SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0TZ66 Cluster: Putative uncharacterized protein; n=1; ...    39   0.078
UniRef50_UPI00015B63B2 Cluster: PREDICTED: similar to organic an...    37   0.41 
UniRef50_A0Q9G9 Cluster: Putative uncharacterized protein; n=1; ...    36   0.96 
UniRef50_UPI0000F2C3DC Cluster: PREDICTED: hypothetical protein;...    33   3.9  
UniRef50_Q9GRZ1 Cluster: Putative uncharacterized protein ebp-1;...    33   3.9  
UniRef50_Q4S952 Cluster: Chromosome 3 SCAF14700, whole genome sh...    33   5.1  
UniRef50_P12304 Cluster: Protein X92; n=2; Trypanosoma brucei|Re...    33   6.7  
UniRef50_Q16XL2 Cluster: Acyl-CoA oxidase; n=2; Culicidae|Rep: A...    32   8.9  

>UniRef50_Q0TZ66 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 582

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 19/45 (42%), Positives = 26/45 (57%)
 Frame = +1

Query: 124 GVPLGQRGVLPGSTQINRKCFREGESRRAPSAGPMLPVAAVTRRP 258
           G+P  QRG  P    ++R   R+  S RAPS+G   P  A+TR+P
Sbjct: 143 GIPFHQRGPSPQPGHLSRPNSRDPHSGRAPSSGISAPSTALTRQP 187


>UniRef50_UPI00015B63B2 Cluster: PREDICTED: similar to organic anion
            transporter; n=1; Nasonia vitripennis|Rep: PREDICTED:
            similar to organic anion transporter - Nasonia
            vitripennis
          Length = 992

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = +2

Query: 110  VVTLMEFRLDSAEYXQAQHK 169
            ++T MEF+LDSAEY QAQHK
Sbjct: 973  ILTYMEFQLDSAEYCQAQHK 992


>UniRef50_A0Q9G9 Cluster: Putative uncharacterized protein; n=1;
           Mycobacterium avium 104|Rep: Putative uncharacterized
           protein - Mycobacterium avium (strain 104)
          Length = 978

 Score = 35.5 bits (78), Expect = 0.96
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = -3

Query: 239 ATGSMGPA-DGALLLSPSRKHFLFICVEPGSTPRC-PSGTPSMSPQKGSPASQP 84
           A G++G A DG+L L P       +  EP + P   P+  P M+P    PA+QP
Sbjct: 443 AIGTLGVAVDGSLALKPEPAPVETVAAEPAAAPVVEPATEPGMAPAATEPAAQP 496


>UniRef50_UPI0000F2C3DC Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 285

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = -3

Query: 242 AATGSMGP-ADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQ--KGSPASQPYTL 75
           A TG +   A+ AL+ +PS      +  +P S+P+  +G PS  PQ   G+P+S P  L
Sbjct: 14  AITGVLSARAEPALIGAPSSPPQALVRPQPPSSPQALTGAPSSPPQALTGAPSSPPQAL 72



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = -3

Query: 158 PGSTPRCPSGTPSMSPQK--GSPASQPYTLXRN*TVAAVSSRRNSPHTQKR 12
           P S P+  +G PS  PQ   G+P+S P  L R  T A  + R +S   Q+R
Sbjct: 54  PSSPPQALTGAPSSPPQALIGAPSSPPQGLGRRHTGAIDTGRGSSLGKQRR 104


>UniRef50_Q9GRZ1 Cluster: Putative uncharacterized protein ebp-1;
           n=3; Caenorhabditis|Rep: Putative uncharacterized
           protein ebp-1 - Caenorhabditis elegans
          Length = 316

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = -3

Query: 224 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPA 93
           GPA GA   +PSR     +  +P +T R P+ TP+  P + +P+
Sbjct: 143 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPS 186


>UniRef50_Q4S952 Cluster: Chromosome 3 SCAF14700, whole genome
           shotgun sequence; n=3; Percomorpha|Rep: Chromosome 3
           SCAF14700, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 730

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 26/82 (31%), Positives = 39/82 (47%)
 Frame = -3

Query: 248 VTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69
           V   T S+G   GA  L  + +H L + V P   P C S  P++     SP+S P  +  
Sbjct: 162 VLGLTASLGTG-GARTLQDAVEHVLQVSVRPSRQPVCHS--PAL-VSSASPSS-PAQICA 216

Query: 68  N*TVAAVSSRRNSPHTQKRVHR 3
           N     VS++R  P  +++V R
Sbjct: 217 NLDSGVVSTKRYVPELEEKVPR 238


>UniRef50_P12304 Cluster: Protein X92; n=2; Trypanosoma brucei|Rep:
           Protein X92 - Trypanosoma brucei brucei
          Length = 549

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = +1

Query: 391 CFHILNFCLXAFGCVRVVXNDINAGSSHYIIGP-FQNKSYGLFVC 522
           C HIL  C+    CV        AG  + +IG  F  +S+ LF+C
Sbjct: 490 CLHILRVCVCVCVCVFAFDGSKGAGQFYCVIGSLFFFRSFSLFLC 534


>UniRef50_Q16XL2 Cluster: Acyl-CoA oxidase; n=2; Culicidae|Rep:
           Acyl-CoA oxidase - Aedes aegypti (Yellowfever mosquito)
          Length = 773

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = -2

Query: 360 PLKTSATELLAVLNSSGAPNLR*LMMGRYVEQCARSSSHRRYRQHGSSGWRSPALAFTE 184
           P K   TE   +   S  P L  L  G Y     +S    +YRQ  +  WR   LAF +
Sbjct: 66  PEKIDMTEFNTISRPSAHPEL--LANGTYFPDLPKSGPLTKYRQQSAIDWRKVKLAFND 122


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 595,329,490
Number of Sequences: 1657284
Number of extensions: 11820901
Number of successful extensions: 35347
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 33535
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35303
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).