SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0025
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q1D2F5 Cluster: Putative lipoprotein; n=1; Myxococcus x...    35   1.3  
UniRef50_Q9LQ50 Cluster: T30E16.23; n=2; Arabidopsis thaliana|Re...    35   1.7  
UniRef50_A6CR92 Cluster: Adaptor protein; n=1; Bacillus sp. SG-1...    33   3.9  
UniRef50_UPI000155C259 Cluster: PREDICTED: similar to heparan su...    33   5.1  
UniRef50_Q4D0U6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_UPI00005A57E8 Cluster: PREDICTED: hypothetical protein ...    33   6.7  
UniRef50_Q6IR95 Cluster: MGC80043 protein; n=1; Xenopus laevis|R...    33   6.7  
UniRef50_A5C5F0 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_A6QNT4 Cluster: FAM120B protein; n=3; Laurasiatheria|Re...    33   6.7  
UniRef50_Q822Y4 Cluster: Probable O-sialoglycoprotein endopeptid...    33   6.7  
UniRef50_UPI0000498EA5 Cluster: Bax inhibitor; n=1; Entamoeba hi...    32   8.9  
UniRef50_Q097Z8 Cluster: Putative uncharacterized protein; n=1; ...    32   8.9  
UniRef50_Q6Z7U6 Cluster: Putative uncharacterized protein P0471A...    32   8.9  
UniRef50_O00159 Cluster: Myosin-Ic; n=144; root|Rep: Myosin-Ic -...    32   8.9  

>UniRef50_Q1D2F5 Cluster: Putative lipoprotein; n=1; Myxococcus
           xanthus DK 1622|Rep: Putative lipoprotein - Myxococcus
           xanthus (strain DK 1622)
          Length = 558

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +1

Query: 94  LVLPALSAEDVSYQACVDKYSRKGYQPWQEWSDHY-TCHRY-RCEIRDGKYFIAAVDVEN 267
           +V PAL+A      +CV+ Y   G   W  WS+ + TC  Y   E+ DG  F+ AV VE+
Sbjct: 72  VVSPALAAS----LSCVETYVNAGTCDWAHWSEMWETCETYEHPELEDG-VFLEAVQVED 126


>UniRef50_Q9LQ50 Cluster: T30E16.23; n=2; Arabidopsis thaliana|Rep:
           T30E16.23 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1076

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 23/53 (43%), Positives = 27/53 (50%)
 Frame = -1

Query: 466 TTAGFGSFCWPFHGLSGNSSPGCPLVCTILSPFTSTTQRNRAQHVGNSTFSSS 308
           +T  FGS   PF G S        L     SPF STTQ+++    GNSTF SS
Sbjct: 108 STPSFGSSNSPFGGTSTFGQKSFGLSTPQSSPFGSTTQQSQPA-FGNSTFGSS 159


>UniRef50_A6CR92 Cluster: Adaptor protein; n=1; Bacillus sp.
           SG-1|Rep: Adaptor protein - Bacillus sp. SG-1
          Length = 184

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +1

Query: 100 LPALSAEDVSYQACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKYFIAAVDVENQKYR 279
           L  LS+  V +   +D+   KG     +W D    H +  E+ D  Y    +D+E+    
Sbjct: 3   LERLSSNTVKFSISIDELETKGILKDDQWRDSLVWHEFFEELMDEMYSEYGIDLESTV-- 60

Query: 280 KTHWNATNTSKM 315
               N+ N+S+M
Sbjct: 61  TVEINSVNSSEM 72


>UniRef50_UPI000155C259 Cluster: PREDICTED: similar to heparan
           sulfate 3-O-sulfotransferase 2; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to heparan sulfate
           3-O-sulfotransferase 2 - Ornithorhynchus anatinus
          Length = 200

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = -3

Query: 572 C*YRCHPLLLCC*IXQETPDPGLATDRCLL 483
           C Y C+ LL CC   +  P PGL   RCLL
Sbjct: 30  CTYLCYSLLFCC--HRIMPGPGLGETRCLL 57


>UniRef50_Q4D0U6 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 165

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = -1

Query: 448 SFCWPFHGLSGNSSPGCPLVCTILSPFTSTTQRNRAQHVGNSTFSSSMYSWHSSAFSGIF 269
           +  W + G++GN + G P   +  SPF++ + RN  Q  GN+ F+    +  S A + I 
Sbjct: 81  AMAWRYSGVAGNGTFG-P---SPTSPFSTASMRNNGQDNGNTGFAVGSGALFSGASANIL 136

Query: 268 G 266
           G
Sbjct: 137 G 137


>UniRef50_UPI00005A57E8 Cluster: PREDICTED: hypothetical protein
           XP_859378; n=1; Canis lupus familiaris|Rep: PREDICTED:
           hypothetical protein XP_859378 - Canis familiaris
          Length = 253

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 1/79 (1%)
 Frame = +3

Query: 348 LRCVVEVNGERIVQTRGQPGELFPDKPWKGQQNE-PNPAVVGMSGIQQTPVGGEPRVRRL 524
           LRCVVE  G R  +T  Q        P  GQ+ E P P  +G   +Q+ P  G PR RR 
Sbjct: 56  LRCVVEPAGAR-AETATQ----HTAGPGAGQEREKPRPRGLGAFSVQEVPRPGRPR-RRE 109

Query: 525 LXYLTAEEQRMAAILAAVG 581
                A  Q + A  +A G
Sbjct: 110 GREAEAGAQGLGACPSAAG 128


>UniRef50_Q6IR95 Cluster: MGC80043 protein; n=1; Xenopus laevis|Rep:
           MGC80043 protein - Xenopus laevis (African clawed frog)
          Length = 513

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +3

Query: 222 DQRREILHSCCGCRKPKIPENALEC-HEYIEDENVEFPTCCARLRCVVEVNGERIVQTRG 398
           D  +++LH+      P IPE AL C    ++ E V+      R+RC +  + E I +TR 
Sbjct: 43  DDHQQLLHTFSYFPYPSIPEIALLCMRNGLQMEKVKSWFMVQRIRCGISWSSEEIEETRS 102

Query: 399 Q 401
           +
Sbjct: 103 R 103


>UniRef50_A5C5F0 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 113

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = -1

Query: 499 PTGVCWMPLIPTTAGFGSFCWPFHGLSGNSSPGCP 395
           P  + W P +PT AGF  F W     S N +P  P
Sbjct: 50  PRSIIWSPCVPTKAGF--FTWEVXHCSVNPNPNSP 82


>UniRef50_A6QNT4 Cluster: FAM120B protein; n=3; Laurasiatheria|Rep:
           FAM120B protein - Bos taurus (Bovine)
          Length = 700

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = -1

Query: 427 GLSGNSSPGCPLVCTILSPFTSTTQRNRAQHVGNS 323
           GL G  +  CP VCT+++ F    +R+R+QH G +
Sbjct: 5   GLHGFVASSCPHVCTVVN-FKELAERHRSQHPGGT 38


>UniRef50_Q822Y4 Cluster: Probable O-sialoglycoprotein
           endopeptidase; n=7; Chlamydiaceae|Rep: Probable
           O-sialoglycoprotein endopeptidase - Chlamydophila caviae
          Length = 344

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 3/29 (10%)
 Frame = +3

Query: 255 GCRKPKIPENALECH---EYIEDENVEFP 332
           GC+KP I  N +E H    Y+E ENVEFP
Sbjct: 100 GCQKPIIGVNHVEAHLYAAYMEAENVEFP 128


>UniRef50_UPI0000498EA5 Cluster: Bax inhibitor; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: Bax inhibitor - Entamoeba
           histolytica HM-1:IMSS
          Length = 213

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 2/52 (3%)
 Frame = -1

Query: 505 SPPTGVCWMPLIPTTAGF--GSFCWPFHGLSGNSSPGCPLVCTILSPFTSTT 356
           SP   VC M     TAGF  G+FC   HGL  +    C L  T+   F STT
Sbjct: 59  SPKLKVCLMSFSALTAGFGAGAFCIS-HGLDSSQMVFCALATTL--AFVSTT 107


>UniRef50_Q097Z8 Cluster: Putative uncharacterized protein; n=1;
           Stigmatella aurantiaca DW4/3-1|Rep: Putative
           uncharacterized protein - Stigmatella aurantiaca DW4/3-1
          Length = 475

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 21/67 (31%), Positives = 27/67 (40%)
 Frame = +2

Query: 329 PHVLCAIALRRRSKWRENSANQRAAWRTVPR*TMEGPTKRAKSCCCRNERHPADTGRWRA 508
           PHV   +   + SKW   + + RAA    PR     P  R ++   R  R        RA
Sbjct: 374 PHVSSPVL--KLSKWPPWAVHSRAARTPAPRTARATPAPRRENSPARGPRRSPGESAGRA 431

Query: 509 QGQASPG 529
            G A PG
Sbjct: 432 PGPAPPG 438


>UniRef50_Q6Z7U6 Cluster: Putative uncharacterized protein
           P0471A11.42; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0471A11.42 - Oryza sativa subsp. japonica (Rice)
          Length = 163

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +2

Query: 431 EGPTKRAKSCCCRNERHPADTGRWRAQGQASPGIFNSRGAADGSDISSRRFI 586
           +G  +RA     R++     T  WRA G AS G    RGAA GS+ S+ R++
Sbjct: 23  KGKRRRAAQSGGRSDNGWQRTEGWRAVGGASAG--RRRGAAGGSEASAGRWV 72


>UniRef50_O00159 Cluster: Myosin-Ic; n=144; root|Rep: Myosin-Ic -
           Homo sapiens (Human)
          Length = 1028

 Score = 32.3 bits (70), Expect = 8.9
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 97  VLPALSAEDVSYQACVDKYSRKGYQP 174
           VL AL +E + Y   V KY RKGY+P
Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 660,123,444
Number of Sequences: 1657284
Number of extensions: 14489954
Number of successful extensions: 44432
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 42734
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44395
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).