SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera...   128   4e-29
UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Re...    95   7e-19
UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Re...    64   1e-09
UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4; Obtectomera...    49   4e-05
UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor...    49   5e-05
UniRef50_Q5W8G6 Cluster: Cecropin; n=1; Acalolepta luxuriosa|Rep...    42   0.004
UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep: Cecro...    42   0.005
UniRef50_Q8MUF4 Cluster: Cecropin-B precursor; n=18; Culicidae|R...    42   0.007
UniRef50_Q3R5V3 Cluster: Putative uncharacterized protein precur...    33   3.3  
UniRef50_Q83FL8 Cluster: Putative uncharacterized protein; n=2; ...    32   5.8  
UniRef50_Q9RV40 Cluster: Putative uncharacterized protein; n=1; ...    31   7.7  

>UniRef50_P04142 Cluster: Cecropin-B precursor; n=16;
           Obtectomera|Rep: Cecropin-B precursor - Bombyx mori
           (Silk moth)
          Length = 63

 Score =  128 bits (310), Expect = 4e-29
 Identities = 63/63 (100%), Positives = 63/63 (100%)
 Frame = +1

Query: 58  MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 237
           MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA
Sbjct: 1   MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 60

Query: 238 IGK 246
           IGK
Sbjct: 61  IGK 63


>UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Rep:
           Cecropin-A precursor - Hyalophora cecropia (Cecropia
           moth)
          Length = 64

 Score = 94.7 bits (225), Expect = 7e-19
 Identities = 41/63 (65%), Positives = 53/63 (84%)
 Frame = +1

Query: 58  MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 237
           MNF++I  FVFA + AL+M +AAPEP+WK+FKKIEK+G+NIRDGI+KAGPA+ V+G A  
Sbjct: 1   MNFSRIFFFVFACLTALAMVNAAPEPKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQ 60

Query: 238 IGK 246
           I K
Sbjct: 61  IAK 63


>UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Rep:
           Cecropin A - Plutella xylostella (Diamondback moth)
          Length = 66

 Score = 64.1 bits (149), Expect = 1e-09
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 1/64 (1%)
 Frame = +1

Query: 58  MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVK-AGPAIEVLGSAK 234
           M  + I  FVF    A++  SAAP  RWK FKK+EK+GRNIR+GI++  GPA+ V+G A 
Sbjct: 1   MKLSNIFFFVFMAFFAVASVSAAP--RWKPFKKLEKVGRNIRNGIIRYNGPAVAVIGQAT 58

Query: 235 AIGK 246
           +I +
Sbjct: 59  SIAR 62


>UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4;
           Obtectomera|Rep: Antibacterial peptide - Bombyx mori
           (Silk moth)
          Length = 66

 Score = 49.2 bits (112), Expect = 4e-05
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +1

Query: 58  MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 237
           M F KI   VF  ++ + + S A    W  FK++E +G+ +RD I+ AGPAI+VL  AK 
Sbjct: 1   MYFTKI---VFVAIICIMIVSCASA--WDFFKELEGVGQRVRDSIISAGPAIDVLQKAKG 55

Query: 238 I 240
           +
Sbjct: 56  L 56


>UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor;
           n=5; Ditrysia|Rep: Antibacterial peptide enbocin
           precursor - Bombyx mori (Silk moth)
          Length = 59

 Score = 48.8 bits (111), Expect = 5e-05
 Identities = 23/61 (37%), Positives = 39/61 (63%)
 Frame = +1

Query: 58  MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 237
           MNF +I+ F+F +V A    +A+ +P W IFK+IE+     RD ++ AGPA+  + +A +
Sbjct: 1   MNFTRIIFFLFVVVFA----TASGKP-WNIFKEIERAVARTRDAVISAGPAVRTVAAATS 55

Query: 238 I 240
           +
Sbjct: 56  V 56


>UniRef50_Q5W8G6 Cluster: Cecropin; n=1; Acalolepta luxuriosa|Rep:
           Cecropin - Acalolepta luxuriosa (Udo longicorn beetle)
          Length = 60

 Score = 42.3 bits (95), Expect = 0.004
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +1

Query: 82  FVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGP-AIEVLGSAKAIGK 246
           FVFAL + L++T  A    +  FK+IEK+G+NIR+   ++ P  +   G AK IGK
Sbjct: 7   FVFALAVLLALTGQAESKNF--FKRIEKVGKNIRNAAERSLPTVVGYAGVAKQIGK 60


>UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep:
           Cecropin-D - Antheraea pernyi (Chinese oak silk moth)
          Length = 36

 Score = 41.9 bits (94), Expect = 0.005
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = +1

Query: 139 WKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK 246
           W  FK++E+ G+ +RD I+ AGPA+  +  A A+ K
Sbjct: 1   WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK 36


>UniRef50_Q8MUF4 Cluster: Cecropin-B precursor; n=18; Culicidae|Rep:
           Cecropin-B precursor - Anopheles gambiae (African
           malaria mosquito)
          Length = 60

 Score = 41.5 bits (93), Expect = 0.007
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +1

Query: 58  MNFAKILSFV-FALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAK 234
           MNF K+   V  A+++ + +      PRWK  K++EK+GRN+     KA P   V+   K
Sbjct: 1   MNFTKLFILVAIAVLVVVGVQPVDGAPRWKFGKRLEKLGRNVFRAAKKALP---VIAGYK 57

Query: 235 AIG 243
           A+G
Sbjct: 58  ALG 60


>UniRef50_Q3R5V3 Cluster: Putative uncharacterized protein
           precursor; n=2; Xylella fastidiosa|Rep: Putative
           uncharacterized protein precursor - Xylella fastidiosa
           Ann-1
          Length = 188

 Score = 32.7 bits (71), Expect = 3.3
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +1

Query: 7   TAPLVS*RPRLNLDKLTMNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRD 186
           ++PL S  PR N   L +     L+    L+LA + T+AAP P       + +M R  + 
Sbjct: 13  SSPLTSPTPRNNAMPLPIAAPLTLATALILLLATTPTTAAPSPEQHAAALVAQMTRQEKI 72

Query: 187 G-IVKAGPAIEVLG 225
              + A PAI  LG
Sbjct: 73  AQTMNAAPAIPRLG 86


>UniRef50_Q83FL8 Cluster: Putative uncharacterized protein; n=2;
           Tropheryma whipplei|Rep: Putative uncharacterized
           protein - Tropheryma whipplei (strain Twist) (Whipple's
           bacillus)
          Length = 310

 Score = 31.9 bits (69), Expect = 5.8
 Identities = 22/56 (39%), Positives = 29/56 (51%)
 Frame = -2

Query: 275 VDLWRTFKDHFPMALAEPRTSIAGPALTMPSRMFLPIFSIFLKIFHLGSGAALVML 108
           + L R F  H      E + ++AGP+ T     FLPIFS+ L    LG GA  V+L
Sbjct: 105 LSLSRAFS-HIASVQREAQVAMAGPSSTAKIVGFLPIFSLVLSA-ALGFGALNVLL 158


>UniRef50_Q9RV40 Cluster: Putative uncharacterized protein; n=1;
           Deinococcus radiodurans|Rep: Putative uncharacterized
           protein - Deinococcus radiodurans
          Length = 216

 Score = 31.5 bits (68), Expect = 7.7
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +1

Query: 1   ISTAPLVS*-RPRLNLDKLTMNFAKILSFVFALVLALSM 114
           ++  P++S  RPRL   +L  +FA  L +  ALVLALS+
Sbjct: 149 VARDPVISGARPRLQAPQLATSFAAALMYALALVLALSI 187


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 391,064,004
Number of Sequences: 1657284
Number of extensions: 7337130
Number of successful extensions: 16899
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 16555
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16896
length of database: 575,637,011
effective HSP length: 93
effective length of database: 421,509,599
effective search space used: 20653970351
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).