SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0UZL8 Cluster: Predicted protein; n=1; Phaeosphaeria n...    35   0.88 
UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe gri...    35   1.2  
UniRef50_Q559P7 Cluster: Putative uncharacterized protein; n=2; ...    34   1.5  
UniRef50_Q0ITI5 Cluster: Os11g0250100 protein; n=3; Oryza sativa...    33   2.7  
UniRef50_Q477H9 Cluster: Dienelactone hydrolase; n=3; Cupriavidu...    33   3.6  
UniRef50_Q4QCR3 Cluster: Kinase-like protein; n=3; Leishmania|Re...    33   3.6  
UniRef50_A4HGG1 Cluster: Putative uncharacterized protein; n=1; ...    33   4.7  
UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893; ...    33   4.7  
UniRef50_Q0LHU3 Cluster: Putative uncharacterized protein precur...    32   6.2  
UniRef50_A5AK89 Cluster: Putative uncharacterized protein; n=1; ...    32   6.2  
UniRef50_Q04804 Cluster: Sensor protein pfeS; n=29; Pseudomonada...    32   6.2  
UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2...    32   8.2  
UniRef50_Q7SBG8 Cluster: Predicted protein; n=1; Neurospora cras...    32   8.2  
UniRef50_Q4P695 Cluster: Putative uncharacterized protein; n=1; ...    32   8.2  
UniRef50_Q8CBW3 Cluster: Abl interactor 1; n=74; Euteleostomi|Re...    32   8.2  

>UniRef50_Q0UZL8 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 367

 Score = 35.1 bits (77), Expect = 0.88
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
 Frame = -3

Query: 470 NTENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRP----- 306
           +TE +K ++N+E      S  H PT E  ++TAS A+ D+  T+ +R+ST    P     
Sbjct: 207 DTEPDKQQNNTENNTPHGSDDHQPTDE--KKTASAAMADQPNTHTKRTSTNDALPSFDPI 264

Query: 305 -YSSEERRSGTETA 267
            ++S ++RS T  A
Sbjct: 265 AWASIDKRSETSGA 278


>UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe
           grisea|Rep: Predicted protein - Magnaporthe grisea (Rice
           blast fungus) (Pyricularia grisea)
          Length = 699

 Score = 34.7 bits (76), Expect = 1.2
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 246 VLIWVWRLTDHLTTASNGSDS-SSRGTEYSTTCRTARRAYSKARMACDT 103
           VLIW  RLT +L  AS G D+ +   T +STTC       S+ +  CDT
Sbjct: 422 VLIWTGRLTKYLAGASIGHDNINFYNTPFSTTCTCCT---SRLKDLCDT 467


>UniRef50_Q559P7 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 547

 Score = 34.3 bits (75), Expect = 1.5
 Identities = 25/89 (28%), Positives = 44/89 (49%)
 Frame = -2

Query: 387 TTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLGNGDSVTSNAIAVLIWVWRLTDHLT 208
           TT++S  SS +P   +  +K    +T+    G S     S TSN  + L      T   +
Sbjct: 136 TTSSSSFSSPKPISSMSSSKTTTTTTTTTTTGRSTTTSTS-TSNISSDLFKTNVTTKSTS 194

Query: 207 TASNGSDSSSRGTEYSTTCRTARRAYSKA 121
           + SNG++++++ T  STT   +  + SK+
Sbjct: 195 SNSNGNNNNNKSTTSSTTASKSTASESKS 223


>UniRef50_Q0ITI5 Cluster: Os11g0250100 protein; n=3; Oryza sativa
           (japonica cultivar-group)|Rep: Os11g0250100 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 108

 Score = 33.5 bits (73), Expect = 2.7
 Identities = 22/61 (36%), Positives = 27/61 (44%)
 Frame = +1

Query: 271 VSVPERRSSDEYGRRARVELRSAYVAPRSSRALEAVRCRGSDVGKCRRLAA*YCNSLFER 450
           V+V E R   +YGR     LRS   APR  +     RC G   G C R A+   +    R
Sbjct: 42  VAVEELRRRVDYGRDELQRLRSDVAAPRKEKHALEQRCAGVVRGCCCRRASRVRSGRRRR 101

Query: 451 C 453
           C
Sbjct: 102 C 102


>UniRef50_Q477H9 Cluster: Dienelactone hydrolase; n=3;
           Cupriavidus|Rep: Dienelactone hydrolase - Ralstonia
           eutropha (strain JMP134) (Alcaligenes eutrophus)
          Length = 365

 Score = 33.1 bits (72), Expect = 3.6
 Identities = 21/56 (37%), Positives = 29/56 (51%)
 Frame = +2

Query: 278 FPSDAPLTSMDVERALSFAPRTWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCS 445
           +P+D P     VERA++F P       Q  +RL A V+ M+G   DW     TRC+
Sbjct: 239 WPADTP----QVERAVAFYPACKRAVQQHNFRLRAPVLLMIGGADDW--TPATRCA 288


>UniRef50_Q4QCR3 Cluster: Kinase-like protein; n=3; Leishmania|Rep:
           Kinase-like protein - Leishmania major
          Length = 384

 Score = 33.1 bits (72), Expect = 3.6
 Identities = 18/48 (37%), Positives = 23/48 (47%)
 Frame = +1

Query: 271 VSVPERRSSDEYGRRARVELRSAYVAPRSSRALEAVRCRGSDVGKCRR 414
           V++  R   D   R+  V+  S     R S  LE VRC G +V  CRR
Sbjct: 73  VTLAYRHEGDAVWRKTAVKRISLRKETRLSAVLEKVRCTGREVALCRR 120


>UniRef50_A4HGG1 Cluster: Putative uncharacterized protein; n=1;
           Leishmania braziliensis|Rep: Putative uncharacterized
           protein - Leishmania braziliensis
          Length = 1488

 Score = 32.7 bits (71), Expect = 4.7
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = -3

Query: 419 ASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEERRS 282
           A++RHF ++  +  T+S AL+D  +T+ +  +T   + Y+S+  RS
Sbjct: 593 AAQRHFDSNNVQAPTSSFALQDGDSTHEDAYATATSQSYTSDALRS 638


>UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893;
           n=14; Mycobacterium tuberculosis complex|Rep:
           Uncharacterized protein Rv3785/MT3893 - Mycobacterium
           tuberculosis
          Length = 357

 Score = 32.7 bits (71), Expect = 4.7
 Identities = 16/48 (33%), Positives = 21/48 (43%)
 Frame = -2

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLL 79
           TDHL       D  S   +Y    R AR  + +     D+GG A WL+
Sbjct: 51  TDHLEARLASLDKFSTAWDYRARARAARALHGEPVRCQDSGGGARWLI 98


>UniRef50_Q0LHU3 Cluster: Putative uncharacterized protein
           precursor; n=1; Herpetosiphon aurantiacus ATCC
           23779|Rep: Putative uncharacterized protein precursor -
           Herpetosiphon aurantiacus ATCC 23779
          Length = 472

 Score = 32.3 bits (70), Expect = 6.2
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = -2

Query: 336 GAKLNARSTSILVRGASLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSD 187
           GAK ++  T+  V    +G G +V   A A LI V R+T  + T + G D
Sbjct: 416 GAKASSNPTNAGVTNMGVGGGSAVVEGAGAQLIVVARVTSPVGTGTTGED 465


>UniRef50_A5AK89 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 596

 Score = 32.3 bits (70), Expect = 6.2
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 1/92 (1%)
 Frame = -2

Query: 357 RPRCHVRGAKLNARSTS-ILVRGASLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSS 181
           RPR   RG     R  S   + G   G    V + A+A ++ +     H T+++ G  + 
Sbjct: 104 RPRGTRRGTGGGTRPMSWTRLMGTMQGPAACVMARAMARVVCLGSTRGHHTSSARGHHAR 163

Query: 180 SRGTEYSTTCRTARRAYSKARMACDTGGKASW 85
            RGT + T   T R +   +   C     ASW
Sbjct: 164 PRGTHHGTGGGTRRMSCLGSVAQCRAPRHASW 195


>UniRef50_Q04804 Cluster: Sensor protein pfeS; n=29;
           Pseudomonadaceae|Rep: Sensor protein pfeS - Pseudomonas
           aeruginosa
          Length = 446

 Score = 32.3 bits (70), Expect = 6.2
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = -1

Query: 448 VRTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRTRSEAQRAL 314
           +RT S+ ++ P+A +     HDSE PPE L+  + R   + QR L
Sbjct: 239 LRTLSHELRTPLARL--RIAHDSELPPEQLRQRLDREIGDMQRLL 281


>UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2;
           Escherichia coli|Rep: AF/R2 fimbrial major subunit Afr2G
           - Escherichia coli
          Length = 279

 Score = 31.9 bits (69), Expect = 8.2
 Identities = 13/47 (27%), Positives = 26/47 (55%)
 Frame = -2

Query: 294 GASLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTT 154
           G ++  G ++  ++    +W W+L D +T ASN +D ++  T  + T
Sbjct: 32  GGTIDIGGTIEVDSQYDDLWTWKLGDAITVASNAADMNAEKTSLTIT 78


>UniRef50_Q7SBG8 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 368

 Score = 31.9 bits (69), Expect = 8.2
 Identities = 14/46 (30%), Positives = 22/46 (47%)
 Frame = +2

Query: 287 DAPLTSMDVERALSFAPRTWHRGLQELWRLFAVVVRMLGNVGDWPL 424
           D P+          + PR W R L+++WR+ AV+ R     G W +
Sbjct: 288 DLPMGEQQPINCHRYTPRLWRRTLEQVWRMTAVMERRKDGKG-WEI 332


>UniRef50_Q4P695 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 716

 Score = 31.9 bits (69), Expect = 8.2
 Identities = 32/114 (28%), Positives = 47/114 (41%), Gaps = 2/114 (1%)
 Frame = -2

Query: 462 KRKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASL 283
           +R T F +R T  S +  T    +TT+     ++   R     +     ST   VR AS 
Sbjct: 167 RRCTQFVRRATTTSRRKTTSTKRKTTSTKRTSTTTSTRRTTSTSSKRTTSTLNAVRTAS- 225

Query: 282 GNGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSS--SRGTEYSTTCRTARRAYS 127
               S T+ +          T   +T S  S SS  SR +  STT R++  +YS
Sbjct: 226 STRRSTTTTSTTPKPSTTSTTSRSSTTSKPSTSSTTSRSSTASTTSRSSTTSYS 279


>UniRef50_Q8CBW3 Cluster: Abl interactor 1; n=74; Euteleostomi|Rep:
           Abl interactor 1 - Mus musculus (Mouse)
          Length = 481

 Score = 31.9 bits (69), Expect = 8.2
 Identities = 33/121 (27%), Positives = 54/121 (44%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 194 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 245

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    TA   +  ++ G++Y T  R   R ++    +  +G
Sbjct: 246 SGSRENSGSSSIGIPIAVPTPSPPTAGPAAPGAAPGSQYGTMTRQISR-HNSTTSSTSSG 304

Query: 99  G 97
           G
Sbjct: 305 G 305


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 465,708,088
Number of Sequences: 1657284
Number of extensions: 7982513
Number of successful extensions: 28533
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 27505
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28505
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 29273652170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).