 237 SSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNAC 296

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           F+  N MV CDPR G+Y+    ++RG+
Sbjct: 297 FEPGNQMVKCDPRDGKYMATCLLYRGD 323



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRG--------LKMASTFIG 408
           +G +  ++V   +  ++NK +   V+W P   KI +C  PP          +  A   + 
Sbjct: 321 RGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLS 380

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTT+I   +KR+  +F  M+ ++AF+HWY GEG
Sbjct: 381 NTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEG 413


>UniRef50_Q3UX10 Cluster: In vitro fertilized eggs cDNA, RIKEN
           full-length enriched library, clone:7420443F16
           product:similar to Alpha tubulin; n=4; Murinae|Rep: In
           vitro fertilized eggs cDNA, RIKEN full-length enriched
           library, clone:7420443F16 product:similar to Alpha
           tubulin - Mus musculus (Mouse)
          Length = 446

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 37/105 (35%), Positives = 58/105 (55%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF     AP+ S        L+V ++T   
Sbjct: 243 SSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPITALAPIISAEKAYQEQLSVSDVTASC 302

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           F+  N +V CDPR G+Y+    ++RG+ + K +       +++T+
Sbjct: 303 FEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKSRTS 347



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+E +A ++++ S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 327 RGDVVPKDVNEAIAAMKSRTSVQFVDWCPTGFKVGINYQPPAVVPGGDLARVQRAVCMLS 386

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ +KAFLHWY  EG
Sbjct: 387 NTTAIVEAWARLDHKFDLMYAKKAFLHWYITEG 419


>UniRef50_A5HWB6 Cluster: Bacterial tubulin B; n=8;
           Prosthecobacter|Rep: Bacterial tubulin B -
           Prosthecobacter vanneervenii
          Length = 442

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 37/101 (36%), Positives = 54/101 (53%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRFPG+LN DL +   N+VPFP  HF T  FAP+ + G +    +  P++  + 
Sbjct: 252 SSVTASLRFPGKLNTDLGEYVTNLVPFPGNHFLTASFAPMRAPGQEGQVRINFPDIARET 311

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFR 304
           F   N   A D  +G YL+   +FRG+   K++  N    R
Sbjct: 312 FAQDNFTAAIDWTNGVYLSACALFRGDVKAKEVEENMAAIR 352



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/89 (31%), Positives = 43/89 (48%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTA 420
           C   +G +  KEV+E +A I  + S  F  ++P   K+ V +  P G   +   + N T 
Sbjct: 332 CALFRGDVKAKEVEENMAAI--RKSLNFASYVPTGVKLGVAETAPEGFASSGLALVNHTG 389

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           I  +F+R+   F  MF   A+ HWY   G
Sbjct: 390 IAAVFERLINNFDIMFDNHAYTHWYENNG 418


>UniRef50_UPI0000DC0432 Cluster: UPI0000DC0432 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0432 UniRef100 entry -
           Rattus norvegicus
          Length = 200

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 43/99 (43%), Positives = 56/99 (56%)
 Frame = +2

Query: 20  LRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNM 199
           L F GQ N+DL   AVNMV F  LHF+ PGF PL +        LTV ++T Q+F AKNM
Sbjct: 1   LLFSGQFNSDLCTRAVNMVLFLCLHFFKPGFTPLIAWTVSSIVTLTVSKITQQLF-AKNM 59

Query: 200 MVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           M+  DP H  YL V  IF+G    K++       ++K +
Sbjct: 60  MITGDPCHSHYLIVTIIFQGPTSMKEVDMQMPAIQSKNS 98



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIG-NTTAIQT 429
           QG  SMKEVD Q+  IQ+KNS+YFVEWIP + +      P  G +   T IG + T    
Sbjct: 78  QGPTSMKEVDMQMPAIQSKNSSYFVEWIPQDHQGVHVQRPAMGPEDGLTVIGQSATHPDV 137

Query: 430 IFKRVSEQFVAMFRRKAFLHW 492
           +F+ +SEQF+A+F  KAFLH+
Sbjct: 138 LFRHISEQFLALFHGKAFLHF 158


>UniRef50_A0DAZ7 Cluster: Chromosome undetermined scaffold_43, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_43,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 400

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 36/108 (33%), Positives = 63/108 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S ITT +R+ G L  D+ +L  ++VP+ +L F    +AP+ S     +  L+  E+    
Sbjct: 100 SSITTSMRYDGALLRDMAELETSLVPYAKLKFLICSYAPIISHQKVDHMQLSTVEIAKLA 159

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARIL 325
           F+  NMM  CDPR G+Y++   +FRG+ + K ++S+  IF+ +T + +
Sbjct: 160 FETTNMMAKCDPRLGKYISCLLLFRGDIIPKDVSSS--IFQIRTHKTI 205



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC-----DIPPRGLKMA---STFIG 408
           +G +  K+V   +  I+   +  FV+W P   K+ +       +P   ++ A   +  IG
Sbjct: 184 RGDIIPKDVSSSIFQIRTHKTIRFVDWCPTGLKVGIDYQFQQTLPKDDIRKALRSACMIG 243

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+  +F  V  ++ +MF ++AF+HWY  EG
Sbjct: 244 NTTAVSQVFSDVCYKYDSMFAKRAFVHWYINEG 276


>UniRef50_A7M6D9 Cluster: Alpha-tubulin; n=1; Dugesia
           ryukyuensis|Rep: Alpha-tubulin - Dugesia ryukyuensis
          Length = 534

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 30/86 (34%), Positives = 52/86 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  +RF   LN DL +L  N+VP+PR+HF    +AP+       +  L++ E+T ++
Sbjct: 235 SAMTVSIRFGSSLNHDLLQLQTNLVPYPRIHFPAVNYAPILDPHRANHEKLSITEITREL 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           F++ N ++ CD R G+Y++    +RG
Sbjct: 295 FESSNQLIKCDLRLGKYMSCCIQYRG 320



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 29/97 (29%), Positives = 55/97 (56%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR---GLKMAST---- 399
           C   +G ++ ++V+  +  I+ +    FV+W P   K+ +  +PP    G ++A T    
Sbjct: 315 CIQYRGLITPRQVNLGVYEIKRRTDISFVDWCPTGFKLGISPMPPTIVPGSEIAPTERNC 374

Query: 400 -FIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
               NTTA+  +++R+ ++F  +F ++AF+HWY GEG
Sbjct: 375 TMFCNTTAVAQVWQRLDKKFDLLFNKRAFVHWYVGEG 411


>UniRef50_UPI0000DB78C0 Cluster: PREDICTED: similar to Tubulin
           alpha-6 chain (Alpha-tubulin 6) (Alpha-tubulin isotype
           M-alpha-6); n=1; Apis mellifera|Rep: PREDICTED: similar
           to Tubulin alpha-6 chain (Alpha-tubulin 6)
           (Alpha-tubulin isotype M-alpha-6) - Apis mellifera
          Length = 542

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 33/87 (37%), Positives = 49/87 (56%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  +RF G +N  L++L  N+VP+PR+HF    +APL S     Y  +T   +T   
Sbjct: 237 SSITASMRFEGAVNVSLQELQTNLVPYPRIHFSLTTYAPLISPRRGLYAEITTQRITNDC 296

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           F   N M++ DPR G Y +   ++RG+
Sbjct: 297 FIPSNQMLSIDPRTGAYTSCCLLYRGD 323



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAV-----CDIPPRGLKMAS---TFIG 408
           +G +S  +V+  +A+++   S  FV W P   K+ +       +P   L  ++     I 
Sbjct: 321 RGDVSANDVNRTIASLKGAKSIRFVTWAPTGFKVGINYQPTTTVPGGDLAKSNRTVVMIS 380

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           N TA++  +  ++ ++  M++++AF H Y GEG
Sbjct: 381 NNTAMRHRWSMLTRKYDLMYQKRAFFHHYIGEG 413


>UniRef50_UPI0000D9DAEA Cluster: PREDICTED: similar to tubulin, beta
           8; n=1; Macaca mulatta|Rep: PREDICTED: similar to
           tubulin, beta 8 - Macaca mulatta
          Length = 293

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 32/58 (55%), Positives = 39/58 (67%)
 Frame = +1

Query: 334 IPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           +P     AV DI   GLKM++TF+GN  A Q +F+ + EQF AMFR KAF HWY GEG
Sbjct: 18  VPGTSNRAVRDIQLWGLKMSATFVGNNIAFQVLFRCILEQFTAMFRCKAFSHWYMGEG 75



 Score = 39.9 bits (89), Expect = 0.059
 Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A  HW    G DEME TEA +NM DL+SE QQYQ
Sbjct: 66  AFSHWYMGEGMDEMELTEAVTNMKDLMSESQQYQ 99


>UniRef50_A5HWB9 Cluster: Bacterial tubulin A2; n=7;
           Prosthecobacter|Rep: Bacterial tubulin A2 -
           Prosthecobacter debontii
          Length = 497

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 34/88 (38%), Positives = 51/88 (57%), Gaps = 2/88 (2%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNAD--LRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTL 175
           +G+T  +RF G L  +  LR+L  N+VP P LHF    FAPLT     ++  + + E+  
Sbjct: 238 AGLTAPMRFSGFLTVEISLRELLTNLVPQPSLHFLMCTFAPLTPPHQSKFEEMGIEEMIE 297

Query: 176 QMFDAKNMMVACDPRHGRYLTVATIFRG 259
            MF  ++M  AC P  GR+L+ A ++RG
Sbjct: 298 SMFRNESMFAACSPMEGRFLSTAVLYRG 325



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%)
 Frame = +1

Query: 274 EVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQ 453
           + D  LA+I+ +    +  WIP   KI   + P    + +   + N T +  +F+R+   
Sbjct: 332 QADAALASIRGRLPLTY--WIPTAFKIGYVEQPGITHRRSVVLVANNTEVSRVFERICSN 389

Query: 454 FVAMFRRKAFLHWYTGEG 507
           F  +++RKAF +WY  EG
Sbjct: 390 FDKLWQRKAFANWYLNEG 407


>UniRef50_Q7Z1L8 Cluster: Alpha-tubulin; n=2; Eukaryota|Rep:
           Alpha-tubulin - Schmidtea polychroa (Freshwater
           planarian flatworm) (Dugesiapolychroa)
          Length = 489

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 33/97 (34%), Positives = 56/97 (57%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR-----GL---KMAS 396
           C   +G ++ + V+E +  I+ +    FV+W P   KI +   PP      GL   K + 
Sbjct: 315 CLQYRGDITPRAVNEAIFEIKRRTDIKFVDWCPTGFKIGINSQPPTLIPGSGLAPSKSSV 374

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           T I N+TAI T+++ ++++F  +F ++AF+HWY GEG
Sbjct: 375 TMITNSTAIVTMWENINKKFTLLFNKRAFVHWYVGEG 411



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 26/87 (29%), Positives = 51/87 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LR+   LNA+L ++  N++P+PR+HF    ++P+ S     +   +V ELT  +
Sbjct: 235 SAITVSLRYESSLNANLSQIVTNLIPYPRIHFSMVNYSPIVSAQRAAHEQFSVVELTRNV 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           F+  + ++  + + G+Y++    +RG+
Sbjct: 295 FEPGSQLLRVNMKVGKYMSCCLQYRGD 321


>UniRef50_A2EAH1 Cluster: Gamma tubulin, putative; n=5;
           Eukaryota|Rep: Gamma tubulin, putative - Trichomonas
           vaginalis G3
          Length = 457

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQY-RALTVPELTLQMFD 187
           T  LRFP   N DL  L   +VP P+ HF   G+ P+T    +QY +  +V E+  ++ D
Sbjct: 250 TATLRFPAYSNNDLVSLLAPLVPTPKCHFLMTGYTPITLPSMRQYIQKTSVIEVMNRLLD 309

Query: 188 AKNMMVACDPRHGRYLTVATIFRGE 262
            KN+MV+ D  +G Y+++  + +GE
Sbjct: 310 KKNIMVSTDMSNGMYMSILNVLQGE 334



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 17/86 (19%), Positives = 39/86 (45%), Gaps = 3/86 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           +QG +   E+   L  I       F+ W P + ++A+    P      +++   + N T 
Sbjct: 331 LQGEIDPSEIHSALRQIHENQKLRFIPWGPASIQLALSRKSPYVAMPNRVSGLMLANHTN 390

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYT 498
           I+ +F ++   +  + +  A+L+ +T
Sbjct: 391 IRHLFTKIVSDYKGLIKTDAYLNQFT 416


>UniRef50_UPI00006CA67A Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 452

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/98 (32%), Positives = 57/98 (58%), Gaps = 9/98 (9%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGL---KMASTF--- 402
           C   +G +  +++ E +  I++K S  FV++IP   K+ VC   P+ L   +  S F   
Sbjct: 314 CLTARGDIYPRQISESIKIIKSKQSIDFVDFIPTGIKVGVCQKQPKNLLHKEYESKFQRD 373

Query: 403 ---IGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
              + N T+I +IF+ ++++F  M+ ++AF+HWY GEG
Sbjct: 374 AILLANNTSINSIFQIMAQKFNKMYDKRAFVHWYVGEG 411



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 1/104 (0%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRAL-TVPELTLQ 178
           S +T  +RF G LN ++  L  N+V +PR++   P +        ++     TV  L   
Sbjct: 233 SSLTHSMRFKGDLNYNMANLVTNLVCYPRINNTIPSYCSSNFNFIKEKCGQPTVNMLCSS 292

Query: 179 MFDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           +F+ +N  V C+P+ G+YL+     RG+   ++++ + +I ++K
Sbjct: 293 LFNKQNFFVDCNPQQGKYLSCCLTARGDIYPRQISESIKIIKSK 336


>UniRef50_Q9D6T1 Cluster: Tubulin epsilon chain; n=9; Eukaryota|Rep:
           Tubulin epsilon chain - Mus musculus (Mouse)
          Length = 475

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/84 (33%), Positives = 44/84 (52%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+  RF G LN DL ++++N+VPFP+LH+      PL +          + ++    F 
Sbjct: 269 LTSSARFEGSLNMDLNEISMNLVPFPKLHYLVSSLTPLYTLADVNIPPRRLDQMFSDAFS 328

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
             + ++  DPRH  YL  A I RG
Sbjct: 329 KDHQLIQADPRHSLYLACALIVRG 352



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 EVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           ++ +   NI+  K +  FV W     K ++C +PP G   +   + N T ++  F  + E
Sbjct: 355 QISDLRRNIERLKPALQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELRE 414

Query: 451 QFVAMFRRKAFLHWY 495
           +F  ++++KA LH Y
Sbjct: 415 RFTRLYKKKAHLHHY 429


>UniRef50_A7NXT4 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_2, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 100

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/37 (75%), Positives = 30/37 (81%)
 Frame = +2

Query: 143 YRALTVPELTLQMFDAKNMMVACDPRHGRYLTVATIF 253
           Y ALTVPELT QM+DAKNMM A DPRHGRYLT   +F
Sbjct: 64  YHALTVPELTQQMWDAKNMMCATDPRHGRYLTSLAMF 100


>UniRef50_Q5B300 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 804

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/59 (45%), Positives = 37/59 (62%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 178
           S +TT LRF G LN DL +   N+VPFPR+H+    +AP+ S     Y++  V +LTLQ
Sbjct: 694 SSLTTSLRFNGDLNIDLNEFQTNLVPFPRIHYPLILYAPVISSSCSTYKSFKVKDLTLQ 752


>UniRef50_Q6JAE0 Cluster: Putative tubulin gamma-2 chain; n=1; Zea
           mays|Rep: Putative tubulin gamma-2 chain - Zea mays
           (Maize)
          Length = 449

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 33/93 (35%), Positives = 49/93 (52%), Gaps = 6/93 (6%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLT-SRGAQQYRALTVPELTLQ 178
           S  TT LR PG +N DL  L  +++P PR HF   G+ PLT  R     R  TV ++  +
Sbjct: 23  SASTTTLRHPGYMNNDLVGLLASLIPTPRCHFLMTGYTPLTVERQVNMIRKTTVLDVMRR 82

Query: 179 MFDAKNMMVACDPR-----HGRYLTVATIFRGE 262
           +   KN+MV+   R       +Y+++  I +GE
Sbjct: 83  LLQTKNVMVSSYARTKEASQAKYISILNIIQGE 115


>UniRef50_Q24HJ8 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 447

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 26/80 (32%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query: 271 KEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR-GLKMASTFIGNTTAIQTIFKRVS 447
           +E++ +   +   N+ +   WIPN+C I+ C++P +   K+  + I N   I   F++ +
Sbjct: 322 EEIESEYNKLYRSNNIFATNWIPNSCSISYCNVPCQYNSKLIFSIISNYN-ICRHFEKYT 380

Query: 448 EQFVAMFRRKAFLHWYTGEG 507
           +Q+  +FRRKA+LH+Y  EG
Sbjct: 381 QQYSQLFRRKAYLHYYLQEG 400



 Score = 39.9 bits (89), Expect = 0.059
 Identities = 17/22 (77%), Positives = 20/22 (90%)
 Frame = +3

Query: 504 G*DEMEFTEAESNMNDLISEYQ 569
           G DEMEFTEAESN+ND+I +YQ
Sbjct: 400 GMDEMEFTEAESNINDVICDYQ 421



 Score = 36.7 bits (81), Expect = 0.55
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPEL 169
           IT+  R+ G +NA  RK+  N++PFPRL   +    PL     +Q   L   E+
Sbjct: 235 ITSGSRYHGSINASTRKICTNIIPFPRLKHMSMICLPLNYYKQKQQTQLDYIEM 288


>UniRef50_P23258 Cluster: Tubulin gamma-1 chain; n=213; cellular
           organisms|Rep: Tubulin gamma-1 chain - Homo sapiens
           (Human)
          Length = 451

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R+AFL  +  E   K
Sbjct: 384 ISSLFERTCRQYDKLRKREAFLEQFRKEDMFK 415


>UniRef50_Q4S6A2 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=6; Euteleostomi|Rep: Chromosome 9
           SCAF14729, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 416

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 28/67 (41%), Positives = 38/67 (56%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 235 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 294

Query: 182 FDAKNMM 202
           F+  N M
Sbjct: 295 FEPANQM 301



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 8/80 (10%)
 Frame = +1

Query: 292 ANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIGNTTAIQTIFKRVS 447
           AN   K +  FV+W P   K+ +   PP          ++ A   + NTTAI   + R+ 
Sbjct: 298 ANQMTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLD 357

Query: 448 EQFVAMFRRKAFLHWYTGEG 507
            +F  M+ ++AF+HWY GEG
Sbjct: 358 HKFDLMYAKRAFVHWYVGEG 377


>UniRef50_Q23WP5 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 450

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 29/109 (26%), Positives = 59/109 (54%), Gaps = 1/109 (0%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S  T+ +RF G LN DL +L +N+VP+ +++   P ++P T +  QQ + ++V  +T Q+
Sbjct: 236 SATTSSIRFKGDLNFDLNQLIMNLVPYRKINLVIPSYSPSTDKNNQQNQQMSVNSMTNQL 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KK-LTSNWRIFRTKTARIL 325
           F      + C      Y+  + + RG+ + ++ L S + + + K  + +
Sbjct: 296 FKNDFSFINCKINANIYMACSYMIRGDIVPREALESIYNLKKKKNIKFV 344



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 9/96 (9%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGL---------KMASTF 402
           I+G +  +E  E + N++ K +  FV+W  N+  + V    P  +          +    
Sbjct: 319 IRGDIVPREALESIYNLKKKKNIKFVDWCSNSFLLGVNSFKPIPIIIEEKSFSSSVDGCI 378

Query: 403 IGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEGR 510
           + N+  +Q     +  +F  M+ ++AF+HW+ GEG+
Sbjct: 379 LANSCGVQDAIDFIGTKFDLMYSKRAFVHWHYGEGQ 414


>UniRef50_Q9UJT0 Cluster: Tubulin epsilon chain; n=30;
           Eukaryota|Rep: Tubulin epsilon chain - Homo sapiens
           (Human)
          Length = 475

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+  RF G LN DL ++++N+VPFP+LH+      PL +          + ++    F 
Sbjct: 269 LTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFS 328

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
             + ++  DP+H  YL  A + RG
Sbjct: 329 KDHQLLRADPKHSLYLACALMVRG 352



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 EVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           ++ +   NI+  K S  FV W     K ++C +PP G   +   + N T ++  F  + E
Sbjct: 355 QISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKE 414

Query: 451 QFVAMFRRKAFLHWY 495
           +F+ ++++KA LH Y
Sbjct: 415 RFMRLYKKKAHLHHY 429


>UniRef50_Q4SEQ2 Cluster: Chromosome 3 SCAF14614, whole genome
           shotgun sequence; n=2; Euteleostomi|Rep: Chromosome 3
           SCAF14614, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 407

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +  I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 277 RGDVVPKDVNSAIPTIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 336

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 337 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 369


>UniRef50_Q8N532 Cluster: TUBA1C protein; n=9; Amniota|Rep: TUBA1C
           protein - Homo sapiens (Human)
          Length = 325

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 26/74 (35%), Positives = 41/74 (55%)
 Frame = +2

Query: 89  LHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNMMVACDPRHGRYLTVATIFRGECL 268
           +HF    +AP+ S     +  LTV E+T   F+  N MV CDPRHG+Y+    ++RG+ +
Sbjct: 135 VHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVV 194

Query: 269 *KKLTSNWRIFRTK 310
            K + +     +TK
Sbjct: 195 PKDVNAAIATIKTK 208



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 8/82 (9%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP--------RGLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 190 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 249

Query: 409 NTTAIQTIFKRVSEQFVAMFRR 474
           NTTA+   + R+  +F    RR
Sbjct: 250 NTTAVAEAWARLDHKFDLPLRR 271


>UniRef50_UPI0000DB71EB Cluster: PREDICTED: similar to
           epsilon-tubulin 1; n=1; Apis mellifera|Rep: PREDICTED:
           similar to epsilon-tubulin 1 - Apis mellifera
          Length = 420

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 6/107 (5%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQ----QYRALTVPELTL 175
           +T+  RFPG LN D+ ++A N+VP+P+LH+     +P+T         Q R L + E+ +
Sbjct: 213 LTSGSRFPGNLNMDMNEIATNLVPYPKLHYILSSVSPVTLSAPTICNIQGRKL-IDEIFI 271

Query: 176 QMFDAKNMMVACDPRH--GRYLTVATIFRGECL*KKLTSNWRIFRTK 310
             +   N  +  DP       L+ A I RG C    L  N   FR K
Sbjct: 272 NAWSRNNQSIKLDPLQTGSMILSAAHIARGNCSVNDLKRNIEKFRKK 318



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/82 (24%), Positives = 46/82 (56%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G  S+ ++   +   + K +  F +W     KI +C +PP G   +   + N++++ ++
Sbjct: 300 RGNCSVNDLKRNIEKFRKKVT--FAKWGTEAMKIGLCSVPPAGHSTSLLCLLNSSSMISL 357

Query: 433 FKRVSEQFVAMFRRKAFLHWYT 498
           F+ + +QF  +++RKA ++ YT
Sbjct: 358 FENIIKQFTRLYKRKAHVYHYT 379


>UniRef50_Q4QC95 Cluster: Epsilon tubulin, putative; n=6;
           Trypanosomatidae|Rep: Epsilon tubulin, putative -
           Leishmania major
          Length = 470

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLT-SRGAQQYRALTVPELTLQ 178
           S +T  +RFPG LN D+ ++  N+VPFPRLHF T   APL+ S         TV  +   
Sbjct: 253 SNLTCAMRFPGPLNMDINEITTNLVPFPRLHFLTAAIAPLSVSSKHAAVGPRTVDAMITA 312

Query: 179 MFDAKNMMVACDPRHGR 229
             D  +  V  D RHG+
Sbjct: 313 CLDPGHQFV--DVRHGQ 327


>UniRef50_A1CPB9 Cluster: Tubulin gamma chain; n=9; Fungi/Metazoa
           group|Rep: Tubulin gamma chain - Aspergillus clavatus
          Length = 488

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQ---YRALTVPELT 172
           S  TT LR+PG ++ DL  +  +++P PR HF    + P T    +Q    R  TV ++ 
Sbjct: 269 SASTTTLRYPGYMHNDLVGIIASLIPTPRSHFLITSYTPFTGDNVEQAKTVRKTTVLDVM 328

Query: 173 LQMFDAKNMMVACDP-RHGRYLTVATIFRGE 262
            ++   KN MV+ +P +   Y+++  I +GE
Sbjct: 329 RRLLQPKNRMVSINPSKSSCYMSILNIIQGE 359



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG     +V + L  I+ +    F+ W P + ++A+    P      +++   + N T+
Sbjct: 356 IQGEADPTDVHKSLLRIRERRLASFIPWGPASIQVALTKKSPYIQNTHRVSGLMLANHTS 415

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGE 504
           + T+FKR+  Q+  + +R AFL  Y  E
Sbjct: 416 VATLFKRIVSQYDRLRKRNAFLEQYKKE 443


>UniRef50_Q0D0J3 Cluster: Tubulin gamma chain; n=6; Fungi/Metazoa
           group|Rep: Tubulin gamma chain - Aspergillus terreus
           (strain NIH 2624)
          Length = 450

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRG---AQQYRALTVPELT 172
           S  TT LR+PG ++ DL  +  +++P PR HF    + P T      A+  R  TV ++ 
Sbjct: 231 SASTTTLRYPGYMHNDLCGIVASLIPTPRSHFLITSYTPFTGDNIDQAKTVRKTTVLDVM 290

Query: 173 LQMFDAKNMMVACDP-RHGRYLTVATIFRGE 262
            ++   KN MV+ +P +   Y+++  I +GE
Sbjct: 291 RRLLQPKNRMVSINPSKSSCYISILNIIQGE 321



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG     +V + L  I+ +    F+ W P + ++A+    P      +++   + N T+
Sbjct: 318 IQGEADPTDVHKSLLRIRERRLASFIPWGPASIQVALTKKSPYVQNTHRVSGLMLANHTS 377

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGE 504
           + T+FKR+ +Q+  + +R AFL  Y  E
Sbjct: 378 VATLFKRIVQQYDRLRKRGAFLEQYKKE 405


>UniRef50_Q22YZ9 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 498

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +2

Query: 20  LRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNM 199
           +RF G LN DL ++ +N+VP+P LHF     APL S      +   + ++    +     
Sbjct: 300 MRFEGVLNVDLNEITMNLVPYPDLHFLISSIAPLYSLSDSNLQPRRLDQMFKDCYHPDYQ 359

Query: 200 MVACDPRHGRYLTVATIFRG 259
           +V+ +P   +YL V  + RG
Sbjct: 360 LVSVNPFQNKYLAVGLMVRG 379



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/83 (25%), Positives = 44/83 (53%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQT 429
           ++G +   +V+  +  ++++ +  +  W     K  +C+ PP G   +   + N TAI+ 
Sbjct: 377 VRGSVPFSDVNRNIKKLRSELNMIY--WNQEGFKYGICNTPPIGQPYSLLCLANNTAIRD 434

Query: 430 IFKRVSEQFVAMFRRKAFLHWYT 498
            F  + E+F  +++RK F+H YT
Sbjct: 435 QFSTMVERFNKLYKRKVFVHHYT 457


>UniRef50_Q22E27 Cluster: Tubulin/FtsZ family, C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 281

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 253 QGR-MSMKEVDEQLAN--IQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAI 423
           +GR +S  EV++ ++   I  + +  F EWI ++  +A C+ PP+G   +   + N   I
Sbjct: 156 RGRNISTGEVEQSVSQLLINKRKNKEFSEWIESSISLAYCNTPPKGATNSVQILSNYAGI 215

Query: 424 QTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             +F  +  +F   F +K++LH+Y  EG
Sbjct: 216 HRVFTDLVNKFRQQFTKKSYLHYYLQEG 243



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 27/85 (31%), Positives = 43/85 (50%)
 Frame = +2

Query: 5   GITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMF 184
           G++  +RFPGQLN   RKLA N++PF R  F      PL+ +      + T  EL    +
Sbjct: 73  GLSAGIRFPGQLNISTRKLATNLIPFRRYSFLLNQLYPLSGKNFNHASSFTERELVDCFW 132

Query: 185 DAKNMMVACDPRHGRYLTVATIFRG 259
              N  ++      +++T+  +FRG
Sbjct: 133 RLDNTFLSNIEEQEKFMTLYGLFRG 157


>UniRef50_A6RFR4 Cluster: Tubulin gamma chain; n=1; Ajellomyces
           capsulatus NAm1|Rep: Tubulin gamma chain - Ajellomyces
           capsulatus NAm1
          Length = 655

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQ---YRALTVPELT 172
           S  TT LR+PG ++ DL  +  N++P PR  F    + P T    +Q    R  TV ++ 
Sbjct: 439 SASTTTLRYPGYMHNDLVSILANLIPDPRTRFLITSYTPFTGDNVEQAKTVRKTTVLDVM 498

Query: 173 LQMFDAKNMMVACDP-RHGRYLTVATIFRGE 262
            ++   KN MV+  P +   Y+++  I +GE
Sbjct: 499 RRLLQPKNRMVSIVPSKSSCYISIFNIIQGE 529



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAV---CDIPPRGLKMASTFIGNTTA 420
           IQG  +  +VD+ +  I+ +    F+ W P +  +AV       P   +++   + N T+
Sbjct: 526 IQGEAAQTDVDKSILRIRERRLATFIPWGPASIHVAVPKRSPYLPNTHRVSGLMLANHTS 585

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGE 504
           + T+FKR+  Q+  + +R AFL  Y  E
Sbjct: 586 VATLFKRIVSQYDRLRKRNAFLEQYKKE 613


>UniRef50_UPI00005A2266 Cluster: PREDICTED: similar to Tubulin
           alpha-2 chain (Alpha-tubulin 2); n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to Tubulin alpha-2
           chain (Alpha-tubulin 2) - Canis familiaris
          Length = 250

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 8/92 (8%)
 Frame = +1

Query: 256 GRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIGN 411
           G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++     + N
Sbjct: 105 GYVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPSGDLAKVERVVCMLRN 164

Query: 412 TTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
            TAI   + R+  +F  M+ + AF+HWY  EG
Sbjct: 165 ITAIADAWARLDHKFGLMYAKHAFVHWYVAEG 196


>UniRef50_A7TZ32 Cluster: Beta-tubulin; n=1; Lepeophtheirus
           salmonis|Rep: Beta-tubulin - Lepeophtheirus salmonis
           (salmon louse)
          Length = 84

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/39 (71%), Positives = 31/39 (79%), Gaps = 3/39 (7%)
 Frame = +3

Query: 471 AESLLALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           +E  L+L HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 28  SEEKLSL-HWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 65


>UniRef50_UPI0000D5556D Cluster: PREDICTED: similar to
           epsilon-tubulin 1; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to epsilon-tubulin 1 - Tribolium
           castaneum
          Length = 432

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/64 (31%), Positives = 37/64 (57%)
 Frame = +1

Query: 307 KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFL 486
           K+  +F  W     K+ +C++ P+GL  +   + NT++   +F+ V  QF  +++RKA +
Sbjct: 336 KSKLHFACWSNKAVKVGLCNVAPKGLDFSMFSLCNTSSTSNLFQEVLNQFTKLYQRKAHV 395

Query: 487 HWYT 498
           H YT
Sbjct: 396 HHYT 399



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/55 (36%), Positives = 35/55 (63%), Gaps = 4/55 (7%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLT----SRGAQQYRALTV 160
           +T+  RF G++N D+ ++  NMVPFP+L+F   G++P      +  A +Y A++V
Sbjct: 261 LTSGSRFGGKMNIDMNEINTNMVPFPKLNFLASGYSPFRLKNFNSSAHRYMAMSV 315


>UniRef50_UPI00015B54E0 Cluster: PREDICTED: similar to Tubulin,
           epsilon 1; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to Tubulin, epsilon 1 - Nasonia vitripennis
          Length = 478

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 22/81 (27%), Positives = 43/81 (53%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G  S+ ++   +   QNK    F  W     KI +C +PP G   +   + N+T++  +
Sbjct: 358 RGDSSLTDIRRNIERFQNKAK--FTSWSKEAMKIGLCSVPPAGHPASLLCMMNSTSMSLL 415

Query: 433 FKRVSEQFVAMFRRKAFLHWY 495
           FK + +QF  +++++A +H Y
Sbjct: 416 FKDIIQQFDRLYKKQAHIHHY 436



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 5/106 (4%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQ---QYRALTVPELTLQ 178
           +T+  RFPG LN D+ +LA N+V +P+LH+     +P+    +Q           EL   
Sbjct: 271 LTSGSRFPGCLNTDMNELATNLVAYPQLHYIFSSVSPVALTASQISTTNGTKYQDELFTN 330

Query: 179 MFDAKNMMVACDPRHGRYLTV--ATIFRGECL*KKLTSNWRIFRTK 310
            +   N ++  DP     L +  A I+RG+     +  N   F+ K
Sbjct: 331 AWSRNNQLIKVDPLQSGSLVIGAAHIYRGDSSLTDIRRNIERFQNK 376


>UniRef50_Q4UCK3 Cluster: Tubulin gamma-chain (Gamma-tubulin),
           putative; n=2; Theileria|Rep: Tubulin gamma-chain
           (Gamma-tubulin), putative - Theileria annulata
          Length = 490

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 28/86 (32%), Positives = 45/86 (52%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T+C+RFPG +N DL  L  ++V  PR HF       L S     +  +T+  L  ++
Sbjct: 286 SSVTSCIRFPGPINNDLISLVSSLVIIPRCHF-------LIS-SIMDHENITLLNLVKKL 337

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           +   N +V    ++G+YL+   I RG
Sbjct: 338 YYPNNFLVYTSTKNGKYLSALNIIRG 363


>UniRef50_Q3SEG3 Cluster: Beta tubulin,putative; n=2; Paramecium
           tetraurelia|Rep: Beta tubulin,putative - Paramecium
           tetraurelia
          Length = 426

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 19/40 (47%), Positives = 27/40 (67%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSR 130
           T   RFPG LN  ++KL +N++PFPRLHF+ P +  +  R
Sbjct: 232 TASYRFPGFLNGGMKKLTLNLIPFPRLHFFQPSYMIINQR 271



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 19/21 (90%), Positives = 20/21 (95%)
 Frame = +3

Query: 504 G*DEMEFTEAESNMNDLISEY 566
           G DEMEFTEAESN+NDLISEY
Sbjct: 385 GMDEMEFTEAESNINDLISEY 405


>UniRef50_Q24D62 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 459

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/65 (40%), Positives = 36/65 (55%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG T   RFP Q+   +RKLA NMVPFP+L F   G AP+        R+L+  E+   +
Sbjct: 232 SGTTAQWRFPSQVYNTMRKLATNMVPFPQLLFLNTGVAPILHHEFVTNRSLSTKEMISML 291

Query: 182 FDAKN 196
            + +N
Sbjct: 292 QNNRN 296



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +1

Query: 265 SMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRG-LKMASTFIGNTTAIQTIFKR 441
           S +E+ E++ + Q K   Y    IP+N K+  C+       + ++  + N T++  I + 
Sbjct: 322 SEQEILEEIQDQQIKTQYY----IPDNQKVYQCNQTFNNEFRNSALKLENGTSVTEILQE 377

Query: 442 VSEQFVAMFRRKAFLHWYTGE 504
             + F A+F+RKAFLH+  G+
Sbjct: 378 QLQNFSALFKRKAFLHYGFGD 398



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/23 (60%), Positives = 19/23 (82%)
 Frame = +3

Query: 510 DEMEFTEAESNMNDLISEYQQYQ 578
           DEMEFTEA+S +ND++  Y Q+Q
Sbjct: 400 DEMEFTEAQSYLNDILDLYNQHQ 422


>UniRef50_Q22CD2 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 443

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 24/86 (27%), Positives = 41/86 (47%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF  +    L     N++P+P+  F    ++P           L+  E++  +
Sbjct: 233 SQLTCGLRFDDEQQNHLSDFEKNLIPYPKFCFMLSSYSPFIFTQQINSIQLSTQEISSFL 292

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           F+  NMM  C+P  G+Y+ V   +RG
Sbjct: 293 FEPSNMMAKCNPSFGKYMAVDITYRG 318



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 8/87 (9%)
 Frame = +1

Query: 271 KEVDEQLANIQNKNSTYFVEWIPNNCKIAV-----CDIPPRGLKMA--STF-IGNTTAIQ 426
           K + +   + + K +  FV W  +  K+       C +P      +  S F + N+T+I 
Sbjct: 324 KHIGQSFNSWKEKKTLQFVNWCQSYIKLKAIYNIPCIVPQSSFAYSNKSVFMVSNSTSIS 383

Query: 427 TIFKRVSEQFVAMFRRKAFLHWYTGEG 507
            +F R++ +F  MF ++ F H Y  EG
Sbjct: 384 EVFSRINNRFDQMFTKRQFTHLYQSEG 410


>UniRef50_Q3SD83 Cluster: Beta tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Beta tubulin,putative - Paramecium
           tetraurelia
          Length = 430

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +2

Query: 23  RFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPL 121
           RFPG  N D +KL+ N++PFPRLHF T  F P+
Sbjct: 237 RFPGYQNGDQKKLSTNLIPFPRLHFLTCAFTPI 269



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/61 (39%), Positives = 33/61 (54%)
 Frame = +1

Query: 325 VEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGE 504
           +EWIP+      C I  R L   +  +GN   +   FK+  E F A FRRKAF+H+Y  +
Sbjct: 327 IEWIPDAVFHINCKIENRNLGKTAMHVGNHRDLGHSFKQHCEIFTANFRRKAFIHYYLQD 386

Query: 505 G 507
           G
Sbjct: 387 G 387



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/24 (87%), Positives = 21/24 (87%)
 Frame = +3

Query: 504 G*DEMEFTEAESNMNDLISEYQQY 575
           G DEMEFTEAESNMND ISEYQ Y
Sbjct: 387 GMDEMEFTEAESNMNDFISEYQDY 410


>UniRef50_UPI0000660846 Cluster: Homolog of Notothenia coriiceps
           "Alpha tubulin.; n=1; Takifugu rubripes|Rep: Homolog of
           Notothenia coriiceps "Alpha tubulin. - Takifugu rubripes
          Length = 306

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/86 (25%), Positives = 41/86 (47%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQT 429
           +Q  +  KEVD     I++ ++  FV+W P   K+ +   PP  +           A+  
Sbjct: 190 VQANLVPKEVDTATGTIKSSHNIQFVDWCPTGFKVGINYQPPTVVPGGHLAKVQGCAVAE 249

Query: 430 IFKRVSEQFVAMFRRKAFLHWYTGEG 507
            +  +  +   M+ ++AF+HWY G+G
Sbjct: 250 AWAHLDHKCDLMYTKRAFVHWYEGKG 275


>UniRef50_Q3SEF9 Cluster: Alpha-tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 551

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/88 (26%), Positives = 42/88 (47%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T   RF G    DL ++ +N+VP P   F    +AP  +   Q      + ++T  +
Sbjct: 238 SSVTQSSRFNGSKFVDLIEMRMNVVPEPDFQFLHASYAPFINIDKQNTELTNLQQITNSL 297

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGEC 265
           FD ++  +  + +  +Y+     FRG+C
Sbjct: 298 FDQRSSFINYNHKTVKYMAANLFFRGDC 325


>UniRef50_Q3SEG7 Cluster: Theta tubuline, putative; n=1; Paramecium
           tetraurelia|Rep: Theta tubuline, putative - Paramecium
           tetraurelia
          Length = 417

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 4/63 (6%)
 Frame = +2

Query: 20  LRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMF----D 187
           +RFPG  N DLRKLAVN++ FPR+HF +  F  ++       +   + E   Q F    D
Sbjct: 232 MRFPGYQNGDLRKLAVNLISFPRMHFLSNAFCVISPSKILSNQIYKLTEPANQNFTFSED 291

Query: 188 AKN 196
           AKN
Sbjct: 292 AKN 294



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 14/24 (58%), Positives = 19/24 (79%)
 Frame = +3

Query: 504 G*DEMEFTEAESNMNDLISEYQQY 575
           G DE++F EAES+++DL SEY  Y
Sbjct: 383 GADELDFVEAESSVSDLFSEYISY 406


>UniRef50_Q5B2Z8 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 599

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/59 (37%), Positives = 33/59 (55%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 178
           S +TT L F   LN DL +   N+VPFP +++    + P+ S     Y++  V +LTLQ
Sbjct: 165 SSLTTSLHFNSDLNIDLNEFQTNLVPFPCIYYPLILYTPVISSSCSTYKSFKVKDLTLQ 223


>UniRef50_Q8IK81 Cluster: Tubulin, putative; n=9; Plasmodium|Rep:
           Tubulin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 519

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/94 (26%), Positives = 46/94 (48%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+ +RF G LN D+ ++  N++P+P  +F     +P     ++  R  T   L   +  
Sbjct: 267 LTSSMRFEGSLNVDINEICTNLIPYPFFNFLLSSLSPCIE--SESIR--TFDHLFKNVLS 322

Query: 188 AKNMMVACDPRHGRYLTVATIFRGECL*KKLTSN 289
             N M+  +P+ G  L++A + RG      +T N
Sbjct: 323 QNNQMLIANPKDGLSLSMAFLVRGNINISDVTKN 356



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 21/82 (25%), Positives = 46/82 (56%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQT 429
           ++G +++ +V + +  I  KN+   +++  +  KI +C++ P     +   + N+  I+ 
Sbjct: 344 VRGNINISDVTKNVLLI--KNNLNILKYNKDATKIGICNVSPLNQPYSLLCLINSCEIRN 401

Query: 430 IFKRVSEQFVAMFRRKAFLHWY 495
            F ++ E+F  +F+RKA LH Y
Sbjct: 402 TFLQILERFNKLFKRKAHLHHY 423


>UniRef50_Q7QZN1 Cluster: GLP_680_43068_44504; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_680_43068_44504 - Giardia lamblia
           ATCC 50803
          Length = 478

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/51 (49%), Positives = 31/51 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRAL 154
           S IT  +RF G+LN DL +L+VN+VPFP L+      APL    A  YR L
Sbjct: 267 SCITASMRFGGELNVDLNELSVNLVPFPELNLVCTSLAPLPM--APPYRTL 315


>UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba
           histolytica|Rep: Tubulin gamma chain - Entamoeba
           histolytica
          Length = 451

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 3/85 (3%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGN 411
           CD  QG +S  E++E L    ++    FV W     K+    + P   RG +M+   + N
Sbjct: 311 CDFFQGDVSYDEINEALQRFTDRRLAEFVPWNKEAIKVVHTRVSPLVKRGNRMSGMLLAN 370

Query: 412 TTAIQTIFKRVSEQFVAMFRRKAFL 486
            T+I+  F+ + + F  MF+++ +L
Sbjct: 371 NTSIRYYFQDILKAFDQMFKKRVYL 395



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 21/87 (24%), Positives = 39/87 (44%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S  T  LRFP  L   L  L +++ P    HF    + PL        R   + ++  ++
Sbjct: 232 SAFTANLRFPSTLYNSLNSLMIHLCPSRFSHFLMTSYTPLRQVNQISSRTSAI-DVMKRL 290

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
              +N+M     + G+Y+++   F+G+
Sbjct: 291 IQPQNIMARTRLKEGKYISMCDFFQGD 317


>UniRef50_Q3ZJ98 Cluster: Tubulin gamma subunit; n=1;
           Monocercomonoides sp. PA203|Rep: Tubulin gamma subunit -
           Monocercomonoides sp. PA203
          Length = 479

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRG-AQQYRALTVPELTLQMFD 187
           T+ LRFP  +N DL  +  +++P PR HF    + P TS    Q  R  +V ++  ++  
Sbjct: 241 TSTLRFPSYMNNDLVSILSSLIPTPRCHFLMTAYTPFTSTTVTQSIRKTSVMDVLRRLLH 300

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
               MV+     G + ++  I +G
Sbjct: 301 PHQAMVSVSTSRGFFSSLLAIIQG 324


>UniRef50_A4D1N8 Cluster: Similar to beta-tubulin; n=2;
           Homo/Pan/Gorilla group|Rep: Similar to beta-tubulin -
           Homo sapiens (Human)
          Length = 98

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 28/52 (53%), Positives = 32/52 (61%)
 Frame = +3

Query: 420 HTDHIQEGV*AVRGYV*AESLLALVHW*G*DEMEFTEAESNMNDLISEYQQY 575
           H  H   GV  V  +   + L ALVH  G DEMEFTEA+ NMNDL+  YQQY
Sbjct: 30  HQQHNHSGV--VLCHFQTQGLPALVHE-GMDEMEFTEAKCNMNDLVFAYQQY 78


>UniRef50_Q7R2Q0 Cluster: GLP_546_6876_8351; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_546_6876_8351 - Giardia lamblia ATCC
           50803
          Length = 491

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 3/85 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           +QG     ++ + L  I+      F++W P+N ++A+    P      K++   + N TA
Sbjct: 363 VQGEAESNQLYKSLQQIKEGRDVKFIDWGPSNMQMALSKRSPFTNEAHKVSGLMLANHTA 422

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWY 495
           I+ IF  ++  F  +F ++A+L  Y
Sbjct: 423 IRKIFDNINNTFTQLFSKRAYLQNY 447



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS 127
           T+ LR PG ++ DL  L  ++VP PRLHF    + P+TS
Sbjct: 259 TSTLRLPGFMSNDLLSLVSSLVPTPRLHFLMSSYTPITS 297


>UniRef50_Q24D61 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 441

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHF 97
           SG+T   RFP Q++ D+RK A+N+VPFP L++
Sbjct: 232 SGVTALWRFPSQISNDIRKFAMNLVPFPNLNY 263


>UniRef50_Q22UN3 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 431

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +2

Query: 14  TC-LRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDA 190
           TC +R+PG +NA  RK+  N+VPF R+   T  F P       Q   L + ++  Q  + 
Sbjct: 237 TCGIRYPGSINASSRKICTNLVPFARVKMMTATFLPFNYFRQNQISQLELTDMIPQTLNE 296

Query: 191 KN 196
           KN
Sbjct: 297 KN 298



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 15/22 (68%), Positives = 17/22 (77%)
 Frame = +3

Query: 504 G*DEMEFTEAESNMNDLISEYQ 569
           G DEMEF EA+ N  DLI+EYQ
Sbjct: 399 GMDEMEFQEAKYNTADLITEYQ 420


>UniRef50_UPI0000DC0F37 Cluster: UPI0000DC0F37 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0F37 UniRef100 entry -
           Rattus norvegicus
          Length = 410

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 6/97 (6%)
 Frame = +1

Query: 235 DRCDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCD---IPPRGL---KMAS 396
           D C      M  K+V+  +A I+ K++  FV+W     +        IP   L   + A 
Sbjct: 277 DCCLLYHSDMVPKDVNVVIATIKTKHTIQFVDWYSTGFRFGYQPPTVIPGSNLSKNQRAV 336

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NT AI  ++  +  +   M+ + AF+HWY  EG
Sbjct: 337 CMLSNTIAIAEVWTHLDHKLDVMYAKHAFVHWYVDEG 373



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 26/100 (26%), Positives = 46/100 (46%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDA 190
           T  L F G L+ DL +   N+V +P++HF    +  + S     +   +V E+T   F+ 
Sbjct: 207 TASLGFDG-LDVDLTEFQTNLVHYPQMHF-PATYTLVISTEKAYHEQHSVAEITSTCFEP 264

Query: 191 KNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
            N MV C   HG+ +    ++  + + K +       +TK
Sbjct: 265 ANHMVKC---HGKNMDCCLLYHSDMVPKDVNVVIATIKTK 301


>UniRef50_A2ELX8 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Tubulin/FtsZ family, GTPase domain containing protein -
           Trichomonas vaginalis G3
          Length = 434

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 2/86 (2%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T   RF G++N DL ++  NMVPFP   F   G +P+  +   +       E       
Sbjct: 236 LTAGSRFSGKMNVDLSEIETNMVPFPHHKFLVGGISPIYPKNPPRSEKSFFSEA------ 289

Query: 188 AKNMMVACDPRH--GRYLTVATIFRG 259
             N    CD  H  G YL+ A + RG
Sbjct: 290 MSNKATLCDIDHSQGTYLSTALLIRG 315



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 21/86 (24%), Positives = 40/86 (46%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQT 429
           I+G +S   V +    +  K    F +W   + KI +C  P    K++   + NTT+I  
Sbjct: 313 IRGNISESSVQQNTTQLAEKMK--FPKWNTEHWKIGLCSTPSLTSKISICSLCNTTSITG 370

Query: 430 IFKRVSEQFVAMFRRKAFLHWYTGEG 507
           +F  +  ++  +  R A++H +   G
Sbjct: 371 MFDTILGRYTKLASRGAYIHLFNDNG 396


>UniRef50_Q15670 Cluster: Alpha-tubulin isotype H2-alpha; n=5;
           Euteleostomi|Rep: Alpha-tubulin isotype H2-alpha - Homo
           sapiens (Human)
          Length = 98

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +1

Query: 364 DIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           D+ P  ++ A   + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 15  DLAP--VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 60


>UniRef50_UPI0000DC0C7D Cluster: UPI0000DC0C7D related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0C7D UniRef100 entry -
           Rattus norvegicus
          Length = 366

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/79 (26%), Positives = 36/79 (45%)
 Frame = +1

Query: 271 KEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           K+V+  +A I+ K +T+FV+W P   K+ +   PP  +                     E
Sbjct: 264 KDVNAAIATIKTKCTTHFVDWCPTGFKVGINYQPPTVVHGGDLTKVWRAVFMLSSTTADE 323

Query: 451 QFVAMFRRKAFLHWYTGEG 507
           +F  +  ++ F+HWY  EG
Sbjct: 324 KFDLICAKQPFMHWYVSEG 342



 Score = 39.9 bits (89), Expect = 0.059
 Identities = 26/103 (25%), Positives = 44/103 (42%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LR+ G L+        ++VP+P +HF      P T+    Q   +         
Sbjct: 186 SSITVSLRYHGALDLVWTAFQTSLVPYPCIHF-PRAIKPTTNNFKLQRSPMPA------- 237

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
               N MV CDP+H +Y+    ++  + + K + +     +TK
Sbjct: 238 ----NQMVKCDPQHSKYMACCLLYHDDVVPKDVNAAIATIKTK 276


>UniRef50_Q3SEG4 Cluster: Alpha-tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 461

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/88 (23%), Positives = 40/88 (45%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           + IT+  R   +   DL+ +  N+V  P L F    +AP   R  Q   ++ + +++  +
Sbjct: 235 ASITSTQRLNSENFVDLQDMYQNLVLLPELQFLHTSYAPFIQRDQQNSSSVNLLQISQAL 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGEC 265
           F+     +   P   +Y  V   +RG+C
Sbjct: 295 FNEAGSFIKFTPNPSQYFGVNLFYRGDC 322



 Score = 39.5 bits (88), Expect = 0.078
 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 9/90 (10%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---------RGLKMASTFI 405
           +G     ++   +  ++N     F +W+P N ++A+              RG K A   +
Sbjct: 319 RGDCPYSDLQSTINELKNSKCINFADWVPINYQVAMSSKSTVQFHNAELGRGNKTAC-LV 377

Query: 406 GNTTAIQTIFKRVSEQFVAMFRRKAFLHWY 495
            N+T I    K +  +F  ++++K FLHW+
Sbjct: 378 ANSTRILNPLKNIQSRFKNLYQKKCFLHWF 407


>UniRef50_P53378 Cluster: Tubulin gamma chain; n=5;
           Saccharomycetales|Rep: Tubulin gamma chain -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 473

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 3/83 (3%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQ---YRALTVPELT 172
           S +T  +RFP  + + +  +   ++P P LHF +P F P TS        ++  +  ++ 
Sbjct: 236 SSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVM 295

Query: 173 LQMFDAKNMMVACDPRHGRYLTV 241
           L + D  N +V+    +  Y  V
Sbjct: 296 LDLLDPSNSLVSTAMNNPTYFNV 318


>UniRef50_UPI000155C428 Cluster: PREDICTED: similar to tubulin
           alpha-3 chain - Chinese hamster; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to tubulin alpha-3
           chain - Chinese hamster - Ornithorhynchus anatinus
          Length = 300

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +1

Query: 403 IGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 2   LSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 36


>UniRef50_UPI00005A03AE Cluster: PREDICTED: similar to tubulin,
           alpha 1; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to tubulin, alpha 1 - Canis familiaris
          Length = 300

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRA 151
           S IT  L F G LN DL +   N+VP+PR+HF    +A    +   + R+
Sbjct: 240 SSITASLGFDGALNVDLMEFQTNLVPYPRIHFPLATYAISAEKAYHEQRS 289


>UniRef50_A1BPT4 Cluster: Tubulin-like protein; n=1; Lygus
           lineolaris|Rep: Tubulin-like protein - Lygus lineolaris
           (Tarnished plant bug)
          Length = 242

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +TT LRF  +L  D      N++P+PRLHF     +P+      +Y   TV ++T + 
Sbjct: 162 SSMTTGLRFDCRLMTDFFDFQTNLIPYPRLHFPVVSLSPIVXCQFDEY--WTVNDITSRA 219

Query: 182 FDAKNMMVACDPRHGRYL 235
           F++   +     R G ++
Sbjct: 220 FESSCRLANHRGRQGTHM 237


>UniRef50_UPI00005A5664 Cluster: PREDICTED: similar to tubulin alpha
           6; n=1; Canis lupus familiaris|Rep: PREDICTED: similar
           to tubulin alpha 6 - Canis familiaris
          Length = 182

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +1

Query: 370 PPRGLKM-ASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           P +G  + A   + N TAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 99  PGQGAALRAVCMLSNPTAIAQAWARLDHKFELMYAKRAFVHWYVGEG 145


>UniRef50_Q3SEH6 Cluster: Iota_tubulin,putative; n=2; Paramecium
           tetraurelia|Rep: Iota_tubulin,putative - Paramecium
           tetraurelia
          Length = 408

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 19/86 (22%), Positives = 39/86 (45%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQT 429
           + G   +  V ++       +   FV WI +     VC +  +   + +  I + TAI  
Sbjct: 291 VYGDTDVFSVQQEFKQTLTSDEVQFVRWIADPITYTVCPVKQKQCDLMAFSINHHTAIGN 350

Query: 430 IFKRVSEQFVAMFRRKAFLHWYTGEG 507
               + +Q+  +F++KA+LH +  +G
Sbjct: 351 KLNLLQQQYRTLFQKKAYLHLFLQDG 376



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = +2

Query: 5   GITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS 127
           GI    R     N +  K+  N+ PFP+LH YT   APL S
Sbjct: 213 GIYKSFRHNSYSNTNFYKIQTNITPFPKLHCYTVSLAPLFS 253


>UniRef50_Q49MM4 Cluster: Beta-tubulin; n=1; Cactodera betulae|Rep:
           Beta-tubulin - Cactodera betulae
          Length = 83

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 22/56 (39%), Positives = 29/56 (51%)
 Frame = +2

Query: 26  FPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAK 193
           FPG       ++     P P          PL+++GA  Y+AL+V ELT QMFDAK
Sbjct: 28  FPGSTECRPSQVGRQHGPLPAPALLHARLRPLSAKGAAAYQALSVSELTKQMFDAK 83


>UniRef50_A0EC94 Cluster: Chromosome undetermined scaffold_89, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_89,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 624

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 19/88 (21%), Positives = 39/88 (44%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S I+  +RF G    D   +  N++  P+  F    ++P      Q  +   +  +T  +
Sbjct: 236 SSISQSIRFRGTKLVDFNDMRTNLITTPKQQFLWTSYSPFIYTDQQHLKKPNLQNITESL 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGEC 265
           FD    +++ +    +YL  +  F+G+C
Sbjct: 296 FDDNGHLLSFNRLTHKYLGSSLFFKGDC 323


>UniRef50_UPI00005A297F Cluster: PREDICTED: similar to tubulin,
           alpha 1; n=2; Eutheria|Rep: PREDICTED: similar to
           tubulin, alpha 1 - Canis familiaris
          Length = 127

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = +1

Query: 271 KEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           K+V+  +A I+ K++  FV+W P + K+ +          A T +      +        
Sbjct: 25  KDVNAAIATIKTKHTIQFVDWCPTDFKVGIN-------YQAPTVVPGRHLAEV------- 70

Query: 451 QFVAMFRRKAFLHWYTGEG 507
           QF  ++ ++AF+HWY GEG
Sbjct: 71  QFDLIYAKRAFVHWYVGEG 89



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = +2

Query: 200 MVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           MV CDPRHG+Y+    ++  + + K + +     +TK
Sbjct: 1   MVKCDPRHGKYMACCLLYHADVVPKDVNAAIATIKTK 37


>UniRef50_UPI000156080D Cluster: PREDICTED: similar to Tubulin,
           alpha 3c; n=1; Equus caballus|Rep: PREDICTED: similar to
           Tubulin, alpha 3c - Equus caballus
          Length = 186

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = +2

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F++ N MV CDP HG+Y+    ++ GE + K + +     +TK
Sbjct: 27  FESSNQMVKCDPYHGQYVECCMLYCGEVVSKDVNAAIATIKTK 69


>UniRef50_A7Q8W1 Cluster: Chromosome chr5 scaffold_64, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_64, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 205

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +2

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +M   CDPRHG+Y+    I+RG+   K + +   I + K
Sbjct: 45  FEPSSMTATCDPRHGKYIASCMIYRGDVAPKGVNAAVAIVKIK 87


>UniRef50_Q3SEF7 Cluster: Alpha-tubulin,putative; n=3; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 426

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +2

Query: 41  NADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           N D  KL   + P+PR+HF  P + PL S      + LT  +L  Q+
Sbjct: 230 NIDNSKLFTGLCPYPRVHFVIPSYGPLASINDYNNKELTEKQLISQI 276



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 12/42 (28%), Positives = 26/42 (61%)
 Frame = +1

Query: 382 LKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           LK    F+ N  ++   F+ + +++  ++ ++AF+HW+ GEG
Sbjct: 345 LKQTGIFLSNDASLFNYFELLGKKYDYVYAKRAFVHWFVGEG 386


>UniRef50_A0BQ87 Cluster: Chromosome undetermined scaffold_120,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_120,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 178

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +1

Query: 310 NSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLH 489
           N  Y + W     K+   DI    L   +  I N TAI+ +F R+  +F  M+ +K  ++
Sbjct: 82  NKIYQINWCTKGFKL---DINYNLLP--AYMISNKTAIEEVFARIDYKFDLMYSKKVLIY 136

Query: 490 WYTGEG 507
           W+  EG
Sbjct: 137 WFIQEG 142


>UniRef50_A7R175 Cluster: Chromosome undetermined scaffold_340,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_340, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 568

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/20 (70%), Positives = 19/20 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKL 61
           SG+T+CLRF GQL++DL+KL
Sbjct: 120 SGVTSCLRFSGQLHSDLQKL 139


>UniRef50_O93807 Cluster: Tubulin gamma chain; n=8;
           Saccharomycetales|Rep: Tubulin gamma chain - Candida
           albicans (Yeast)
          Length = 502

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSR 130
           + ++  LRFPG + + +  +  N++P P L F T   AP +++
Sbjct: 272 ASVSNPLRFPGYMYSSMESIVSNLIPTPDLKFLTSSIAPFSTQ 314


>UniRef50_UPI0000E47CF2 Cluster: PREDICTED: similar to cryptic
           tubulin; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to cryptic tubulin -
           Strongylocentrotus purpuratus
          Length = 589

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +1

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWY 495
           T   NT+ I +  +RV  +  +M+  KAFLHWY
Sbjct: 527 TMCVNTSRIVSTMQRVQSRAQSMYEAKAFLHWY 559


>UniRef50_Q9N9D7 Cluster: Tubulin; n=1; Paramecium tetraurelia|Rep:
           Tubulin - Paramecium tetraurelia
          Length = 476

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
 Frame = +1

Query: 265 SMKEVDEQLANIQNKNSTYF--VEWIPNNCKIAVCD----IPPRGLKMASTFIGNTTAIQ 426
           ++++ D  +  ++ K ++ F  V+W P+  ++   +    +     KM  T I N+T I 
Sbjct: 365 TLQDSDSHMKFLERKINSVFNPVQWNPDAVQLHFINEKSSVKGHDQKMNVTLI-NSTKII 423

Query: 427 TIFKRVSEQFVAMFRRKAFLHWY 495
            I K VS+     +R  A+LHWY
Sbjct: 424 PILKNVSKIAYQKYRSGAYLHWY 446


>UniRef50_A0DI61 Cluster: Chromosome undetermined scaffold_51, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_51,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 614

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 13/25 (52%), Positives = 20/25 (80%)
 Frame = +3

Query: 504 G*DEMEFTEAESNMNDLISEYQQYQ 578
           G DE +F+EAESNMN+L+  Y+ ++
Sbjct: 27  GMDETKFSEAESNMNNLVLSYENFK 51


>UniRef50_UPI00006CAF6E Cluster: hypothetical protein TTHERM_00466100;
            n=1; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00466100 - Tetrahymena thermophila SB210
          Length = 1068

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 3/113 (2%)
 Frame = +1

Query: 124  VARSSTVSS--FNCTRADAANVRRQKHDGRV*SSTREVFDRCDDIQGRMSMKEVDEQLAN 297
            V R+S +S+  F  TR   A+V+      R+  +T ++  R         +  ++    N
Sbjct: 839  VFRNSEISNNTFFKTRNSIASVKTHFQLNRI--NTDDMITRIKASSSNFQIANLNNPKMN 896

Query: 298  IQNKNSTYFVEWIPN-NCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQ 453
            I N ++TY  +   N N K     +P    +  +  IGNT AIQ I +++ +Q
Sbjct: 897  INNISNTYHYQADGNQNLKNTSNQLPTFNFQK-NLIIGNTEAIQNIIRQIPDQ 948


>UniRef50_Q8SRD2 Cluster: Tubulin gamma chain; n=1; Encephalitozoon
           cuniculi|Rep: Tubulin gamma chain - Encephalitozoon
           cuniculi
          Length = 434

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = +1

Query: 214 SSTREVFDRCDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAV--CDI-PPRGL 384
           +  + V    + + G     EV   +    +K    FV W+P +  +A+  C     R  
Sbjct: 303 TKAQSVVSMLNILHGVEDSGEVSRTVMRFLDKGMVNFVPWMPPSFNVALGKCIANETRPS 362

Query: 385 KMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWY 495
           +++   + N+T    I  ++S QF  + +++AFL  Y
Sbjct: 363 RVSGLSLTNSTGASLILSKISGQFDKLRKQRAFLDIY 399


>UniRef50_UPI0001555715 Cluster: PREDICTED: similar to
           immunoglobulin superfamily, member 2, partial; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           immunoglobulin superfamily, member 2, partial -
           Ornithorhynchus anatinus
          Length = 770

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 23/69 (33%), Positives = 34/69 (49%)
 Frame = -1

Query: 245 SQRSNTSRVEDHTRPSCFWRRTFAASARVQLKLDTVELLATSAAQSQGCRNAGAETAPCS 66
           +Q  +T   E HT P+   +   + SA+V+L +    L ATSAAQ+   R     T PC 
Sbjct: 128 AQVQDTGEYECHT-PNTDVKYFGSYSAKVRLTVIADTLSATSAAQTLNRREGDPLTLPCD 186

Query: 65  QPTSSDQRS 39
             T + Q +
Sbjct: 187 VTTGTSQHT 195


>UniRef50_UPI0000F2BF49 Cluster: PREDICTED: similar to MGC53359
           protein; n=1; Monodelphis domestica|Rep: PREDICTED:
           similar to MGC53359 protein - Monodelphis domestica
          Length = 366

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +1

Query: 382 LKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGE 504
           L+ A   + NTTAI   +  +  +F  M+ + A +HWY  E
Sbjct: 286 LQRAVCMVSNTTAIAEAWAHLDHKFDLMYTKCAIVHWYMEE 326


>UniRef50_UPI0000DAE654 Cluster: hypothetical protein
           Rgryl_01000876; n=1; Rickettsiella grylli|Rep:
           hypothetical protein Rgryl_01000876 - Rickettsiella
           grylli
          Length = 405

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = -3

Query: 279 NFFHRHSPLNIVATVKYLPCRGSHATIMFLASNICSVSSGTVKARY 142
           +FF R S L  V TV  LP   +   I F +S +CSV +G V  +Y
Sbjct: 13  DFFQRLSQLFAVLTVLTLPLSTAALMIFFSSSVLCSVLAGHVYEKY 58


>UniRef50_UPI0000584751 Cluster: PREDICTED: similar to tubulin,
           delta 1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to tubulin, delta 1 -
           Strongylocentrotus purpuratus
          Length = 439

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGL----KMASTFIGNT 414
           I   + ++  D   A+I   +NS  +V+WIP++     C    R      K A       
Sbjct: 328 ISNHLILRGKDSTAADISPLRNSALYVDWIPSDFAFT-CSHQSRQFRAYEKSACLMSNGR 386

Query: 415 TAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           TA+ ++   V + +  MF  +A++HWY   G
Sbjct: 387 TALGSLNTIVRKAW-DMFAMRAYVHWYVRHG 416


>UniRef50_Q5MAT5 Cluster: Acrosome-specific protein VAD1.3; n=4; Mus
           musculus|Rep: Acrosome-specific protein VAD1.3 - Mus
           musculus (Mouse)
          Length = 1014

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = -2

Query: 82  KRHHVHSQLPQISVQLSRKPQTRRN 8
           +  H+ +QLPQ SV+ S+KPQ  RN
Sbjct: 922 QNRHIRNQLPQRSVRFSKKPQNPRN 946


>UniRef50_A4S3U2 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 1428

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 5/75 (6%)
 Frame = -3

Query: 393 SHFKTPRR-YVTHGNLAVIGY----PLDKIRAVFVLNIRQLLVNFFHRHSPLNIVATVKY 229
           + +  PRR +V   N  ++ +    P+D +R+V   NI + +  FF  + P+   A    
Sbjct: 512 TQYMCPRRTFVLMTNAGLVRFEKARPIDTLRSVLEKNIPEQIEEFFKSYGPIEAAAMCVA 571

Query: 228 LPCRGSHATIMFLAS 184
           L   GS +  + LA+
Sbjct: 572 LSVSGSESNAVILAA 586


>UniRef50_Q3SEH3 Cluster: Beta_tubulin,putative; n=4; Paramecium
           tetraurelia|Rep: Beta_tubulin,putative - Paramecium
           tetraurelia
          Length = 439

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
 Frame = +2

Query: 23  RFPGQLNADLRKLAVNMVPFPRLHFYTPGFA-PLTSRGAQQYRALTVPELTLQMFDAKNM 199
           R PG +N+ LRKL+ N+ PF     +T      L S   ++Y  +   ++  ++  + + 
Sbjct: 234 RNPGDINSSLRKLSTNLSPFAFYKLFTCNMTNNLYSDYYKEYLKMDEYQIFKELISSDHN 293

Query: 200 MVACDPRHGRYLTVATIFRGE 262
             +     G++++ A   RG+
Sbjct: 294 QTSAVYTQGKFVSAALSVRGK 314


>UniRef50_A7QN35 Cluster: Chromosome undetermined scaffold_130,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_130, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 470

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +2

Query: 197 MMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARI 322
           ++  CDPRH RY+T   ++RG+ + K +  N  +   KT RI
Sbjct: 21  VIAKCDPRHVRYVTCCLMYRGDVMPKGV--NVVVATIKTRRI 60


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 651,560,518
Number of Sequences: 1657284
Number of extensions: 12900817
Number of successful extensions: 37455
Number of sequences better than 10.0: 105
Number of HSP's better than 10.0 without gapping: 35994
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37411
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).