SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000E47F16 Cluster: PREDICTED: similar to ribosomal ...   138   2e-32
UniRef50_P61513 Cluster: 60S ribosomal protein L37a; n=137; Euka...   136   7e-32
UniRef50_O96184 Cluster: 60S ribosomal protein L37a; n=37; Eukar...   132   2e-30
UniRef50_Q7RAQ3 Cluster: Ribosomal L37ae protein family, putativ...   122   2e-27
UniRef50_Q6C3I3 Cluster: Similarity; n=2; Dikarya|Rep: Similarit...   116   1e-25
UniRef50_Q00VK4 Cluster: 60S ribosomal protein L37; n=1; Ostreoc...   103   1e-21
UniRef50_A0E0Z9 Cluster: Chromosome undetermined scaffold_72, wh...   102   1e-21
UniRef50_Q7S1Z1 Cluster: Putative uncharacterized protein NCU075...    86   2e-16
UniRef50_O74106 Cluster: 50S ribosomal protein L37Ae; n=7; Eurya...    73   9e-13
UniRef50_O30179 Cluster: 50S ribosomal protein L37Ae; n=3; cellu...    73   1e-12
UniRef50_Q8TYC3 Cluster: 50S ribosomal protein L37Ae; n=4; Eurya...    71   4e-12
UniRef50_Q9YC06 Cluster: 50S ribosomal protein L37Ae; n=9; Archa...    70   9e-12
UniRef50_Q6L225 Cluster: 50S ribosomal protein L37Ae; n=4; Therm...    69   3e-11
UniRef50_Q6M0M1 Cluster: 50S ribosomal protein L37Ae; n=6; Metha...    69   3e-11
UniRef50_Q74N55 Cluster: 50S ribosomal protein L37Ae; n=1; Nanoa...    68   3e-11
UniRef50_Q8ZVN1 Cluster: 50S ribosomal protein L37Ae; n=7; Therm...    67   6e-11
UniRef50_P60619 Cluster: 50S ribosomal protein L37Ae; n=5; Halob...    60   9e-09
UniRef50_A7I9C5 Cluster: Ribosomal protein L37a; n=1; Candidatus...    60   1e-08
UniRef50_Q3LWL0 Cluster: Ribosomal protein L37ae; n=1; Bigelowie...    59   2e-08
UniRef50_Q0W2Y6 Cluster: 50S ribosomal protein L37AE; n=6; Eurya...    57   9e-08
UniRef50_A7DRS5 Cluster: Putative uncharacterized protein; n=1; ...    55   3e-07
UniRef50_A0RXT9 Cluster: Ribosomal protein L37AE/L43A; n=1; Cena...    48   3e-05
UniRef50_A2Q538 Cluster: Ribosomal L37ae protein; n=1; Medicago ...    39   0.019
UniRef50_UPI00015B4280 Cluster: PREDICTED: similar to ENSANGP000...    34   0.53 
UniRef50_Q6RKI1 Cluster: Polyketide synthase; n=5; Eukaryota|Rep...    33   1.6  
UniRef50_A7PD66 Cluster: Chromosome chr17 scaffold_12, whole gen...    32   2.1  
UniRef50_A5BQ29 Cluster: Putative uncharacterized protein; n=1; ...    32   2.1  
UniRef50_Q17JM9 Cluster: Predicted protein; n=1; Aedes aegypti|R...    32   2.8  
UniRef50_Q0UXB7 Cluster: Putative uncharacterized protein; n=1; ...    32   2.8  
UniRef50_Q7LZW2 Cluster: Polyprotein; n=1; Sugarcane bacilliform...    31   3.7  
UniRef50_A3CM43 Cluster: Antirepressor regulating drug resistanc...    31   3.7  
UniRef50_Q4SW89 Cluster: Chromosome undetermined SCAF13668, whol...    31   4.9  
UniRef50_Q1Q090 Cluster: Putative uncharacterized protein; n=1; ...    31   4.9  
UniRef50_Q53MZ6 Cluster: Integrase core domain, putative; n=13; ...    31   4.9  
UniRef50_Q2R3S2 Cluster: Retrotransposon protein, putative, uncl...    31   4.9  
UniRef50_Q01MF0 Cluster: OSIGBa0091B08.6 protein; n=1; Oryza sat...    31   4.9  
UniRef50_Q01J06 Cluster: OSIGBa0145C12.6 protein; n=2; Oryza sat...    31   4.9  
UniRef50_UPI0000DB718D Cluster: PREDICTED: similar to Brahma ass...    31   6.5  
UniRef50_UPI000049A299 Cluster: ubiquitin carboxyl-terminal hydr...    31   6.5  
UniRef50_Q14VX1 Cluster: ORF135; n=1; Ranid herpesvirus 2|Rep: O...    31   6.5  
UniRef50_Q6D9N6 Cluster: Putative exported protein; n=1; Pectoba...    31   6.5  
UniRef50_Q0BFG0 Cluster: Putative uncharacterized protein; n=1; ...    31   6.5  
UniRef50_A6PS51 Cluster: Putative uncharacterized protein precur...    31   6.5  
UniRef50_Q2QP29 Cluster: Retrotransposon protein, putative, uncl...    31   6.5  
UniRef50_A1Z9R4 Cluster: CG17390-PA; n=3; Sophophora|Rep: CG1739...    31   6.5  
UniRef50_Q1LN88 Cluster: ISSod11, transposase; n=1; Ralstonia me...    30   8.6  
UniRef50_A4ED20 Cluster: Putative uncharacterized protein; n=1; ...    30   8.6  
UniRef50_Q3EBP9 Cluster: Uncharacterized protein At2g32770.3; n=...    30   8.6  
UniRef50_O48840 Cluster: Putative purple acid phosphatase; n=1; ...    30   8.6  
UniRef50_A3BHI4 Cluster: Putative uncharacterized protein; n=1; ...    30   8.6  
UniRef50_Q22469 Cluster: Putative uncharacterized protein; n=5; ...    30   8.6  

>UniRef50_UPI0000E47F16 Cluster: PREDICTED: similar to ribosomal
           protein L37a; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to ribosomal protein L37a -
           Strongylocentrotus purpuratus
          Length = 141

 Score =  138 bits (335), Expect = 2e-32
 Identities = 60/75 (80%), Positives = 68/75 (90%)
 Frame = +2

Query: 29  AKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           AKRT+KVGITGKYGTRYGASLRKMVKK+E++QH K TC FCGKD+MKR  VGIW CK C+
Sbjct: 51  AKRTRKVGITGKYGTRYGASLRKMVKKIEISQHGKCTCVFCGKDSMKRKVVGIWHCKICR 110

Query: 209 RTVAGGAWVFSTTAA 253
           +TVAGGAWV+STTAA
Sbjct: 111 KTVAGGAWVYSTTAA 125


>UniRef50_P61513 Cluster: 60S ribosomal protein L37a; n=137;
           Eukaryota|Rep: 60S ribosomal protein L37a - Homo sapiens
           (Human)
          Length = 92

 Score =  136 bits (330), Expect = 7e-32
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>UniRef50_O96184 Cluster: 60S ribosomal protein L37a; n=37;
           Eukaryota|Rep: 60S ribosomal protein L37a - Plasmodium
           falciparum (isolate 3D7)
          Length = 96

 Score =  132 bits (318), Expect = 2e-30
 Identities = 55/79 (69%), Positives = 66/79 (83%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           M++RTKKVG+TGKYGTRYG+SLRK +KK+E+ QHAKY C+FCGK A KR+CVGIW CK+C
Sbjct: 1   MSRRTKKVGLTGKYGTRYGSSLRKQIKKIELMQHAKYLCTFCGKTATKRTCVGIWKCKKC 60

Query: 206 KRTVAGGAWVFSTTAAYHA 262
           KR V GGAW  +T AA  A
Sbjct: 61  KRKVCGGAWSLTTPAAVAA 79


>UniRef50_Q7RAQ3 Cluster: Ribosomal L37ae protein family, putative;
           n=1; Plasmodium yoelii yoelii|Rep: Ribosomal L37ae
           protein family, putative - Plasmodium yoelii yoelii
          Length = 116

 Score =  122 bits (294), Expect = 2e-27
 Identities = 51/73 (69%), Positives = 59/73 (80%)
 Frame = +2

Query: 44  KVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAG 223
           KVG+TGKYGTRYG+SLRK +KK+E+ QHAKY CSFCGK A KR+CVGIW CK+CKR   G
Sbjct: 27  KVGLTGKYGTRYGSSLRKQIKKIELMQHAKYLCSFCGKTATKRTCVGIWECKKCKRKTCG 86

Query: 224 GAWVFSTTAAYHA 262
           GAW  +T AA  A
Sbjct: 87  GAWSLTTPAAVAA 99


>UniRef50_Q6C3I3 Cluster: Similarity; n=2; Dikarya|Rep: Similarity -
           Yarrowia lipolytica (Candida lipolytica)
          Length = 121

 Score =  116 bits (278), Expect = 1e-25
 Identities = 47/74 (63%), Positives = 59/74 (79%)
 Frame = +2

Query: 32  KRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKR 211
           KRTKKVGITGKYG RYG+SLR+  KK+E+ QH++Y C+FCGK  ++R  VGIW+C  CK+
Sbjct: 32  KRTKKVGITGKYGVRYGSSLRRQCKKLEIQQHSRYDCTFCGKTTVRRGAVGIWTCSACKK 91

Query: 212 TVAGGAWVFSTTAA 253
           TVAGGA+  ST  A
Sbjct: 92  TVAGGAYTVSTATA 105


>UniRef50_Q00VK4 Cluster: 60S ribosomal protein L37; n=1;
           Ostreococcus tauri|Rep: 60S ribosomal protein L37 -
           Ostreococcus tauri
          Length = 133

 Score =  103 bits (246), Expect = 1e-21
 Identities = 44/65 (67%), Positives = 51/65 (78%)
 Frame = +2

Query: 50  GITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGA 229
           GI GKYGTRYGASLRK+VKK EV+QH+K+ C FCGK  MKR  VGIW CK C +T AGGA
Sbjct: 50  GIVGKYGTRYGASLRKVVKKTEVSQHSKFFCDFCGKYGMKRQAVGIWCCKGCNKTKAGGA 109

Query: 230 WVFST 244
           +  +T
Sbjct: 110 YSLNT 114


>UniRef50_A0E0Z9 Cluster: Chromosome undetermined scaffold_72, whole
           genome shotgun sequence; n=10; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_72,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 145

 Score =  102 bits (245), Expect = 1e-21
 Identities = 44/79 (55%), Positives = 57/79 (72%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           M K+TKKVGITGKYGTRYGASLRK++KK E++QH +Y  +F G  ++KR  +GIW C + 
Sbjct: 1   MTKKTKKVGITGKYGTRYGASLRKIIKKFEISQHQRYFNTFTGAHSLKRQAIGIWRCTQT 60

Query: 206 KRTVAGGAWVFSTTAAYHA 262
              +AGGAW  +T A   A
Sbjct: 61  GLQIAGGAWEVNTPAGLSA 79


>UniRef50_Q7S1Z1 Cluster: Putative uncharacterized protein
           NCU07562.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU07562.1 - Neurospora crassa
          Length = 137

 Score = 85.8 bits (203), Expect = 2e-16
 Identities = 38/60 (63%), Positives = 49/60 (81%)
 Frame = +2

Query: 74  RYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAA 253
           RYGASL++     EV+QHA+YTC+FCGK+ ++RS VGIWSCK CK+T+AGGA+  ST AA
Sbjct: 67  RYGASLQQ-----EVSQHARYTCTFCGKNTVRRSSVGIWSCKACKKTLAGGAYTVSTPAA 121


>UniRef50_O74106 Cluster: 50S ribosomal protein L37Ae; n=7;
           Euryarchaeota|Rep: 50S ribosomal protein L37Ae -
           Pyrococcus horikoshii
          Length = 83

 Score = 73.3 bits (172), Expect = 9e-13
 Identities = 31/71 (43%), Positives = 42/71 (59%)
 Frame = +2

Query: 38  TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTV 217
           TKKVG  G++G RYG  +R+ V  +E     K+ C  CG+ A+KR   GIW C +C    
Sbjct: 4   TKKVGSAGRFGARYGLKIRRRVAAVEAKMRQKHVCPVCGRRAVKRISTGIWQCTKCGAIF 63

Query: 218 AGGAWVFSTTA 250
           AGGA++  T A
Sbjct: 64  AGGAYLPVTPA 74


>UniRef50_O30179 Cluster: 50S ribosomal protein L37Ae; n=3; cellular
           organisms|Rep: 50S ribosomal protein L37Ae -
           Archaeoglobus fulgidus
          Length = 83

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +2

Query: 35  RTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRT 214
           RTKKV   G++G RYG  +R+   ++E  Q  KY C  CGK A+KRS  GIW C+ C   
Sbjct: 3   RTKKVRSAGRFGPRYGLRVRRTWLEIEAVQRQKYVCKKCGKKAVKRSGTGIWECRHCGYK 62

Query: 215 VAGGAW 232
            AGG +
Sbjct: 63  FAGGCY 68


>UniRef50_Q8TYC3 Cluster: 50S ribosomal protein L37Ae; n=4;
           Euryarchaeota|Rep: 50S ribosomal protein L37Ae -
           Methanopyrus kandleri
          Length = 89

 Score = 71.3 bits (167), Expect = 4e-12
 Identities = 32/72 (44%), Positives = 42/72 (58%)
 Frame = +2

Query: 35  RTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRT 214
           RTKKVG  G++G RYG  +R+ V ++E  Q  K+ C  C K A+KR   GIW C +C   
Sbjct: 3   RTKKVGPAGRFGPRYGMRIRRRVAEIESVQRQKHECPVCHKRAVKRVGTGIWRCTKCGAE 62

Query: 215 VAGGAWVFSTTA 250
             GGA+   T A
Sbjct: 63  FTGGAYYPETEA 74


>UniRef50_Q9YC06 Cluster: 50S ribosomal protein L37Ae; n=9;
           Archaea|Rep: 50S ribosomal protein L37Ae - Aeropyrum
           pernix
          Length = 86

 Score = 70.1 bits (164), Expect = 9e-12
 Identities = 30/67 (44%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +2

Query: 35  RTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGK-DAMKRSCVGIWSCKRCKR 211
           RTK VG  G+YG RYG S+RK V+ +   ++  + C FCG    ++R  VG+WSC++C  
Sbjct: 3   RTKVVGPAGRYGPRYGVSVRKRVRDILARRYQPHECPFCGSTGTVRRVSVGVWSCRKCGN 62

Query: 212 TVAGGAW 232
           T AG A+
Sbjct: 63  TWAGAAY 69


>UniRef50_Q6L225 Cluster: 50S ribosomal protein L37Ae; n=4;
           Thermoplasmatales|Rep: 50S ribosomal protein L37Ae -
           Picrophilus torridus
          Length = 85

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 29/69 (42%), Positives = 41/69 (59%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAK T KVG+ G++G RYG ++RK   K  V + A Y C  C +  ++R   GIW C+ C
Sbjct: 1   MAKHTVKVGVAGRFGPRYGVTVRKEWSKYYVQKKAYYVCPKCKQKKVRRIANGIWECRHC 60

Query: 206 KRTVAGGAW 232
               AGG++
Sbjct: 61  SYKFAGGSY 69


>UniRef50_Q6M0M1 Cluster: 50S ribosomal protein L37Ae; n=6;
           Methanococcales|Rep: 50S ribosomal protein L37Ae -
           Methanococcus maripaludis
          Length = 96

 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = +2

Query: 38  TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTV 217
           TKK+G  G++G+RYG  +R  ++ +E+ Q+  Y C  C    +KR+   IW C++C   +
Sbjct: 7   TKKIGSAGRFGSRYGRKIRVRLRDVEIKQNKDYKCPVCAFPKLKRAGTSIWVCEKCGAKI 66

Query: 218 AGGAWVFSTTA 250
           AGGA+   T A
Sbjct: 67  AGGAYTPETGA 77


>UniRef50_Q74N55 Cluster: 50S ribosomal protein L37Ae; n=1;
           Nanoarchaeum equitans|Rep: 50S ribosomal protein L37Ae -
           Nanoarchaeum equitans
          Length = 86

 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +2

Query: 38  TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTV 217
           TKKVG TG++G RYG  +RK V  +E+ Q  K+ C FC   A+ R   GI+ CK+C +  
Sbjct: 6   TKKVGPTGRFGPRYGLGIRKRVLTVEIKQRKKHVCPFCRSKAVIREAYGIYRCKKCGKQF 65

Query: 218 AGGAW 232
            G A+
Sbjct: 66  TGLAY 70


>UniRef50_Q8ZVN1 Cluster: 50S ribosomal protein L37Ae; n=7;
           Thermoproteales|Rep: 50S ribosomal protein L37Ae -
           Pyrobaculum aerophilum
          Length = 101

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 32/70 (45%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +2

Query: 38  TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC-GKDAMKRSCVGIWSCKRCKRT 214
           TK VG  G+YG RYG  LR+ V  +EV Q  K+ C  C     ++R   GIW C +C  T
Sbjct: 6   TKIVGPAGRYGARYGMGLRRKVTAIEVKQRGKHRCPSCRSLVRLERIAFGIWRCPKCGFT 65

Query: 215 VAGGAWVFST 244
            AGGAW   T
Sbjct: 66  FAGGAWTPQT 75


>UniRef50_P60619 Cluster: 50S ribosomal protein L37Ae; n=5;
           Halobacteriaceae|Rep: 50S ribosomal protein L37Ae -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 92

 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 24/69 (34%), Positives = 38/69 (55%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MA ++ K G +G++G RYG   R+ V ++E   +  + C  CG+D + R   GIW C  C
Sbjct: 1   MASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYC 60

Query: 206 KRTVAGGAW 232
                GG++
Sbjct: 61  DYKFTGGSY 69


>UniRef50_A7I9C5 Cluster: Ribosomal protein L37a; n=1; Candidatus
           Methanoregula boonei 6A8|Rep: Ribosomal protein L37a -
           Methanoregula boonei (strain 6A8)
          Length = 99

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 25/64 (39%), Positives = 36/64 (56%)
 Frame = +2

Query: 41  KKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVA 220
           K  G  G++G RYG  +RK V +ME    A + C  C   +++R   GIW C++C    A
Sbjct: 11  KVTGSAGRFGCRYGRFVRKRVAEMEKISRASHRCPKCDTQSVERKGTGIWLCRKCGYKFA 70

Query: 221 GGAW 232
           GGA+
Sbjct: 71  GGAY 74


>UniRef50_Q3LWL0 Cluster: Ribosomal protein L37ae; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L37ae - Bigelowiella
           natans (Pedinomonas minutissima) (Chlorarachnion
           sp.(strain CCMP 621))
          Length = 76

 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 27/69 (39%), Positives = 39/69 (56%)
 Frame = +2

Query: 32  KRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKR 211
           K  KK  +  K+G +YG+SLR    K+E      Y C FC K A+ +   G+W CK+C +
Sbjct: 4   KNIKK--LCSKFGAKYGSSLRIRYMKIEKICKKTYKCIFCNKLAIIKVSTGLWKCKKCHQ 61

Query: 212 TVAGGAWVF 238
            + GGA+ F
Sbjct: 62  QMTGGAYGF 70


>UniRef50_Q0W2Y6 Cluster: 50S ribosomal protein L37AE; n=6;
           Euryarchaeota|Rep: 50S ribosomal protein L37AE -
           Uncultured methanogenic archaeon RC-I
          Length = 96

 Score = 56.8 bits (131), Expect = 9e-08
 Identities = 27/75 (36%), Positives = 40/75 (53%)
 Frame = +2

Query: 20  TKMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCK 199
           TK AK  +K    G++G RYG   R +V  +E      + C  CG+ ++ R   GIWSC 
Sbjct: 3   TKSAKG-RKTRSAGRWGCRYGRKARNLVADIEGNMRQAHKCPKCGRMSVWREGTGIWSCI 61

Query: 200 RCKRTVAGGAWVFST 244
           +CK +  GG ++  T
Sbjct: 62  KCKYSYTGGTYLPQT 76


>UniRef50_A7DRS5 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Nitrosopumilus maritimus SCM1|Rep: Putative
           uncharacterized protein - Candidatus Nitrosopumilus
           maritimus SCM1
          Length = 70

 Score = 55.2 bits (127), Expect = 3e-07
 Identities = 23/55 (41%), Positives = 29/55 (52%)
 Frame = +2

Query: 68  GTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAW 232
           G RYG  +RK   K+ +    K  C  CG     R  VGIWSCK+C   +AG A+
Sbjct: 12  GARYGIKIRKQYTKIHLQLKEKRACPECGSKTFGRDAVGIWSCKKCSFKIAGTAY 66


>UniRef50_A0RXT9 Cluster: Ribosomal protein L37AE/L43A; n=1;
           Cenarchaeum symbiosum|Rep: Ribosomal protein L37AE/L43A
           - Cenarchaeum symbiosum
          Length = 69

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 22/55 (40%), Positives = 27/55 (49%)
 Frame = +2

Query: 68  GTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAW 232
           G RYG  +RK   K+      K  C  CG     R  VGIW C++C   VAG A+
Sbjct: 11  GARYGIKIRKEYTKIHFQLKEKRPCPECGSAKFGRVAVGIWECRKCGFKVAGTAY 65


>UniRef50_A2Q538 Cluster: Ribosomal L37ae protein; n=1; Medicago
           truncatula|Rep: Ribosomal L37ae protein - Medicago
           truncatula (Barrel medic)
          Length = 36

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 16/22 (72%), Positives = 19/22 (86%)
 Frame = +2

Query: 68  GTRYGASLRKMVKKMEVTQHAK 133
           GTRY ASL K +KKMEV+QH+K
Sbjct: 9   GTRYSASLHKQIKKMEVSQHSK 30


>UniRef50_UPI00015B4280 Cluster: PREDICTED: similar to
           ENSANGP00000012345; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000012345 - Nasonia
           vitripennis
          Length = 706

 Score = 34.3 bits (75), Expect = 0.53
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = -2

Query: 249 AVVENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQV 136
           +++ N  APP  +    +Q Q+P Q++++  +PQ++QV
Sbjct: 557 SLMSNPMAPPPHMTQQHMQPQVPQQQQYMQQVPQSQQV 594


>UniRef50_Q6RKI1 Cluster: Polyketide synthase; n=5; Eukaryota|Rep:
           Polyketide synthase - Botrytis cinerea (Noble rot
           fungus) (Botryotinia fuckeliana)
          Length = 460

 Score = 32.7 bits (71), Expect = 1.6
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +2

Query: 161 AMKRSCVGIWSCKRCKRTVAGGAWVFSTTAAYHADLLSGGYV 286
           A+  +C  IWS + C R VAGG  V S+   Y  +L SGG++
Sbjct: 204 AINTACRAIWSGE-CTRAVAGGTNVISSPGDYQ-NLQSGGFL 243


>UniRef50_A7PD66 Cluster: Chromosome chr17 scaffold_12, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr17 scaffold_12, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 277

 Score = 32.3 bits (70), Expect = 2.1
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +2

Query: 86  SLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVG 184
           +L KM K +E  +H KY C FC K+      +G
Sbjct: 70  ALSKMEKSVEKPEHKKYECQFCLKEFANSQALG 102


>UniRef50_A5BQ29 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 196

 Score = 32.3 bits (70), Expect = 2.1
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +2

Query: 86  SLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVG 184
           +L KM K +E  +H KY C FC K+      +G
Sbjct: 70  ALSKMEKSVEKPEHKKYECQFCLKEFANSQALG 102


>UniRef50_Q17JM9 Cluster: Predicted protein; n=1; Aedes aegypti|Rep:
           Predicted protein - Aedes aegypti (Yellowfever mosquito)
          Length = 1131

 Score = 31.9 bits (69), Expect = 2.8
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 89  LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           L + ++  E  +  +YTCSFCG+    R C  + S +RC
Sbjct: 605 LMRHMRGHESLEEGRYTCSFCGRKCKSRPC--LISHERC 641


>UniRef50_Q0UXB7 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 376

 Score = 31.9 bits (69), Expect = 2.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 113 EVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           E   +  Y C+ C +D +KR   G+WSC+ C
Sbjct: 187 EDIDNGHYECAICTED-VKRHSRGVWSCRTC 216


>UniRef50_Q7LZW2 Cluster: Polyprotein; n=1; Sugarcane bacilliform
           virus|Rep: Polyprotein - Sugarcane bacilliform virus
          Length = 199

 Score = 31.5 bits (68), Expect = 3.7
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 95  KMVKKMEVTQHAKYTCSFCGK-DAMKRSCVGIWSCKRCKRTVAGGAWVFSTT 247
           +++  ME+       C  CG  D + + C    SCKRC +TV  G +++  T
Sbjct: 34  RVLGAMEIDLSKGCRCYVCGSPDHLMKDCK---SCKRCLKTVTKGQYIYCRT 82


>UniRef50_A3CM43 Cluster: Antirepressor regulating drug resistance
           (Membrane-bound), putative; n=2; Streptococcus|Rep:
           Antirepressor regulating drug resistance
           (Membrane-bound), putative - Streptococcus sanguinis
           (strain SK36)
          Length = 485

 Score = 31.5 bits (68), Expect = 3.7
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = +2

Query: 62  KYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKR 211
           +Y T YG ++  M+ + + T  A  TC +  K  +KR  VGI   +  KR
Sbjct: 259 EYRTFYGETILTMIDRSKKTPIALTTCFYSDKFNLKRRIVGIMDNRLPKR 308


>UniRef50_Q4SW89 Cluster: Chromosome undetermined SCAF13668, whole
           genome shotgun sequence; n=5; Euteleostomi|Rep:
           Chromosome undetermined SCAF13668, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 277

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +2

Query: 74  RYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCV 181
           R  ASL   +KK +     +++CS CGK   K+ CV
Sbjct: 215 RQKASLNWHMKKHDADATYQFSCSICGKKFEKKDCV 250


>UniRef50_Q1Q090 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Kuenenia stuttgartiensis|Rep: Putative
           uncharacterized protein - Candidatus Kuenenia
           stuttgartiensis
          Length = 282

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +2

Query: 107 KMEVTQHAKYTCSFCGKDAMKRSCVGIWS-CKRCKRTVAGGAWVFSTTAAYH 259
           K EV+     TCS CGK   +    GI + C +C R  AG   +  TT   H
Sbjct: 124 KTEVSAAKTSTCSICGKVVGENHICGITTYCSQCGRE-AGSGHICGTTQFCH 174


>UniRef50_Q53MZ6 Cluster: Integrase core domain, putative; n=13;
           Magnoliophyta|Rep: Integrase core domain, putative -
           Oryza sativa subsp. japonica (Rice)
          Length = 1584

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +2

Query: 83  ASLRKMVKKMEVTQHA-KYTCSFCGKD 160
           A + K      V+ H  KYTCSFCGKD
Sbjct: 455 ACVAKSSNATNVSNHCEKYTCSFCGKD 481


>UniRef50_Q2R3S2 Cluster: Retrotransposon protein, putative,
           unclassified; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 991

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +2

Query: 83  ASLRKMVKKMEVTQHA-KYTCSFCGKD 160
           A + K      V+ H  KYTCSFCGKD
Sbjct: 389 ACVAKSSNATNVSNHCEKYTCSFCGKD 415


>UniRef50_Q01MF0 Cluster: OSIGBa0091B08.6 protein; n=1; Oryza
           sativa|Rep: OSIGBa0091B08.6 protein - Oryza sativa
           (Rice)
          Length = 929

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +2

Query: 83  ASLRKMVKKMEVTQHA-KYTCSFCGKD 160
           A + K      V+ H  KYTCSFCGKD
Sbjct: 423 ACVAKSSNSTNVSNHREKYTCSFCGKD 449


>UniRef50_Q01J06 Cluster: OSIGBa0145C12.6 protein; n=2; Oryza
           sativa|Rep: OSIGBa0145C12.6 protein - Oryza sativa
           (Rice)
          Length = 1313

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +2

Query: 83  ASLRKMVKKMEVTQHA-KYTCSFCGKD 160
           A + K      V+ H  KYTCSFCGKD
Sbjct: 629 ACVAKSSNSTNVSNHREKYTCSFCGKD 655


>UniRef50_UPI0000DB718D Cluster: PREDICTED: similar to Brahma
           associated protein 170kD CG3274-PA; n=1; Apis
           mellifera|Rep: PREDICTED: similar to Brahma associated
           protein 170kD CG3274-PA - Apis mellifera
          Length = 829

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = -2

Query: 213 VLLHRLQDQMPTQERFIASLPQNEQVYFACWVTSIFLTILRREAP*RVPYLPVIPT--FL 40
           ++L       PTQ++ +A  PQ +QV     VT +   IL+  A   +P  P++PT   +
Sbjct: 436 IILQSQAAAQPTQQKMVAVTPQGQQVV----VTQVSRPILQSPALGNIP-PPLVPTSGTI 490

Query: 39  VRLAILVNLS 10
            + +I+VN S
Sbjct: 491 PQTSIIVNSS 500


>UniRef50_UPI000049A299 Cluster: ubiquitin carboxyl-terminal
           hydrolase; n=2; Entamoeba histolytica HM-1:IMSS|Rep:
           ubiquitin carboxyl-terminal hydrolase - Entamoeba
           histolytica HM-1:IMSS
          Length = 1477

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 3/62 (4%)
 Frame = +2

Query: 5   VSERFTKMAKRTKKVGITG-KYGTRYGASLRKMVKKMEVTQHAKYTCSFCGK--DAMKRS 175
           +SE   K       + + G K  T    SL+ +V   E+T   KY C  C K  DA++R+
Sbjct: 425 ISEHEEKTICEQMNIVVFGEKNKTSLTESLQSLVNGDELTGENKYFCEKCKKKVDAIRRT 484

Query: 176 CV 181
           C+
Sbjct: 485 CI 486


>UniRef50_Q14VX1 Cluster: ORF135; n=1; Ranid herpesvirus 2|Rep:
           ORF135 - Ranid herpesvirus 2
          Length = 545

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = +1

Query: 1   FCIGEVYQNGQTYQKGWNY-WQIWHTLRC 84
           FCI   ++ GQ +  GW++  Q+WH+  C
Sbjct: 486 FCISCAWKTGQDHVGGWDFITQLWHSKLC 514


>UniRef50_Q6D9N6 Cluster: Putative exported protein; n=1;
           Pectobacterium atrosepticum|Rep: Putative exported
           protein - Erwinia carotovora subsp. atroseptica
           (Pectobacterium atrosepticum)
          Length = 123

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 46  GWNYWQIWHTLRC 84
           GW +W+IWH  RC
Sbjct: 77  GWGFWKIWHAPRC 89


>UniRef50_Q0BFG0 Cluster: Putative uncharacterized protein; n=1;
           Burkholderia ambifaria AMMD|Rep: Putative
           uncharacterized protein - Burkholderia cepacia (strain
           ATCC 53795 / AMMD)
          Length = 130

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +2

Query: 131 KYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTA 250
           ++  S CG+ A KR CV + + +    TVAG A V ST A
Sbjct: 85  QWRSSACGRHAAKRRCVALGATR--SLTVAGAAQVGSTAA 122


>UniRef50_A6PS51 Cluster: Putative uncharacterized protein
           precursor; n=1; Victivallis vadensis ATCC BAA-548|Rep:
           Putative uncharacterized protein precursor - Victivallis
           vadensis ATCC BAA-548
          Length = 581

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +1

Query: 142 LILW*GCYETFLCRHLVL*AMQEDCSRRSLGILHYC 249
           L+ W GC  TFL  +L+L   Q  C + ++ ++ +C
Sbjct: 52  LLFWSGCGLTFLLLYLILAFYQRFCGKSNVFLIRWC 87


>UniRef50_Q2QP29 Cluster: Retrotransposon protein, putative,
           unclassified; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1417

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%)
 Frame = +2

Query: 83  ASLRKMVKKMEVTQHA-KYTCSFCGKD 160
           A + K      V  H  KYTCSFCGKD
Sbjct: 308 AHVAKSTNATNVPNHREKYTCSFCGKD 334


>UniRef50_A1Z9R4 Cluster: CG17390-PA; n=3; Sophophora|Rep:
           CG17390-PA - Drosophila melanogaster (Fruit fly)
          Length = 1290

 Score = 30.7 bits (66), Expect = 6.5
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +2

Query: 59  GKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGK 157
           G YG+ +G S   M+  M   +H  + C +C K
Sbjct: 219 GWYGSEFGLSAYGMLMAMSHAEHLPFKCEYCSK 251


>UniRef50_Q1LN88 Cluster: ISSod11, transposase; n=1; Ralstonia
           metallidurans CH34|Rep: ISSod11, transposase - Ralstonia
           metallidurans (strain CH34 / ATCC 43123 / DSM 2839)
          Length = 193

 Score = 30.3 bits (65), Expect = 8.6
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = +2

Query: 134 YTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGA 229
           ++C  C  DA  R   G W CK C+R ++  A
Sbjct: 32  FSCPGCSGDAGWRMSDGRWWCKACRRRISATA 63


>UniRef50_A4ED20 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 440

 Score = 30.3 bits (65), Expect = 8.6
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +2

Query: 113 EVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           E+ Q+A Y CS CG + +    V + +C  C
Sbjct: 72  ELAQNAGYICSSCGAELVSDGTVAVTTCPYC 102


>UniRef50_Q3EBP9 Cluster: Uncharacterized protein At2g32770.3; n=38;
           Magnoliophyta|Rep: Uncharacterized protein At2g32770.3 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 545

 Score = 30.3 bits (65), Expect = 8.6
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +1

Query: 10  GEVYQNGQTYQKGWNYW 60
           G  Y +G+TYQ  W+YW
Sbjct: 261 GSCYSSGETYQPRWDYW 277


>UniRef50_O48840 Cluster: Putative purple acid phosphatase; n=1;
           Arabidopsis thaliana|Rep: Putative purple acid
           phosphatase - Arabidopsis thaliana (Mouse-ear cress)
          Length = 516

 Score = 30.3 bits (65), Expect = 8.6
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +1

Query: 10  GEVYQNGQTYQKGWNYW 60
           G  Y +G+TYQ  W+YW
Sbjct: 261 GSCYSSGETYQPRWDYW 277


>UniRef50_A3BHI4 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 317

 Score = 30.3 bits (65), Expect = 8.6
 Identities = 14/34 (41%), Positives = 17/34 (50%)
 Frame = +2

Query: 158 DAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAAYH 259
           DA++R C G W   +C R   GG   F   A YH
Sbjct: 19  DALQRFC-GAWRDMQCSRRGGGGGDAFVVGAVYH 51


>UniRef50_Q22469 Cluster: Putative uncharacterized protein; n=5;
           Bilateria|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 500

 Score = 30.3 bits (65), Expect = 8.6
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +1

Query: 4   CIGEVYQNGQTYQKGWNYWQIWHTLRCLST*NGQKDGSNPTRKVYLLILW 153
           C  + Y+  + +QK +N W+  H +RCL   N     +N T+    L LW
Sbjct: 410 CGNQTYKGPKAFQKHFNEWRHSHGMRCLGIPN-TSHFANITKIKDALDLW 458


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 320,933,785
Number of Sequences: 1657284
Number of extensions: 6181409
Number of successful extensions: 17460
Number of sequences better than 10.0: 51
Number of HSP's better than 10.0 without gapping: 16716
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17452
length of database: 575,637,011
effective HSP length: 73
effective length of database: 454,655,279
effective search space used: 10002416138
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).