SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0032
         (648 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B63E8 Cluster: PREDICTED: hypothetical protein;...    39   0.12 
UniRef50_A6R6J8 Cluster: Predicted protein; n=1; Ajellomyces cap...    35   1.5  
UniRef50_Q59HF1 Cluster: TNFRSF14 protein variant; n=1; Homo sap...    33   6.0  
UniRef50_A4R7Z2 Cluster: Predicted protein; n=1; Magnaporthe gri...    33   6.0  

>UniRef50_UPI00015B63E8 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 1379

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query: 236 LFRASERDXQDAANSIMGXVVXNI-EPHIHWKPQLIDGILKYGDRV 370
           LF+   RD Q AA++++      + +PH+ W PQ++D ILK  D++
Sbjct: 437 LFKKESRDRQQAASALVALATTKLFDPHL-WYPQVLDDILKMADKL 481



 Score = 35.9 bits (79), Expect = 0.84
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 239  FRASERDXQDAANSIMGXVVXNIEPHIHWKPQLIDGILKYGDRVXT 376
            + +  R  Q  A S +  VV ++     W P+L+D  LKYGD + T
Sbjct: 1193 YPSENRGLQSCAISAVAIVVSSLHAPSSWTPELLDACLKYGDLLHT 1238


>UniRef50_A6R6J8 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 501

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = +2

Query: 209 RKTGTRRGILFRASERDXQDAANSIMGXVVXNIEPHIHWKPQLIDGILKYGDRV 370
           R+ G R G++F  S        N I G +V NIE    W+ QL  GI+  G  V
Sbjct: 431 RQIGIRTGVMFAVSSLASL-TGNPIGGALVGNIEQPTFWRMQLFSGIVMAGGAV 483


>UniRef50_Q59HF1 Cluster: TNFRSF14 protein variant; n=1; Homo
           sapiens|Rep: TNFRSF14 protein variant - Homo sapiens
           (Human)
          Length = 179

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +1

Query: 307 RTSHPLE-AAADRRNPQVRRQGPXDVSAQSFCSARSYAPTRLSTSSTSPILMS 462
           RT HPL  A   +  P   R GP  +S  + C  R     R  ++S SP+ +S
Sbjct: 121 RTLHPLSMATVPQEGPGCPRPGPNPISMDAPCRGRLEVSLRPPSTSVSPLTLS 173


>UniRef50_A4R7Z2 Cluster: Predicted protein; n=1; Magnaporthe
           grisea|Rep: Predicted protein - Magnaporthe grisea (Rice
           blast fungus) (Pyricularia grisea)
          Length = 452

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +1

Query: 340 RRNPQVRRQGPXDVSAQSFCSARSYAPTRLSTSSTSPILMSD*RLXANCXRRTESWKTGA 519
           R+N  +RR+   ++ + S  S  S   TR S+    P       L     R ++S ++GA
Sbjct: 66  RKNQPIRRRTSGNLDSDSNLSCGSCPVTRTSSPLPHP-------LSTTTSRSSQSEQSGA 118

Query: 520 VLNLKRAINRFFES 561
             N+ R +NR+F S
Sbjct: 119 TENILRILNRYFSS 132


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 506,355,298
Number of Sequences: 1657284
Number of extensions: 7825658
Number of successful extensions: 20417
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 19846
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20414
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48955894634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).